HHsearch alignment for GI: 254781106 and conserved domain: TIGR00242

>TIGR00242 TIGR00242 mraZ protein; InterPro: IPR003444 This family is characterised by a 70 amino acid region and is found duplicated in a group of bacterial proteins. These proteins may be DNA-binding transcription factors, its members are probably enzymes containing a conserved DXXXR motif that probably forms part of the active site. .
Probab=99.90  E-value=1.1e-23  Score=166.82  Aligned_cols=136  Identities=24%  Similarity=0.379  Sum_probs=128.1

Q ss_pred             CCCCCCCCEECCCCCEEECHHHHHHHHHCCCCCEEECCCCCCCEEECCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             42221121056766271078899998524898499516566441304523678999998630688751379999986311
Q gi|254781106|r    3 RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGG   82 (145)
Q Consensus         3 ~F~G~~~~~lD~KGRi~iPa~fR~~L~~~~~~~lv~~~~~~~~~l~~~~~~~w~~~~~~i~~l~~~~~~~~~~~r~~~~~   82 (145)
T Consensus         1 ~~~g~~~~~~d~~~~~~~p~~~~~~~~~~~~g~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (152)
T TIGR00242         1 LFLGAFNVTLDAKGRLSLPAKYREGLLENSAGQLVCLNRGFENCLLLYPLPEWEKIEEKLNALPNTKPDTRRLKRLLFGG   80 (152)
T ss_pred             CCCCCCHHCCCCCCCCCCHHHHHHHHHCCCCCCEEEEECCCHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHCC
T ss_conf             95442000003456300103556553012356344431000013320561467899998862236652578888876326


Q ss_pred             HHHCCCCCCCEEECCHHHHHHCCCCCEEEEEECCCEEEECCHHHHHHHHHHHHHHH
Q ss_conf             11122178614751989998709985399994199899629899999999959999
Q gi|254781106|r   83 GIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEY  138 (145)
Q Consensus        83 a~~~~~D~~GRi~ip~~lr~~agi~~ev~~vG~g~~fEIW~~~~~~~~~~~~~~~~  138 (145)
T Consensus        81 ~~~~~~d~~g~~~~~~~~~~~~~~~~~~~~~g~~~~~~~w~~~~~~~~~~~~~~~~  136 (152)
T TIGR00242        81 ATECELDGAGRVLIPGNLLNHAKLEKELVLVGQFNKLELWDKVLWEQYLAEDEDLE  136 (152)
T ss_pred             CCCCCCCCCCCEECCHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             53000034572001202333200222144641232100111244555553223334