PSIBLAST alignment of GI: 254781106 and protein with PDB id: 1n0e

>gi|38492456|pdb|1N0E|A Chain A, Crystal Structure Of A Cell Division And Cell Wall Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae: Indication Of A Novel Fold With A Possible New Conserved Sequence Motif Length = 166
>gi|38492457|pdb|1N0E|B Chain B, Crystal Structure Of A Cell Division And Cell Wall Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae: Indication Of A Novel Fold With A Possible New Conserved Sequence Motif Length = 166
 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      +D+K R+S+P   R                 F   + V      + + ++ 
Sbjct: 26  MLLGTFNITLDAKNRISLPAKLRA-----FFEGSIVINRGFENCLEVRKPQDFQKYFEQF 80

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W
Sbjct: 81  NSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIW 140

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      S +     + ++
Sbjct: 141 DKKLYEDYLANSES--LETVAER 161