BLAST/PSIBLAST alignment of GI: 254781106 and GI: 327191488 at iteration 1
>gi|327191488|gb|EGE58506.1| cell division protein MraZ [Rhizobium etli CNPAF512] Length = 145
 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR I +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 1   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNIQELYCFQDFVFPAISVGGLDLLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 61  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 120

Query: 121 LW 122
           LW
Sbjct: 121 LW 122