BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781106|ref|YP_003065519.1| cell division protein MraZ
[Candidatus Liberibacter asiaticus str. psy62]
         (145 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|121998879|ref|YP_001003666.1| cell division protein MraZ [Halorhodospira halophila SL1]
 gi|167012247|sp|A1WYV2|MRAZ_HALHL RecName: Full=Protein MraZ
 gi|121590284|gb|ABM62864.1| MraZ protein [Halorhodospira halophila SL1]
          Length = 152

 Score =  150 bits (380), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 60/142 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++ P   R  L   C  ++    D+    +        E  E+K+
Sbjct: 1   MFRGVNQLNLDAKGRLAFPSRHRDRLLSHCSGEVVATIDYRDRCLVFYPLPEWEEIERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +L  L+ G    L++D  GR L+   +R + G+E  V  +G+GN F+LW
Sbjct: 61  IALPDLQPSAKRLKRLLIGHAQELQVDGNGRALVPPPLREYAGLEKRVVLIGQGNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + + + +   E      +
Sbjct: 121 DESLWEQRRADWLQEAAAADAE 142


>gi|254455571|ref|ZP_05069000.1| cell division protein MraZ [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082573|gb|EDZ59999.1| cell division protein MraZ [Candidatus Pelagibacter sp. HTCC7211]
          Length = 155

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 67/136 (49%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FLS    K+D KGRVSVP  FR+ L+      + C+  F   +I   + D +E     I
Sbjct: 1   MFLSTYENKLDKKGRVSVPASFRSHLSNLGYNGVICYPSFNNSSIEACSQDRIEKISSVI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              NPF  + +  +  +      L+ DSEGRI ++  +     I+N + FVG+G  FQ+W
Sbjct: 61  DSLNPFEEKRDYFATSILAESTNLQFDSEGRISLSSKLLKHAKIKNSMLFVGQGQTFQIW 120

Query: 123 NPQTFRKLQEESRNEY 138
            P  F K +  +R + 
Sbjct: 121 EPTAFEKFKVNARKKA 136


>gi|215485247|ref|YP_002327678.1| cell division protein MraZ [Escherichia coli O127:H6 str. E2348/69]
 gi|312966209|ref|ZP_07780435.1| protein MraZ [Escherichia coli 2362-75]
 gi|254813277|sp|B7UID1|MRAZ_ECO27 RecName: Full=Protein MraZ
 gi|215263319|emb|CAS07634.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|312289452|gb|EFR17346.1| protein MraZ [Escherichia coli 2362-75]
 gi|323190237|gb|EFZ75513.1| protein MraZ [Escherichia coli RN587/1]
          Length = 152

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSTNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|16128074|ref|NP_414623.1| conserved protein, MraZ family [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89106964|ref|AP_000744.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|188492777|ref|ZP_03000047.1| MraZ protein [Escherichia coli 53638]
 gi|301028562|ref|ZP_07191793.1| protein MraZ [Escherichia coli MS 196-1]
 gi|307136682|ref|ZP_07496038.1| cell division protein MraZ [Escherichia coli H736]
 gi|312970175|ref|ZP_07784357.1| protein MraZ [Escherichia coli 1827-70]
 gi|140163|sp|P22186|MRAZ_ECOLI RecName: Full=Protein MraZ
 gi|40849|emb|CAA38858.1| unnamed protein product [Escherichia coli]
 gi|42319|emb|CAA36284.1| unnamed protein product [Escherichia coli str. K-12 substr. W3110]
 gi|1786269|gb|AAC73192.1| conserved protein, MraZ family [Escherichia coli str. K-12 substr.
           MG1655]
 gi|21321962|dbj|BAB96649.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|188487976|gb|EDU63079.1| MraZ protein [Escherichia coli 53638]
 gi|260450712|gb|ACX41134.1| MraZ protein [Escherichia coli DH1]
 gi|299878406|gb|EFI86617.1| protein MraZ [Escherichia coli MS 196-1]
 gi|309700292|emb|CBI99580.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310337673|gb|EFQ02784.1| protein MraZ [Escherichia coli 1827-70]
 gi|315134775|dbj|BAJ41934.1| conserved protein, MraZ family [Escherichia coli DH1]
 gi|315616140|gb|EFU96759.1| protein MraZ [Escherichia coli 3431]
 gi|323935133|gb|EGB31500.1| mraZ protein [Escherichia coli E1520]
 gi|323939879|gb|EGB36079.1| mraZ protein [Escherichia coli E482]
          Length = 152

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D + P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|82775488|ref|YP_401835.1| cell division protein MraZ [Shigella dysenteriae Sd197]
 gi|91207214|sp|Q32K11|MRAZ_SHIDS RecName: Full=Protein MraZ
 gi|81239636|gb|ABB60346.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 152

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  PRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|74310700|ref|YP_309119.1| cell division protein MraZ [Shigella sonnei Ss046]
 gi|91207215|sp|Q3Z5S8|MRAZ_SHISS RecName: Full=Protein MraZ
 gi|73854177|gb|AAZ86884.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|323165964|gb|EFZ51744.1| protein MraZ [Shigella sonnei 53G]
          Length = 152

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +  +  + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAVGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|71082742|ref|YP_265461.1| cell division protein MraZ [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762836|ref|ZP_01264801.1| hypothetical protein PU1002_06186 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91207205|sp|Q4FPN3|MRAZ_PELUB RecName: Full=Protein MraZ
 gi|71061855|gb|AAZ20858.1| Cell division protein MraZ [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91718638|gb|EAS85288.1| hypothetical protein PU1002_06186 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 155

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 68/136 (50%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FLS    KID KGRVSVP  FR+ L+      + C+  F   +I   + D +E     I
Sbjct: 1   MFLSTYENKIDKKGRVSVPASFRSHLSNLGYNGVICYPSFNNQSIEACSQDRIEKLSASI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +PF  + +  +  +    + L+ DSEGRI ++  +     I+N + FVG+G  FQ+W
Sbjct: 61  DSLSPFEEKRDYFATSILSESMNLQFDSEGRISLSTKLLKHAKIKNSMLFVGQGQTFQIW 120

Query: 123 NPQTFRKLQEESRNEY 138
            P  F K +  +R + 
Sbjct: 121 EPAAFEKFKINARKKA 136


>gi|331640534|ref|ZP_08341682.1| MraZ protein [Escherichia coli H736]
 gi|331650978|ref|ZP_08352006.1| MraZ protein [Escherichia coli M718]
 gi|331040280|gb|EGI12487.1| MraZ protein [Escherichia coli H736]
 gi|331051432|gb|EGI23481.1| MraZ protein [Escherichia coli M718]
          Length = 160

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D + P + +      E  EQK+
Sbjct: 9   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPEWEIIEQKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 69  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 128

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 129 DETTWHQQVKEDID--AEQLA 147


>gi|237729379|ref|ZP_04559860.1| cell division protein MraZ [Citrobacter sp. 30_2]
 gi|226909108|gb|EEH95026.1| cell division protein MraZ [Citrobacter sp. 30_2]
          Length = 160

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 9   MFRGATLVNLDSKGRLSVPTRYRDQLLESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 69  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPILRQHAGLTKEVMLVGQFNKFELW 128

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 129 DETTWYQQVKEDIDAEQSVTGALSER 154


>gi|323960027|gb|EGB55673.1| mraZ protein [Escherichia coli H489]
          Length = 152

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|15799765|ref|NP_285777.1| cell division protein MraZ [Escherichia coli O157:H7 EDL933]
 gi|15829339|ref|NP_308112.1| cell division protein MraZ [Escherichia coli O157:H7 str. Sakai]
 gi|82542685|ref|YP_406632.1| cell division protein MraZ [Shigella boydii Sb227]
 gi|110640294|ref|YP_668022.1| cell division protein MraZ [Escherichia coli 536]
 gi|157155426|ref|YP_001461251.1| cell division protein MraZ [Escherichia coli E24377A]
 gi|157159552|ref|YP_001456870.1| cell division protein MraZ [Escherichia coli HS]
 gi|168751409|ref|ZP_02776431.1| MraZ protein [Escherichia coli O157:H7 str. EC4113]
 gi|168755689|ref|ZP_02780696.1| MraZ protein [Escherichia coli O157:H7 str. EC4401]
 gi|168764040|ref|ZP_02789047.1| MraZ protein [Escherichia coli O157:H7 str. EC4501]
 gi|168771305|ref|ZP_02796312.1| MraZ protein [Escherichia coli O157:H7 str. EC4486]
 gi|168776925|ref|ZP_02801932.1| MraZ protein [Escherichia coli O157:H7 str. EC4196]
 gi|168781966|ref|ZP_02806973.1| MraZ protein [Escherichia coli O157:H7 str. EC4076]
 gi|168789608|ref|ZP_02814615.1| MraZ protein [Escherichia coli O157:H7 str. EC869]
 gi|168801508|ref|ZP_02826515.1| MraZ protein [Escherichia coli O157:H7 str. EC508]
 gi|170021563|ref|YP_001726517.1| cell division protein MraZ [Escherichia coli ATCC 8739]
 gi|170079720|ref|YP_001729040.1| hypothetical protein ECDH10B_0063 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170684017|ref|YP_001742203.1| cell division protein MraZ [Escherichia coli SMS-3-5]
 gi|187730835|ref|YP_001878891.1| cell division protein MraZ [Shigella boydii CDC 3083-94]
 gi|191167779|ref|ZP_03029586.1| MraZ protein [Escherichia coli B7A]
 gi|191174643|ref|ZP_03036125.1| MraZ protein [Escherichia coli F11]
 gi|193065872|ref|ZP_03046933.1| MraZ protein [Escherichia coli E22]
 gi|193070827|ref|ZP_03051760.1| MraZ protein [Escherichia coli E110019]
 gi|194429371|ref|ZP_03061896.1| MraZ protein [Escherichia coli B171]
 gi|194434408|ref|ZP_03066670.1| MraZ protein [Shigella dysenteriae 1012]
 gi|195939297|ref|ZP_03084679.1| cell division protein MraZ [Escherichia coli O157:H7 str. EC4024]
 gi|208807965|ref|ZP_03250302.1| mraZ protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812142|ref|ZP_03253471.1| mraZ protein [Escherichia coli O157:H7 str. EC4045]
 gi|208821647|ref|ZP_03261967.1| mraZ protein [Escherichia coli O157:H7 str. EC4042]
 gi|209399832|ref|YP_002268689.1| mraZ protein [Escherichia coli O157:H7 str. EC4115]
 gi|209917274|ref|YP_002291358.1| cell division protein MraZ [Escherichia coli SE11]
 gi|217324288|ref|ZP_03440372.1| mraZ protein [Escherichia coli O157:H7 str. TW14588]
 gi|218552664|ref|YP_002385577.1| cell division protein MraZ [Escherichia coli IAI1]
 gi|218557021|ref|YP_002389934.1| cell division protein MraZ [Escherichia coli S88]
 gi|218687958|ref|YP_002396170.1| cell division protein MraZ [Escherichia coli ED1a]
 gi|218693550|ref|YP_002401217.1| cell division protein MraZ [Escherichia coli 55989]
 gi|218698504|ref|YP_002406133.1| cell division protein MraZ [Escherichia coli IAI39]
 gi|218703341|ref|YP_002410860.1| cell division protein MraZ [Escherichia coli UMN026]
 gi|238899482|ref|YP_002925278.1| hypothetical protein BWG_0076 [Escherichia coli BW2952]
 gi|253774889|ref|YP_003037720.1| cell division protein MraZ [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254160203|ref|YP_003043311.1| cell division protein MraZ [Escherichia coli B str. REL606]
 gi|254791218|ref|YP_003076055.1| cell division protein MraZ [Escherichia coli O157:H7 str. TW14359]
 gi|256020081|ref|ZP_05433946.1| cell division protein MraZ [Shigella sp. D9]
 gi|256025395|ref|ZP_05439260.1| cell division protein MraZ [Escherichia sp. 4_1_40B]
 gi|260842317|ref|YP_003220095.1| hypothetical protein ECO103_0083 [Escherichia coli O103:H2 str.
           12009]
 gi|260853294|ref|YP_003227185.1| hypothetical protein ECO26_0084 [Escherichia coli O26:H11 str.
           11368]
 gi|260866234|ref|YP_003232636.1| hypothetical protein ECO111_0084 [Escherichia coli O111:H- str.
           11128]
 gi|261226838|ref|ZP_05941119.1| hypothetical protein EscherichiacoliO157_19947 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255242|ref|ZP_05947775.1| hypothetical protein EscherichiacoliO157EcO_05374 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291280906|ref|YP_003497724.1| hypothetical protein G2583_0085 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293403153|ref|ZP_06647250.1| mraZ [Escherichia coli FVEC1412]
 gi|293408173|ref|ZP_06652013.1| mraZ protein [Escherichia coli B354]
 gi|293417957|ref|ZP_06660579.1| mraZ protein [Escherichia coli B185]
 gi|293476741|ref|ZP_06665149.1| mraZ protein [Escherichia coli B088]
 gi|297516901|ref|ZP_06935287.1| cell division protein MraZ [Escherichia coli OP50]
 gi|298378683|ref|ZP_06988567.1| mraZ [Escherichia coli FVEC1302]
 gi|306815321|ref|ZP_07449470.1| cell division protein MraZ [Escherichia coli NC101]
 gi|307311468|ref|ZP_07591110.1| MraZ protein [Escherichia coli W]
 gi|331661127|ref|ZP_08362059.1| MraZ protein [Escherichia coli TA206]
 gi|331661455|ref|ZP_08362379.1| MraZ protein [Escherichia coli TA143]
 gi|331666318|ref|ZP_08367199.1| MraZ protein [Escherichia coli TA271]
 gi|331681466|ref|ZP_08382103.1| MraZ protein [Escherichia coli H299]
 gi|54037827|sp|P65435|MRAZ_ECO57 RecName: Full=Protein MraZ
 gi|54041489|sp|P65434|MRAZ_ECOL6 RecName: Full=Protein MraZ
 gi|91207213|sp|Q326F4|MRAZ_SHIBS RecName: Full=Protein MraZ
 gi|123049512|sp|Q0TLQ8|MRAZ_ECOL5 RecName: Full=Protein MraZ
 gi|167012240|sp|A7ZHH2|MRAZ_ECO24 RecName: Full=Protein MraZ
 gi|167012241|sp|A7ZW33|MRAZ_ECOHS RecName: Full=Protein MraZ
 gi|189028619|sp|B1IR97|MRAZ_ECOLC RecName: Full=Protein MraZ
 gi|226709972|sp|B7MAK4|MRAZ_ECO45 RecName: Full=Protein MraZ
 gi|226709973|sp|B5YZB7|MRAZ_ECO5E RecName: Full=Protein MraZ
 gi|226709974|sp|B7NHI7|MRAZ_ECO7I RecName: Full=Protein MraZ
 gi|226709975|sp|B7M124|MRAZ_ECO8A RecName: Full=Protein MraZ
 gi|226709976|sp|B1XC58|MRAZ_ECODH RecName: Full=Protein MraZ
 gi|226709977|sp|B7N7V4|MRAZ_ECOLU RecName: Full=Protein MraZ
 gi|226709978|sp|B6HZ58|MRAZ_ECOSE RecName: Full=Protein MraZ
 gi|226709979|sp|B1LG18|MRAZ_ECOSM RecName: Full=Protein MraZ
 gi|226710015|sp|B2U286|MRAZ_SHIB3 RecName: Full=Protein MraZ
 gi|254813278|sp|B7LFV1|MRAZ_ECO55 RecName: Full=Protein MraZ
 gi|254813279|sp|B7MNU0|MRAZ_ECO81 RecName: Full=Protein MraZ
 gi|259509653|sp|C4ZQ03|MRAZ_ECOBW RecName: Full=Protein MraZ
 gi|12512784|gb|AAG54385.1|AE005185_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13359541|dbj|BAB33508.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|81244096|gb|ABB64804.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110341886|gb|ABG68123.1| protein MraZ [Escherichia coli 536]
 gi|157065232|gb|ABV04487.1| MraZ protein [Escherichia coli HS]
 gi|157077456|gb|ABV17164.1| MraZ protein [Escherichia coli E24377A]
 gi|169756491|gb|ACA79190.1| MraZ protein [Escherichia coli ATCC 8739]
 gi|169887555|gb|ACB01262.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170521735|gb|ACB19913.1| MraZ protein [Escherichia coli SMS-3-5]
 gi|187427827|gb|ACD07101.1| MraZ protein [Shigella boydii CDC 3083-94]
 gi|187767746|gb|EDU31590.1| MraZ protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014543|gb|EDU52665.1| MraZ protein [Escherichia coli O157:H7 str. EC4113]
 gi|189000469|gb|EDU69455.1| MraZ protein [Escherichia coli O157:H7 str. EC4076]
 gi|189357012|gb|EDU75431.1| MraZ protein [Escherichia coli O157:H7 str. EC4401]
 gi|189359884|gb|EDU78303.1| MraZ protein [Escherichia coli O157:H7 str. EC4486]
 gi|189365899|gb|EDU84315.1| MraZ protein [Escherichia coli O157:H7 str. EC4501]
 gi|189370810|gb|EDU89226.1| MraZ protein [Escherichia coli O157:H7 str. EC869]
 gi|189376360|gb|EDU94776.1| MraZ protein [Escherichia coli O157:H7 str. EC508]
 gi|190902205|gb|EDV61947.1| MraZ protein [Escherichia coli B7A]
 gi|190905078|gb|EDV64735.1| MraZ protein [Escherichia coli F11]
 gi|192926459|gb|EDV81092.1| MraZ protein [Escherichia coli E22]
 gi|192955857|gb|EDV86327.1| MraZ protein [Escherichia coli E110019]
 gi|194412591|gb|EDX28888.1| MraZ protein [Escherichia coli B171]
 gi|194417324|gb|EDX33431.1| MraZ protein [Shigella dysenteriae 1012]
 gi|208727766|gb|EDZ77367.1| mraZ protein [Escherichia coli O157:H7 str. EC4206]
 gi|208733419|gb|EDZ82106.1| mraZ protein [Escherichia coli O157:H7 str. EC4045]
 gi|208741770|gb|EDZ89452.1| mraZ protein [Escherichia coli O157:H7 str. EC4042]
 gi|209161232|gb|ACI38665.1| mraZ protein [Escherichia coli O157:H7 str. EC4115]
 gi|209746634|gb|ACI71624.1| hypothetical protein ECs0085 [Escherichia coli]
 gi|209746636|gb|ACI71625.1| hypothetical protein ECs0085 [Escherichia coli]
 gi|209746638|gb|ACI71626.1| hypothetical protein ECs0085 [Escherichia coli]
 gi|209746640|gb|ACI71627.1| hypothetical protein ECs0085 [Escherichia coli]
 gi|209746642|gb|ACI71628.1| hypothetical protein ECs0085 [Escherichia coli]
 gi|209910533|dbj|BAG75607.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|217320509|gb|EEC28933.1| mraZ protein [Escherichia coli O157:H7 str. TW14588]
 gi|218350282|emb|CAU95965.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218359432|emb|CAQ96970.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218363790|emb|CAR01450.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218368490|emb|CAR16225.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218425522|emb|CAR06305.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218430438|emb|CAR11304.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222031912|emb|CAP74650.1| Protein mraZ [Escherichia coli LF82]
 gi|238860425|gb|ACR62423.1| conserved protein [Escherichia coli BW2952]
 gi|242375917|emb|CAQ30598.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253325933|gb|ACT30535.1| MraZ protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972104|gb|ACT37775.1| hypothetical protein ECB_00082 [Escherichia coli B str. REL606]
 gi|253976313|gb|ACT41983.1| hypothetical protein ECD_00082 [Escherichia coli BL21(DE3)]
 gi|254590618|gb|ACT69979.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257751943|dbj|BAI23445.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257757464|dbj|BAI28961.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257762590|dbj|BAI34085.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|281177301|dbj|BAI53631.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284919861|emb|CBG32916.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290760779|gb|ADD54740.1| hypothetical protein G2583_0085 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291321194|gb|EFE60636.1| mraZ protein [Escherichia coli B088]
 gi|291430068|gb|EFF03082.1| mraZ [Escherichia coli FVEC1412]
 gi|291430675|gb|EFF03673.1| mraZ protein [Escherichia coli B185]
 gi|291472424|gb|EFF14906.1| mraZ protein [Escherichia coli B354]
 gi|294492594|gb|ADE91350.1| MraZ protein [Escherichia coli IHE3034]
 gi|298281017|gb|EFI22518.1| mraZ [Escherichia coli FVEC1302]
 gi|305850983|gb|EFM51438.1| cell division protein MraZ [Escherichia coli NC101]
 gi|306908447|gb|EFN38945.1| MraZ protein [Escherichia coli W]
 gi|307551925|gb|ADN44700.1| MraZ protein [Escherichia coli ABU 83972]
 gi|307629655|gb|ADN73959.1| cell division protein MraZ [Escherichia coli UM146]
 gi|312944687|gb|ADR25514.1| cell division protein MraZ [Escherichia coli O83:H1 str. NRG 857C]
 gi|315059304|gb|ADT73631.1| conserved hypothetical protein [Escherichia coli W]
 gi|320172828|gb|EFW48060.1| Cell division protein MraZ [Shigella dysenteriae CDC 74-1112]
 gi|320179643|gb|EFW54592.1| Cell division protein MraZ [Shigella boydii ATCC 9905]
 gi|320183632|gb|EFW58475.1| Cell division protein MraZ [Shigella flexneri CDC 796-83]
 gi|320190396|gb|EFW65046.1| Cell division protein MraZ [Escherichia coli O157:H7 str. EC1212]
 gi|320197468|gb|EFW72082.1| Cell division protein MraZ [Escherichia coli WV_060327]
 gi|320200400|gb|EFW74986.1| Cell division protein MraZ [Escherichia coli EC4100B]
 gi|320642120|gb|EFX11471.1| cell division protein MraZ [Escherichia coli O157:H7 str. G5101]
 gi|320647483|gb|EFX16278.1| cell division protein MraZ [Escherichia coli O157:H- str. 493-89]
 gi|320652817|gb|EFX21055.1| cell division protein MraZ [Escherichia coli O157:H- str. H 2687]
 gi|320658206|gb|EFX25935.1| cell division protein MraZ [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320663515|gb|EFX30799.1| cell division protein MraZ [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668827|gb|EFX35622.1| cell division protein MraZ [Escherichia coli O157:H7 str. LSU-61]
 gi|323157852|gb|EFZ43955.1| protein MraZ [Escherichia coli EPECa14]
 gi|323160121|gb|EFZ46082.1| protein MraZ [Escherichia coli E128010]
 gi|323171244|gb|EFZ56892.1| protein MraZ [Escherichia coli LT-68]
 gi|323176389|gb|EFZ61981.1| protein MraZ [Escherichia coli 1180]
 gi|323181778|gb|EFZ67191.1| protein MraZ [Escherichia coli 1357]
 gi|323380138|gb|ADX52406.1| MraZ protein [Escherichia coli KO11]
 gi|323945710|gb|EGB41758.1| mraZ protein [Escherichia coli H120]
 gi|323950923|gb|EGB46800.1| mraZ protein [Escherichia coli H252]
 gi|323955279|gb|EGB51052.1| mraZ protein [Escherichia coli H263]
 gi|323964823|gb|EGB60290.1| mraZ protein [Escherichia coli M863]
 gi|324118431|gb|EGC12325.1| mraZ protein [Escherichia coli E1167]
 gi|326345199|gb|EGD68942.1| Cell division protein MraZ [Escherichia coli O157:H7 str. 1125]
 gi|326346947|gb|EGD70681.1| Cell division protein MraZ [Escherichia coli O157:H7 str. 1044]
 gi|327255059|gb|EGE66662.1| protein MraZ [Escherichia coli STEC_7v]
 gi|330909928|gb|EGH38438.1| cell division protein MraZ [Escherichia coli AA86]
 gi|331052169|gb|EGI24208.1| MraZ protein [Escherichia coli TA206]
 gi|331061370|gb|EGI33333.1| MraZ protein [Escherichia coli TA143]
 gi|331066529|gb|EGI38406.1| MraZ protein [Escherichia coli TA271]
 gi|331081687|gb|EGI52848.1| MraZ protein [Escherichia coli H299]
 gi|332095372|gb|EGJ00395.1| protein MraZ [Shigella boydii 5216-82]
 gi|332098264|gb|EGJ03237.1| protein MraZ [Shigella dysenteriae 155-74]
 gi|332098956|gb|EGJ03907.1| protein MraZ [Shigella boydii 3594-74]
 gi|332341413|gb|AEE54747.1| cell division protein MraZ [Escherichia coli UMNK88]
 gi|333010577|gb|EGK30010.1| protein MraZ [Shigella flexneri VA-6]
 gi|333011469|gb|EGK30883.1| protein MraZ [Shigella flexneri K-272]
 gi|333021711|gb|EGK40960.1| protein MraZ [Shigella flexneri K-227]
          Length = 152

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|254491310|ref|ZP_05104490.1| mraZ protein [Methylophaga thiooxidans DMS010]
 gi|224463439|gb|EEF79708.1| mraZ protein [Methylophaga thiooxydans DMS010]
          Length = 150

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D+KGR+++P  FR  L   C   L    D     + +      E  E+K+
Sbjct: 1   MFRGVATFNLDAKGRMAIPAKFRKHLDVCCEGRLVITIDHSDHCLQMYPLPEWELVEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     + Q  +L  ++ G     +MD  GRIL+   +R F  ++  +  +G+GN F+LW
Sbjct: 61  AALPSLNPQVRRLKRMLLGYATECEMDGNGRILLPAKLREFAKLDKSMVMIGQGNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           N QT+ +L ++   E   ++L
Sbjct: 121 NEQTWNELMDDCLEEDFDEIL 141


>gi|300919636|ref|ZP_07136127.1| protein MraZ [Escherichia coli MS 115-1]
 gi|300949901|ref|ZP_07163864.1| protein MraZ [Escherichia coli MS 116-1]
 gi|300955947|ref|ZP_07168280.1| protein MraZ [Escherichia coli MS 175-1]
 gi|301646393|ref|ZP_07246275.1| protein MraZ [Escherichia coli MS 146-1]
 gi|300317167|gb|EFJ66951.1| protein MraZ [Escherichia coli MS 175-1]
 gi|300413276|gb|EFJ96586.1| protein MraZ [Escherichia coli MS 115-1]
 gi|300450733|gb|EFK14353.1| protein MraZ [Escherichia coli MS 116-1]
 gi|301075363|gb|EFK90169.1| protein MraZ [Escherichia coli MS 146-1]
          Length = 164

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D + P + +      E  EQK+
Sbjct: 13  MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPEWEIIEQKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 73  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 132

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 133 DETTWHQQVKEDID--AEQLA 151


>gi|237704229|ref|ZP_04534710.1| mraZ [Escherichia sp. 3_2_53FAA]
 gi|254037496|ref|ZP_04871573.1| mraZ [Escherichia sp. 1_1_43]
 gi|331645191|ref|ZP_08346302.1| MraZ protein [Escherichia coli M605]
 gi|331671600|ref|ZP_08372398.1| MraZ protein [Escherichia coli TA280]
 gi|331680654|ref|ZP_08381313.1| MraZ protein [Escherichia coli H591]
 gi|332281232|ref|ZP_08393645.1| mraZ [Shigella sp. D9]
 gi|226840602|gb|EEH72604.1| mraZ [Escherichia sp. 1_1_43]
 gi|226902141|gb|EEH88400.1| mraZ [Escherichia sp. 3_2_53FAA]
 gi|331045948|gb|EGI18067.1| MraZ protein [Escherichia coli M605]
 gi|331071445|gb|EGI42802.1| MraZ protein [Escherichia coli TA280]
 gi|331072117|gb|EGI43453.1| MraZ protein [Escherichia coli H591]
 gi|332103584|gb|EGJ06930.1| mraZ [Shigella sp. D9]
          Length = 160

 Score =  147 bits (370), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 9   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 69  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 128

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 129 DETTWHQQVKEDID--AEQLA 147


>gi|323975755|gb|EGB70851.1| mraZ protein [Escherichia coli TW10509]
          Length = 152

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGAALVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|16759114|ref|NP_454731.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29140664|ref|NP_804006.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213161508|ref|ZP_03347218.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213426163|ref|ZP_03358913.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213585688|ref|ZP_03367514.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213647632|ref|ZP_03377685.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213858021|ref|ZP_03384992.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289810555|ref|ZP_06541184.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289826155|ref|ZP_06545267.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|20139005|sp|Q8Z9H5|MRAZ_SALTI RecName: Full=Protein MraZ
 gi|25328053|pir||AD0517 conserved hypothetical protein STY0139 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501404|emb|CAD01276.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136288|gb|AAO67855.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 152

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYREQLIESATGQIVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSATETLSER 146


>gi|255020003|ref|ZP_05292076.1| Cell division protein MraZ [Acidithiobacillus caldus ATCC 51756]
 gi|254970532|gb|EET28021.1| Cell division protein MraZ [Acidithiobacillus caldus ATCC 51756]
          Length = 152

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/146 (26%), Positives = 63/146 (43%), Gaps = 8/146 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFF-----FPAISVGNSDLLEY 57
            F       +D KGR+SVP  FR  LA  C   L    D F        +        E 
Sbjct: 1   MFRGTHRHSLDGKGRLSVPARFRDWLASHCDGQLVVTIDPFSQTQEERCLVAYPLPHWEA 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
            EQ++A     +  A +   L  G    L++D++ RIL++  +R F  +E +V  VG+  
Sbjct: 61  LEQRVASLPGNNPTARRFQRLFIGHSEELRLDAQARILLSPGLRQFANLEKDVVLVGQIE 120

Query: 118 YFQLWNPQTFRKLQEE---SRNEYCR 140
            F++W+   +   QE    +R ++  
Sbjct: 121 KFEIWDAVRWDASQENWLAAREDFSS 146


>gi|157147496|ref|YP_001454814.1| cell division protein MraZ [Citrobacter koseri ATCC BAA-895]
 gi|167011870|sp|A8ALL5|MRAZ_CITK8 RecName: Full=Protein MraZ
 gi|157084701|gb|ABV14379.1| hypothetical protein CKO_03295 [Citrobacter koseri ATCC BAA-895]
          Length = 152

 Score =  146 bits (369), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDQLIENATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDSAGRLLIAPILRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSVTETLSER 146


>gi|26246014|ref|NP_752053.1| cell division protein MraZ [Escherichia coli CFT073]
 gi|91209145|ref|YP_539131.1| cell division protein MraZ [Escherichia coli UTI89]
 gi|227885014|ref|ZP_04002819.1| cell division protein MraZ [Escherichia coli 83972]
 gi|300816119|ref|ZP_07096342.1| protein MraZ [Escherichia coli MS 107-1]
 gi|300821914|ref|ZP_07102058.1| protein MraZ [Escherichia coli MS 119-7]
 gi|300900888|ref|ZP_07119025.1| protein MraZ [Escherichia coli MS 198-1]
 gi|300905490|ref|ZP_07123254.1| protein MraZ [Escherichia coli MS 84-1]
 gi|300923136|ref|ZP_07139196.1| protein MraZ [Escherichia coli MS 182-1]
 gi|300931792|ref|ZP_07147092.1| protein MraZ [Escherichia coli MS 187-1]
 gi|300938476|ref|ZP_07153216.1| protein MraZ [Escherichia coli MS 21-1]
 gi|300981118|ref|ZP_07175364.1| protein MraZ [Escherichia coli MS 45-1]
 gi|300984503|ref|ZP_07176995.1| protein MraZ [Escherichia coli MS 200-1]
 gi|301026111|ref|ZP_07189586.1| protein MraZ [Escherichia coli MS 69-1]
 gi|301048471|ref|ZP_07195497.1| protein MraZ [Escherichia coli MS 185-1]
 gi|301303819|ref|ZP_07209939.1| protein MraZ [Escherichia coli MS 124-1]
 gi|301330142|ref|ZP_07222809.1| protein MraZ [Escherichia coli MS 78-1]
 gi|309796071|ref|ZP_07690483.1| protein MraZ [Escherichia coli MS 145-7]
 gi|26106411|gb|AAN78597.1|AE016755_97 Protein mraZ [Escherichia coli CFT073]
 gi|91070719|gb|ABE05600.1| MraZ protein [Escherichia coli UTI89]
 gi|227837843|gb|EEJ48309.1| cell division protein MraZ [Escherichia coli 83972]
 gi|300299685|gb|EFJ56070.1| protein MraZ [Escherichia coli MS 185-1]
 gi|300306672|gb|EFJ61192.1| protein MraZ [Escherichia coli MS 200-1]
 gi|300355652|gb|EFJ71522.1| protein MraZ [Escherichia coli MS 198-1]
 gi|300395682|gb|EFJ79220.1| protein MraZ [Escherichia coli MS 69-1]
 gi|300402640|gb|EFJ86178.1| protein MraZ [Escherichia coli MS 84-1]
 gi|300409020|gb|EFJ92558.1| protein MraZ [Escherichia coli MS 45-1]
 gi|300420591|gb|EFK03902.1| protein MraZ [Escherichia coli MS 182-1]
 gi|300456545|gb|EFK20038.1| protein MraZ [Escherichia coli MS 21-1]
 gi|300460452|gb|EFK23945.1| protein MraZ [Escherichia coli MS 187-1]
 gi|300525514|gb|EFK46583.1| protein MraZ [Escherichia coli MS 119-7]
 gi|300531326|gb|EFK52388.1| protein MraZ [Escherichia coli MS 107-1]
 gi|300840946|gb|EFK68706.1| protein MraZ [Escherichia coli MS 124-1]
 gi|300843847|gb|EFK71607.1| protein MraZ [Escherichia coli MS 78-1]
 gi|308120313|gb|EFO57575.1| protein MraZ [Escherichia coli MS 145-7]
 gi|315253155|gb|EFU33123.1| protein MraZ [Escherichia coli MS 85-1]
 gi|315285173|gb|EFU44618.1| protein MraZ [Escherichia coli MS 110-3]
 gi|315294724|gb|EFU54067.1| protein MraZ [Escherichia coli MS 153-1]
 gi|315300018|gb|EFU59256.1| protein MraZ [Escherichia coli MS 16-3]
 gi|324008347|gb|EGB77566.1| protein MraZ [Escherichia coli MS 57-2]
 gi|324012283|gb|EGB81502.1| protein MraZ [Escherichia coli MS 60-1]
 gi|324017758|gb|EGB86977.1| protein MraZ [Escherichia coli MS 117-3]
          Length = 164

 Score =  146 bits (369), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 13  MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 73  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 132

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 133 DETTWHQQVKEDID--AEQLA 151


>gi|194439408|ref|ZP_03071485.1| MraZ protein [Escherichia coli 101-1]
 gi|194421667|gb|EDX37677.1| MraZ protein [Escherichia coli 101-1]
 gi|323970753|gb|EGB66007.1| mraZ protein [Escherichia coli TA007]
          Length = 152

 Score =  146 bits (369), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  E K+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEHKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|329895270|ref|ZP_08270912.1| Cell division protein MraZ [gamma proteobacterium IMCC3088]
 gi|328922392|gb|EGG29735.1| Cell division protein MraZ [gamma proteobacterium IMCC3088]
          Length = 151

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 62/147 (42%), Gaps = 6/147 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P   R  L   C  ++    D     +++      E  + +I
Sbjct: 1   MFRGVHHINMDAKGRLAIPAKHREPLLGHCSGEVVITIDTQVACLALYPLPEWEVIQDQI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                      +   L  G    L+MD+ GR+L+   +R +  ++ ++  VG+GN  ++W
Sbjct: 61  QALPALKPAVKRFQRLTLGYATDLEMDANGRLLLPAPLREYANLDKKLVLVGQGNKLEIW 120

Query: 123 NPQTFRKLQEE------SRNEYCRQLL 143
           +   +   +++      +  E   +L+
Sbjct: 121 SENLWLSERDKALLESGADTELPEELM 147


>gi|291086122|ref|ZP_06354884.2| MraZ protein [Citrobacter youngae ATCC 29220]
 gi|291069443|gb|EFE07552.1| MraZ protein [Citrobacter youngae ATCC 29220]
          Length = 164

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 13  MFRGATLVNLDSKGRLSVPTRYRDQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 73  SRLSSMNPVERRVQRLLLGHASECQMDSAGRLLIAPILRQHAGLTKEVMLVGQFNKFELW 132

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 133 DETTWYQQVKEDIDAEQSVTGALSER 158


>gi|16763509|ref|NP_459124.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62178686|ref|YP_215103.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612462|ref|YP_001586428.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167550686|ref|ZP_02344443.1| mraZ protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167989992|ref|ZP_02571092.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230398|ref|ZP_02655456.1| mraZ protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168234883|ref|ZP_02659941.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168243466|ref|ZP_02668398.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168262196|ref|ZP_02684169.1| mraZ protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168464329|ref|ZP_02698232.1| MraZ protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168820887|ref|ZP_02832887.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194442600|ref|YP_002039351.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450621|ref|YP_002044089.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469089|ref|ZP_03075073.1| MraZ protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194734682|ref|YP_002113137.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197249345|ref|YP_002145105.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197263524|ref|ZP_03163598.1| MraZ protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198243614|ref|YP_002214071.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205351458|ref|YP_002225259.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207855633|ref|YP_002242284.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224581962|ref|YP_002635760.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238911176|ref|ZP_04655013.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|20139017|sp|Q8ZRU9|MRAZ_SALTY RecName: Full=Protein MraZ
 gi|68565666|sp|Q57TD9|MRAZ_SALCH RecName: Full=Protein MraZ
 gi|189028634|sp|A9MZL0|MRAZ_SALPB RecName: Full=Protein MraZ
 gi|226710005|sp|B5F7V5|MRAZ_SALA4 RecName: Full=Protein MraZ
 gi|226710006|sp|B5FI63|MRAZ_SALDC RecName: Full=Protein MraZ
 gi|226710007|sp|B5R2L5|MRAZ_SALEP RecName: Full=Protein MraZ
 gi|226710008|sp|B5RH55|MRAZ_SALG2 RecName: Full=Protein MraZ
 gi|226710009|sp|B4TJ78|MRAZ_SALHS RecName: Full=Protein MraZ
 gi|226710010|sp|B4SU41|MRAZ_SALNS RecName: Full=Protein MraZ
 gi|226710012|sp|B4TXG9|MRAZ_SALSV RecName: Full=Protein MraZ
 gi|254813290|sp|C0Q5H7|MRAZ_SALPC RecName: Full=Protein MraZ
 gi|16418618|gb|AAL19083.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62126319|gb|AAX64022.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161361826|gb|ABX65594.1| hypothetical protein SPAB_00152 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401263|gb|ACF61485.1| MraZ protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408925|gb|ACF69144.1| MraZ protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194455453|gb|EDX44292.1| MraZ protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194710184|gb|ACF89405.1| MraZ protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195632987|gb|EDX51441.1| MraZ protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197213048|gb|ACH50445.1| mraZ protein [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197241779|gb|EDY24399.1| MraZ protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197291901|gb|EDY31251.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938130|gb|ACH75463.1| mraZ protein [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|205271239|emb|CAR36027.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324355|gb|EDZ12194.1| mraZ protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205331429|gb|EDZ18193.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335067|gb|EDZ21831.1| mraZ protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205337548|gb|EDZ24312.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205342501|gb|EDZ29265.1| mraZ protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348853|gb|EDZ35484.1| mraZ protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206707436|emb|CAR31709.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224466489|gb|ACN44319.1| hypothetical protein SPC_0128 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261245352|emb|CBG23141.1| Protein mraZ [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267991797|gb|ACY86682.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301156747|emb|CBW16222.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911088|dbj|BAJ35062.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222307|gb|EFX47379.1| Cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322615940|gb|EFY12857.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620724|gb|EFY17584.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623924|gb|EFY20761.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627372|gb|EFY24163.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322630679|gb|EFY27443.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638101|gb|EFY34802.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640587|gb|EFY37238.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647728|gb|EFY44213.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648077|gb|EFY44544.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656891|gb|EFY53177.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657399|gb|EFY53671.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663718|gb|EFY59918.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666551|gb|EFY62729.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672290|gb|EFY68402.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676398|gb|EFY72469.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679509|gb|EFY75554.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686162|gb|EFY82146.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322713139|gb|EFZ04710.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323128439|gb|ADX15869.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323195006|gb|EFZ80192.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200085|gb|EFZ85172.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201094|gb|EFZ86163.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209491|gb|EFZ94424.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212257|gb|EFZ97081.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216562|gb|EGA01288.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222500|gb|EGA06870.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225809|gb|EGA10029.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228649|gb|EGA12778.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236737|gb|EGA20813.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239762|gb|EGA23809.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242190|gb|EGA26219.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249386|gb|EGA33302.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252281|gb|EGA36132.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256629|gb|EGA40359.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262998|gb|EGA46548.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265483|gb|EGA48979.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323271729|gb|EGA55147.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326621815|gb|EGE28160.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326626485|gb|EGE32828.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332987072|gb|AEF06055.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 152

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSATETLSER 146


>gi|206580113|ref|YP_002240447.1| MraZ protein [Klebsiella pneumoniae 342]
 gi|288937147|ref|YP_003441206.1| MraZ protein [Klebsiella variicola At-22]
 gi|226709987|sp|B5Y1V6|MRAZ_KLEP3 RecName: Full=Protein MraZ
 gi|206569171|gb|ACI10947.1| MraZ protein [Klebsiella pneumoniae 342]
 gi|288891856|gb|ADC60174.1| MraZ protein [Klebsiella variicola At-22]
          Length = 152

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRDGLIEDAAGQLVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +      +L ++
Sbjct: 121 DETTWYQRVKEDIDAEQSATGELSER 146


>gi|152968666|ref|YP_001333775.1| cell division protein MraZ [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|167012250|sp|A6T4M4|MRAZ_KLEP7 RecName: Full=Protein MraZ
 gi|150953515|gb|ABR75545.1| hypothetical protein KPN_00085 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 152

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREGLIENAAGQLVCTIDIHHPCLLLYPLPEWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +      +L ++
Sbjct: 121 DETTWYQRVKEDIDAEQSATGELSER 146


>gi|262044875|ref|ZP_06017918.1| cell division protein MraZ [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330012016|ref|ZP_08307233.1| protein MraZ [Klebsiella sp. MS 92-3]
 gi|259037844|gb|EEW39072.1| cell division protein MraZ [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534005|gb|EGF60657.1| protein MraZ [Klebsiella sp. MS 92-3]
          Length = 152

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREGLIEDAAGQLVCTIDIHHPCLLLYPLPEWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +      +L ++
Sbjct: 121 DETTWYQRVKEDIDAEQSATGELSER 146


>gi|46202651|ref|ZP_00052851.2| COG2001: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 153

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 73/140 (52%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS    ++D KGRVSVP  FR  LA +  + + C++ F    I     D +E    
Sbjct: 1   MALFLSTFVNRVDKKGRVSVPATFRAALAAQSFSGIVCYRSFTNACIEGCGMDFMERLSD 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
               ++ FS +   LS L+      L  D EGRI++ + I    GI ++V+FVG+G  FQ
Sbjct: 61  GAQSFDAFSAEQEDLSALIFADARQLPWDPEGRIVLPEDILAHAGIADQVSFVGKGQTFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P+ ++ ++ E R    +
Sbjct: 121 IWEPEAYKAVEAEIRARALQ 140


>gi|200388700|ref|ZP_03215312.1| mraZ protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|199605798|gb|EDZ04343.1| mraZ protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 152

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  S    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMSPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSATETLSER 146


>gi|290512570|ref|ZP_06551936.1| mraZ protein [Klebsiella sp. 1_1_55]
 gi|289774911|gb|EFD82913.1| mraZ protein [Klebsiella sp. 1_1_55]
          Length = 160

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 9   MFRGATLVNLDSKGRLAVPTRYRDGLIEDAAGQLVCTIDIHHPCLLLYPLPEWEIIEQKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 69  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 128

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +      +L ++
Sbjct: 129 DETTWYQRVKEDIDAEQSATGELSER 154


>gi|146310291|ref|YP_001175365.1| cell division protein MraZ [Enterobacter sp. 638]
 gi|167012242|sp|A4W6I4|MRAZ_ENT38 RecName: Full=Protein MraZ
 gi|145317167|gb|ABP59314.1| MraZ protein [Enterobacter sp. 638]
          Length = 152

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 65/134 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDQLIENASGQMVCTIDINHPCLLLYTLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  + Q  ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPQERRVQRLLLGHASECQMDNSGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRN 136
           +  T+ +  +E  +
Sbjct: 121 DETTWYQQVKEDID 134


>gi|30061648|ref|NP_835819.1| cell division protein MraZ [Shigella flexneri 2a str. 2457T]
 gi|56479598|ref|NP_706036.2| cell division protein MraZ [Shigella flexneri 2a str. 301]
 gi|110804145|ref|YP_687665.1| cell division protein MraZ [Shigella flexneri 5 str. 8401]
 gi|51316417|sp|Q83MG1|MRAZ_SHIFL RecName: Full=Protein MraZ
 gi|122957671|sp|Q0T8B6|MRAZ_SHIF8 RecName: Full=Protein MraZ
 gi|30039890|gb|AAP15624.1| hypothetical protein S0080 [Shigella flexneri 2a str. 2457T]
 gi|56383149|gb|AAN41743.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110613693|gb|ABF02360.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281599443|gb|ADA72427.1| protein mraZ [Shigella flexneri 2002017]
 gi|313646536|gb|EFS10997.1| protein MraZ [Shigella flexneri 2a str. 2457T]
 gi|332762316|gb|EGJ92583.1| protein MraZ [Shigella flexneri 2747-71]
 gi|332762642|gb|EGJ92907.1| protein MraZ [Shigella flexneri 4343-70]
 gi|332764927|gb|EGJ95155.1| protein MraZ [Shigella flexneri K-671]
 gi|332768871|gb|EGJ99050.1| mraZ family protein [Shigella flexneri 2930-71]
 gi|333009222|gb|EGK28678.1| protein MraZ [Shigella flexneri K-218]
 gi|333022342|gb|EGK41580.1| protein MraZ [Shigella flexneri K-304]
          Length = 152

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 2/141 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLLSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +  T+ +  +E  +    QL 
Sbjct: 121 DETTWHQQVKEDID--AEQLA 139


>gi|218547538|ref|YP_002381329.1| cell division protein MraZ [Escherichia fergusonii ATCC 35469]
 gi|226709981|sp|B7LWG9|MRAZ_ESCF3 RecName: Full=Protein MraZ
 gi|218355079|emb|CAQ87686.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|324112506|gb|EGC06483.1| mraZ protein [Escherichia fergusonii B253]
 gi|325496017|gb|EGC93876.1| cell division protein MraZ [Escherichia fergusonii ECD227]
          Length = 152

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 64/146 (43%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L       + C  D   P + +      E  E K+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYREELLGNAAGQMVCTIDIHHPCLLLYPLPEWEIIEHKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     ++D+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQLDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +   E   +       L ++
Sbjct: 121 DETTWHQQVREDIDAEQSITENLSER 146


>gi|218289890|ref|ZP_03494080.1| MraZ protein [Alicyclobacillus acidocaldarius LAA1]
 gi|258511252|ref|YP_003184686.1| MraZ protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|218240030|gb|EED07216.1| MraZ protein [Alicyclobacillus acidocaldarius LAA1]
 gi|257477978|gb|ACV58297.1| MraZ protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 143

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 51/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+++P  FR  L    I             +     D     EQK+
Sbjct: 1   MFMGEYEHSLDSKGRLTIPAKFRDGLGDSFIVTRGL-----DQCLFAYPLDEWRALEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+   +R +  +E E T +G  N  ++W
Sbjct: 56  KSLPMTRSDARAFVRFFFSGASECEVDKQGRILLPPKLREYAKLEKECTLIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           N   +     ++   +  
Sbjct: 116 NTSVWEHYSSDAERSFAE 133


>gi|227356433|ref|ZP_03840821.1| cell division protein MraZ [Proteus mirabilis ATCC 29906]
 gi|227163543|gb|EEI48464.1| cell division protein MraZ [Proteus mirabilis ATCC 29906]
          Length = 154

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +DSKGR++VP  +RT L +     + C  D   P + +      E  E 
Sbjct: 1   MRMFRGATLVNLDSKGRITVPSRYRTTLNEASEGQMVCTIDLNQPCLLLYTLPEWEKIEL 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+A  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+
Sbjct: 61  KLAALSSMNPAERRVQRLLLGHASECQMDSAGRLLLASTLRQHAGLTKEVMLVGQFNKFE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LW+ Q +   Q+   +    Q  Q+
Sbjct: 121 LWDEQVW--YQQIKEDILAEQTSQE 143


>gi|254284187|ref|ZP_04959155.1| mraZ protein [gamma proteobacterium NOR51-B]
 gi|219680390|gb|EED36739.1| mraZ protein [gamma proteobacterium NOR51-B]
          Length = 150

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 60/132 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P   R +L   C   +    D     ++V      E  E ++
Sbjct: 1   MFRGVQHINMDAKGRMAIPARQRDVLMTACDGHIVATIDTQSSCLAVYPLPEWERIESEV 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   LV G    +++D+ GR L+   +R + G+E +V  VG+GN F+LW
Sbjct: 61  QALPALNPGVKRFQRLVLGYASDIELDANGRFLVPPSLREYAGLEKKVVLVGQGNKFELW 120

Query: 123 NPQTFRKLQEES 134
           +   +   +E +
Sbjct: 121 SESLWLAEREAA 132


>gi|85712542|ref|ZP_01043590.1| hypothetical protein OS145_05265 [Idiomarina baltica OS145]
 gi|85693676|gb|EAQ31626.1| hypothetical protein OS145_05265 [Idiomarina baltica OS145]
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 67/134 (50%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +DSKGR+++P  +R  L+  C   + C  D   P + +      +  E+K+
Sbjct: 1   MFRGATTINLDSKGRLAIPAKYRHALSIDCDGKMVCTIDIKQPCLLLYPLPEWQVIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +  +    +L  L+ G     +MD  GR+L++  +R+  G+E ++  VG+ N F++W
Sbjct: 61  TQLSSMNPTERRLQRLLLGHADDCEMDKNGRLLISSPLRLHAGLEKKLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           + + +++   E   
Sbjct: 121 SEEAWQQQIAEDLK 134


>gi|162449927|ref|YP_001612294.1| MraZ protein [Sorangium cellulosum 'So ce 56']
 gi|161160509|emb|CAN91814.1| MraZ protein [Sorangium cellulosum 'So ce 56']
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 55/137 (40%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F  +    ID+KGR S+P  FR +LA      +      F P +        E  E K
Sbjct: 3   TMFRGHFEHAIDAKGRTSLPSRFRDVLAAANDLRMVITPALFDPCLHAYPMKAWEELEAK 62

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           IA    F               +   +D +GRIL+   +R    +  +V + G G   +L
Sbjct: 63  IAALPQFDSNVVAFRRRYLSAAVECDLDKQGRILIPPSLREHADLTKDVLWAGMGQTIEL 122

Query: 122 WNPQTFRKLQEESRNEY 138
           W+ + ++  Q+ S  E 
Sbjct: 123 WSQERWKAAQQMSEVEL 139


>gi|204927092|ref|ZP_03218294.1| mraZ protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204323757|gb|EDZ08952.1| mraZ protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DDTTWYQQVKEDIDAEQSATETLSER 146


>gi|238893061|ref|YP_002917795.1| cell division protein MraZ [Klebsiella pneumoniae NTUH-K2044]
 gi|238545377|dbj|BAH61728.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 164

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 13  MFRGATLVNLDSKGRLAVPTRYREGLIEDAAGQLVCTIDIHHPCLLLYPLPEWEVIEQKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 73  SRLSSMNPVERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 132

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +      +L ++
Sbjct: 133 DETTWYQRVKEDIDAEQSATGELSER 158


>gi|332305216|ref|YP_004433067.1| MraZ protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172545|gb|AEE21799.1| MraZ protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGRV++P  +R  L   C   L C  D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDVKGRVTIPTKYRQSLLDDCQGQLVCTIDTQQPCLLLYPLAEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    +L  L+ G     +MD  GR L+T  +R    ++ ++  VG+ N F++W
Sbjct: 61  SRLSSMNPHERRLQRLLLGYATEGEMDKNGRFLLTAPLREHAHLDKQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +   +++  ++   +  E   +L ++
Sbjct: 121 DHSVWQQQIQQDVATEQEAAFELTER 146


>gi|109899829|ref|YP_663084.1| cell division protein MraZ [Pseudoalteromonas atlantica T6c]
 gi|123064186|sp|Q15Q08|MRAZ_PSEA6 RecName: Full=Protein MraZ
 gi|109702110|gb|ABG42030.1| MraZ protein [Pseudoalteromonas atlantica T6c]
          Length = 152

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGRV++P  +R  L   C   L C  D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDVKGRVTIPTKYRQSLLDDCQGQLVCTIDTQQPCLLLYPLPEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    +L  L+ G     +MD  GR L+T  +R    ++ ++  VG+ N F++W
Sbjct: 61  SRLSSMNPHERRLQRLLLGYATEGEMDKSGRFLLTAPLREHAHLDKQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +   +++  ++   +  E   +L ++
Sbjct: 121 DHSVWQQQIQQDVATEQEAAFELTER 146


>gi|296101244|ref|YP_003611390.1| hypothetical protein ECL_00878 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055703|gb|ADF60441.1| hypothetical protein ECL_00878 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 152

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 41/146 (28%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDQLIENASGQLVCTIDINSPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  + Q  ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPQERRVQRLLLGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSNSATLSER 146


>gi|289209370|ref|YP_003461436.1| MraZ protein [Thioalkalivibrio sp. K90mix]
 gi|288945001|gb|ADC72700.1| MraZ protein [Thioalkalivibrio sp. K90mix]
          Length = 146

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 60/146 (41%), Gaps = 6/146 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  LA  C   L    D     + +      E  EQ +
Sbjct: 1   MFRGVSQLNLDAKGRLAMPARYRDTLAASCGGQLVITVDP-DRCLLLYPFPEWERIEQSL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + +   L  L+ G     ++D  GR+L+   +R +  ++     +G+GN F++W
Sbjct: 60  MSRPNMNPKVRNLQRLLVGHATECELDGSGRLLLPTPLRQYASLDKRAVLLGQGNKFEIW 119

Query: 123 NPQTFRKLQEES-----RNEYCRQLL 143
           +   +    E++      ++    + 
Sbjct: 120 DADAWDARCEQALGGDVDDDALESIA 145


>gi|262276871|ref|ZP_06054664.1| protein MraZ [alpha proteobacterium HIMB114]
 gi|262223974|gb|EEY74433.1| protein MraZ [alpha proteobacterium HIMB114]
          Length = 149

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 42/142 (29%), Positives = 69/142 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+S    K+D KGRVSVP  +R+ L+      + C+  F   +I     D LE   + I
Sbjct: 1   MFISTYENKLDKKGRVSVPAAYRSHLSTLGYNGVVCYPSFTNSSIEFCPQDRLEKIIETI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              NPF    +  S  +      L  D +GRI + + +   + I+ +V FVG+G  FQ+W
Sbjct: 61  ETLNPFEENRDIFSTSILANSSQLNFDGDGRITLNEKLLEHSKIKEKVLFVGQGKTFQMW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
            P  F+K  +++R +   +  +
Sbjct: 121 EPTLFKKFSDDARKKANLKRSE 142


>gi|226328339|ref|ZP_03803857.1| hypothetical protein PROPEN_02233 [Proteus penneri ATCC 35198]
 gi|225203072|gb|EEG85426.1| hypothetical protein PROPEN_02233 [Proteus penneri ATCC 35198]
          Length = 154

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +DSKGR++VP  +RT L++     + C  D   P + +      E  E 
Sbjct: 1   MRMFRGATLVNLDSKGRITVPSRYRTTLSEISEGQMVCTIDLNQPCLLLYTLPEWEKIEL 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+A  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+
Sbjct: 61  KLAALSSMNPAERRVQRLLLGHASECQMDSAGRLLLASTLRQHAGLTKEVMLVGQFNKFE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LW+ Q + K  E+  +    Q  Q+
Sbjct: 121 LWDEQIWYKQIEK--DIVAEQTSQE 143


>gi|90962031|ref|YP_535947.1| cell division protein MraZ [Lactobacillus salivarius UCC118]
 gi|227891049|ref|ZP_04008854.1| cell division protein MraZ [Lactobacillus salivarius ATCC 11741]
 gi|301300417|ref|ZP_07206619.1| protein MraZ [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122448862|sp|Q1WT94|MRAZ_LACS1 RecName: Full=Protein MraZ
 gi|90821225|gb|ABD99864.1| Cell division protein mraZ [Lactobacillus salivarius UCC118]
 gi|227867138|gb|EEJ74559.1| cell division protein MraZ [Lactobacillus salivarius ATCC 11741]
 gi|300852019|gb|EFK79701.1| protein MraZ [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 143

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 51/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L    +             +     +     E K+
Sbjct: 1   MFMGEYRHTIDAKGRLIVPAKFREQLGDSFVVTRGM-----DGCLFGYTQEEWNILETKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A       +      ++D +GRI +   +R    ++ +   VG  N F++W
Sbjct: 56  QKLPLTKKDARAFVRFFYSAATECEIDKQGRINIPKSLRTHAALQKKCVVVGVSNRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +    +E+   +   + +
Sbjct: 116 SEDRWEAFADEAEENF-DDIAE 136


>gi|156935399|ref|YP_001439315.1| cell division protein MraZ [Cronobacter sakazakii ATCC BAA-894]
 gi|156533653|gb|ABU78479.1| hypothetical protein ESA_03257 [Cronobacter sakazakii ATCC BAA-894]
          Length = 152

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R +L       + C  D   P + +         EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDLLNDASSGQMVCTIDIHHPCLLLYTLPEWVIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLAPVLRQHAGLTKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +   E   +       L ++
Sbjct: 121 DEATWHQQVREDIDAEQSSSEVLSER 146


>gi|56412391|ref|YP_149466.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361327|ref|YP_002140962.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|68565693|sp|Q5PDH5|MRAZ_SALPA RecName: Full=Protein MraZ
 gi|226710011|sp|B5BLG3|MRAZ_SALPK RecName: Full=Protein MraZ
 gi|56126648|gb|AAV76154.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197092802|emb|CAR58228.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 152

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHRPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSATETLSER 146


>gi|300021769|ref|YP_003754380.1| MraZ domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523590|gb|ADJ22059.1| MraZ domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 163

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCI-TDLYCFQDFFFPAISVGNSDLLEYFE 59
           M RF+S  T KID+KGRVS+P  FR +L +      LYC+     PA+  G   L +  +
Sbjct: 1   MDRFVSTFTNKIDAKGRVSIPASFRAVLERDGYAGGLYCYPSLDAPALDAGGERLAKKID 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
             +A    +S + ++LS+ ++G    L +D +GRI++ + +R   G+   VTFVG G+ F
Sbjct: 61  GLLAGLPDYSDERDELSVALYGDVQVLTIDGDGRIVLPESLRAHAGLGAAVTFVGLGDKF 120

Query: 120 QLWNPQTFRKLQEESRNE 137
           Q+W P  F K + E+R++
Sbjct: 121 QIWEPGRFEKRRAEARSK 138


>gi|295098585|emb|CBK87675.1| mraZ protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 152

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/146 (28%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     L C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDQLIENASGQLVCTIDINSPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  + Q  ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPQERRVQRLLLGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQQVKEDIDAEQSDSATLSER 146


>gi|85058418|ref|YP_454120.1| cell division protein MraZ [Sodalis glossinidius str. 'morsitans']
 gi|123520088|sp|Q2NVW0|MRAZ_SODGM RecName: Full=Protein MraZ
 gi|84778938|dbj|BAE73715.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 152

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 1/141 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP   R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRHREKLNEESAGLMVCTIDLHQPCLLLYPLPAWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GRIL+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRILLAPTLRQHAGLSKEVMLVGQFNKFELW 120

Query: 123 NPQTF-RKLQEESRNEYCRQL 142
           + QT+ ++++++   E   +L
Sbjct: 121 DEQTWYQQVKDDIDAELSAEL 141


>gi|52841148|ref|YP_094947.1| cell division protein MraZ [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628259|gb|AAU27000.1| MraZ protein [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 167

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 66/140 (47%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F       ID+KGR+++P  +R+ L       L    D     + +  +   +  E  
Sbjct: 15  NMFRGINAITIDTKGRLAIPTRYRSALGAEDKIPLVVTIDTEETCLLLYTAAQWQIIEDN 74

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +   F+  A ++  L+ G    +++D+ GR+L+   +R +  +E +V  +G+GN F++
Sbjct: 75  LQKLPSFNAAARRIQRLLIGHATDVEVDANGRVLLPTVLRNYAKLEKDVVMIGQGNKFEV 134

Query: 122 WNPQTFRKLQEESRNEYCRQ 141
           WN + +   +E+   E    
Sbjct: 135 WNKELWESKREQWLAEEASM 154


>gi|114321351|ref|YP_743034.1| MraZ protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311117|sp|Q0A6J3|MRAZ_ALHEH RecName: Full=Protein MraZ
 gi|114227745|gb|ABI57544.1| MraZ protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 150

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 68/142 (47%), Gaps = 4/142 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++ P  +R  L   C  ++    D+  P + +      E  E+ +
Sbjct: 1   MFRGVTHLNLDAKGRMAFPSRYRDRLMGLCDGEVVATIDYESPCLMLYPLPDWEVLERDL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    + QA +L  L+ G    L++D  GR+L+   +R +  ++ ++  VG+ + F+LW
Sbjct: 61  VKLPSLNPQARRLQRLLIGHAHDLQLDGSGRVLLPQPLRDYANLDKKIVLVGQVHRFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +     ++R ++  +  Q
Sbjct: 121 DAEAWE----QARTDWLDEARQ 138


>gi|161504760|ref|YP_001571872.1| cell division protein MraZ [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160866107|gb|ABX22730.1| hypothetical protein SARI_02883 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 164

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 13  MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 73  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 132

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +   E   +       L ++
Sbjct: 133 DETTWYQQVREDIDAEQSATETLSER 158


>gi|304385177|ref|ZP_07367523.1| cell division protein MraZ [Pediococcus acidilactici DSM 20284]
 gi|304329371|gb|EFL96591.1| cell division protein MraZ [Pediococcus acidilactici DSM 20284]
          Length = 160

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR  L +  +             +        +  E+K+
Sbjct: 18  MFMGEFEHSLDNKGRLIIPSKFRDQLGEDFVITRGL-----DGCLFGYPLSEWKLVEEKL 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++              +         D +GRI++   +RV   ++ E   VG  N  ++W
Sbjct: 73  SQLPSNKKNNRAFVRFMFADAAQCNFDKQGRIIIPKKLRVHADLQKECVLVGVSNRIEIW 132

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   +    EE+   +   + +
Sbjct: 133 NKARWEAAIEETEANF-DDIAE 153


>gi|330813723|ref|YP_004357962.1| cell division protein MraZ [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486818|gb|AEA81223.1| cell division protein MraZ [Candidatus Pelagibacter sp. IMCC9063]
          Length = 149

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 70/141 (49%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+S    ++D KGRVSVP  FR+ L+      + C+  F   +I       +E   + I
Sbjct: 1   MFISTFENRLDKKGRVSVPATFRSHLSSLGYNGVVCYPSFTNSSIEFCPQSRIEKIMETI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              NPF    +  S  +      L  D+EGR+ +T+ +   TG++ +V FVG+G  FQ+W
Sbjct: 61  DNLNPFEENRDVFSTSILANSHQLNFDTEGRVTLTEKLIKHTGVKEKVLFVGQGKTFQMW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
            P  FRK  +E+R +   +  
Sbjct: 121 EPLQFRKFSDEARKKAKSERS 141


>gi|302386837|ref|YP_003822659.1| MraZ protein [Clostridium saccharolyticum WM1]
 gi|302197465|gb|ADL05036.1| MraZ protein [Clostridium saccharolyticum WM1]
          Length = 141

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 55/141 (39%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L    +             + V +++     E K+
Sbjct: 1   MFMGEYNHTVDAKGRLIVPSKFREQLGDEFVVTKGL-----DGCLFVYDNNEWTALENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + S     G    ++D +GRIL+   +R   GI+ +   VG G+  ++W
Sbjct: 56  KSLPLTNTNARKFSRFFLAGATTCEVDKQGRILLPAVLREHAGIDKDAVLVGVGSRIEIW 115

Query: 123 NPQTFRKLQE-ESRNEYCRQL 142
           +   +      E   E    +
Sbjct: 116 SKDAWIAANTYEDMEEIAEAM 136


>gi|261867471|ref|YP_003255393.1| cell division protein MraZ [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|293391349|ref|ZP_06635683.1| MraZ protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261412803|gb|ACX82174.1| MraZ protein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951883|gb|EFE02002.1| MraZ protein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 152

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 62/133 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L ++    + C  D   P + +      E  EQK+
Sbjct: 1   MFRGASAVNLDAKGRISIPTRYRAELLEQNQGQMVCTVDIRQPCLLLYPLQEWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E + F      L  ++ G     ++DS GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LELSNFDPVQRSLQRVMLGYATECELDSAGRILISGPLRQHAKLEKSIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   ++   E+  
Sbjct: 121 SDAEWKAQVEQDM 133


>gi|254497124|ref|ZP_05109944.1| cell division protein MraZ [Legionella drancourtii LLAP12]
 gi|254353662|gb|EET12377.1| cell division protein MraZ [Legionella drancourtii LLAP12]
          Length = 167

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 65/136 (47%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F       ID+KGR+++P  +R+ L       L    D     + +  +   +  E  
Sbjct: 15  TMFRGINAITIDTKGRLAIPTRYRSALGVEEKNPLVVTIDTEETCLLLYTAAQWQIIEDN 74

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +   F+  A ++  L+ G    +++D+ GR+L+   +R +  +E +V  +G+GN F++
Sbjct: 75  LQKLPSFNAAARRIQRLLIGHATDVEVDANGRVLLPTVLRNYAKLEKDVVMIGQGNKFEV 134

Query: 122 WNPQTFRKLQEESRNE 137
           W+   +   ++E   E
Sbjct: 135 WSKDLWESRRDEWLAE 150


>gi|104783462|ref|YP_609960.1| cell division protein MraZ [Pseudomonas entomophila L48]
 gi|170720121|ref|YP_001747809.1| cell division protein MraZ [Pseudomonas putida W619]
 gi|122401959|sp|Q1I5A9|MRAZ_PSEE4 RecName: Full=Protein MraZ
 gi|226710002|sp|B1J1Y1|MRAZ_PSEPW RecName: Full=Protein MraZ
 gi|95112449|emb|CAK17176.1| conserved hypothetical protein [Pseudomonas entomophila L48]
 gi|169758124|gb|ACA71440.1| MraZ protein [Pseudomonas putida W619]
          Length = 151

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 58/132 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  RC   L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAVSLDAKGRLAMPSRYRDELDSRCNGQLIVTIDAVDPCLCVYPLDEWEQIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++ +   VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKKAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWNAVSAAD 132


>gi|184155044|ref|YP_001843384.1| hypothetical protein LAF_0568 [Lactobacillus fermentum IFO 3956]
 gi|227514830|ref|ZP_03944879.1| cell division protein MraZ [Lactobacillus fermentum ATCC 14931]
 gi|260663588|ref|ZP_05864477.1| mraZ protein [Lactobacillus fermentum 28-3-CHN]
 gi|226709989|sp|B2GB72|MRAZ_LACF3 RecName: Full=Protein MraZ
 gi|183226388|dbj|BAG26904.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|227086820|gb|EEI22132.1| cell division protein MraZ [Lactobacillus fermentum ATCC 14931]
 gi|260551814|gb|EEX24929.1| mraZ protein [Lactobacillus fermentum 28-3-CHN]
          Length = 143

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 58/141 (41%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T  ID KGR+ +P  FR+ L    I             +        +  +Q++
Sbjct: 1   MFMGEYTHTIDDKGRLIIPAKFRSQLGDDFIITRGL-----DHCLYGYPLIEWQAVQQRL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +  A +L    +      + D +GR+ +   +     +E +   +G  ++F++W
Sbjct: 56  ASLPSTNANARKLVRYFYSAACECQFDKQGRVNLPANLMQHAYLERDCVVIGVASHFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           + + +   Q+ + +++  QL 
Sbjct: 116 DAERWASYQDAAASDF-DQLA 135


>gi|330828036|ref|YP_004390988.1| MraZ protein [Aeromonas veronii B565]
 gi|328803172|gb|AEB48371.1| MraZ protein [Aeromonas veronii B565]
          Length = 152

 Score =  143 bits (361), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 62/132 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +DSKGR+++P  FR  L       L C  D   P + +   +  E  E+K+
Sbjct: 1   MLRGAHAISLDSKGRLAIPTKFRDWLRDESDGQLVCTIDIAHPCLLLYPLNEWEEVERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  + Q  +L  L+ G     ++D  GR+L++  +R   G++ ++  VG+ N F+LW
Sbjct: 61  KTLSSMNPQERRLQRLLLGHATECELDGNGRLLLSQPLRNHAGLDKKIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEES 134
           +   +++   + 
Sbjct: 121 DEARWQQQVNDD 132


>gi|119505129|ref|ZP_01627205.1| hypothetical protein MGP2080_15609 [marine gamma proteobacterium
           HTCC2080]
 gi|119459111|gb|EAW40210.1| hypothetical protein MGP2080_15609 [marine gamma proteobacterium
           HTCC2080]
          Length = 150

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 64/141 (45%), Gaps = 1/141 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++VP   R  L ++C   +    D     +++      E  E +I
Sbjct: 1   MFRGVQHINMDTKGRLAVPARQRESLLEQCAGQVVITIDTQSHCLTLYPLPEWERIEAEI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+ G    +++D  GR+L+   +R +  +E ++  VG+GN  +LW
Sbjct: 61  QSLPALNPAVKRFQRLMLGYAADIELDGNGRVLLPQSLRDYAHLEKKIVLVGQGNKLELW 120

Query: 123 NPQTFRKLQEESRN-EYCRQL 142
           +   + + ++ + + E   +L
Sbjct: 121 SEDRWLEERDAALSIEAPEEL 141


>gi|78042864|ref|YP_360898.1| cell division protein MraZ [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|91207188|sp|Q3AAD6|MRAZ_CARHZ RecName: Full=Protein MraZ
 gi|77994979|gb|ABB13878.1| mraZ protein [Carboxydothermus hydrogenoformans Z-2901]
          Length = 143

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+KGRV +P  FR  L ++ I             + V      +  E+KI
Sbjct: 1   MFMGEYSHTMDAKGRVFIPARFREELGEKFIVTKGL-----DHCLFVFPQKEWKVIEEKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A     L   G    + D +GR+L+ + +R +  ++ EV  VG G   ++W
Sbjct: 56  KALPFTNQDARAFVRLFFAGAAECEQDKQGRVLLPNHLREYAKLDKEVVIVGVGTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      ++  Y  ++ +K
Sbjct: 116 SQELWNNYCNGAQAAY-EEIAEK 137


>gi|226313433|ref|YP_002773327.1| protein MraZ [Brevibacillus brevis NBRC 100599]
 gi|254813271|sp|C0ZGB4|MRAZ_BREBN RecName: Full=Protein MraZ
 gi|226096381|dbj|BAH44823.1| protein MraZ [Brevibacillus brevis NBRC 100599]
          Length = 143

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+++P  FR  L     T     +      +     D  +  E+++
Sbjct: 1   MFMGEYQHSIDEKGRLTIPAKFREGLG----TSFVITRGL-DQCLFAYPQDEWKQLEERL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    + D +GR+ +   +R   G++ E   +G  N  ++W
Sbjct: 56  KSLPFTKADARAFTRFFFSGATECEWDKQGRVNIPPNLREHAGMQKECVIIGVSNRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +     +S   +  ++ +K
Sbjct: 116 SKERWEDYFAQSEGSF-GEIAEK 137


>gi|134298534|ref|YP_001112030.1| cell division protein MraZ [Desulfotomaculum reducens MI-1]
 gi|172044254|sp|A4J2A2|MRAZ_DESRM RecName: Full=Protein MraZ
 gi|134051234|gb|ABO49205.1| MraZ protein [Desulfotomaculum reducens MI-1]
          Length = 142

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      IDSKGR+ VP  FR  L  R I             + V         EQK+
Sbjct: 1   MFMGEFQHNIDSKGRLIVPARFREGLGDRFIVTKGL-----DNCLFVYPQHEWAEVEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+ + +R +  ++ E   VG     ++W
Sbjct: 56  KSLPFTRADARAFVRFFFSGATECEVDKQGRILLPNNLREYAKLDKETVVVGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +   ++   +  QL +
Sbjct: 116 SKEEWDRYNAQAEASF-EQLAE 136


>gi|148549601|ref|YP_001269703.1| cell division protein MraZ [Pseudomonas putida F1]
 gi|167035512|ref|YP_001670743.1| cell division protein MraZ [Pseudomonas putida GB-1]
 gi|38258007|sp|Q88N85|MRAZ_PSEPK RecName: Full=Protein MraZ
 gi|167012263|sp|A5W8Q9|MRAZ_PSEP1 RecName: Full=Protein MraZ
 gi|189028628|sp|B0KFT5|MRAZ_PSEPG RecName: Full=Protein MraZ
 gi|148513659|gb|ABQ80519.1| MraZ protein [Pseudomonas putida F1]
 gi|166862000|gb|ABZ00408.1| MraZ protein [Pseudomonas putida GB-1]
          Length = 151

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 58/132 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  RC   L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAVSLDAKGRLAMPSRYRDELDSRCNGQLIVTIDAVDPCLCVYPLDEWEQIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++ +   VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKKAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWNAVSAAD 132


>gi|255505597|ref|ZP_05347116.3| MraZ protein [Bryantella formatexigens DSM 14469]
 gi|255266854|gb|EET60059.1| MraZ protein [Bryantella formatexigens DSM 14469]
          Length = 178

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L +  +             + V  +D    FE+K+
Sbjct: 36  MFMGEYNHAIDTKGRLIIPSKFREELGEEFVVTKGL-----DGCLFVFPNDAWHEFEEKL 90

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A Q S     G    ++D +GRIL+   +R F G+E +V   G  N  ++W
Sbjct: 91  RALPLTNKSARQFSRFFVAGATPCELDKQGRILLPGTLREFAGLEKDVVLTGMLNRIEIW 150

Query: 123 NPQTF-RKLQEESRNEYCRQLLQ 144
           + + +      +  +E   Q+  
Sbjct: 151 SKEKWSENNSYDDMDEIAEQMTD 173


>gi|167040641|ref|YP_001663626.1| cell division protein MraZ [Thermoanaerobacter sp. X514]
 gi|300914682|ref|ZP_07131998.1| MraZ protein [Thermoanaerobacter sp. X561]
 gi|307724084|ref|YP_003903835.1| MraZ protein [Thermoanaerobacter sp. X513]
 gi|226710018|sp|B0K3H9|MRAZ_THEPX RecName: Full=Protein MraZ
 gi|166854881|gb|ABY93290.1| MraZ protein [Thermoanaerobacter sp. X514]
 gi|300889617|gb|EFK84763.1| MraZ protein [Thermoanaerobacter sp. X561]
 gi|307581145|gb|ADN54544.1| MraZ protein [Thermoanaerobacter sp. X513]
          Length = 143

 Score =  143 bits (360), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGRV +P  FR  L ++ +             + V + +  +  E K+
Sbjct: 1   MLMGQYEHTIDAKGRVIIPAKFREELGEKFVLTKGL-----DNCLFVYSLEEWKNIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +  ++D +GRIL+   +R    IE +V F+G     ++W
Sbjct: 56  KTLPLTKKDARAFTRFFLAGAVECEIDKQGRILIPANLREHAKIEKDVIFIGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +    +   +  ++ +
Sbjct: 116 SKEVWEEYSNNTDVSF-EEIAE 136


>gi|289578682|ref|YP_003477309.1| MraZ protein [Thermoanaerobacter italicus Ab9]
 gi|297544902|ref|YP_003677204.1| MraZ protein [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|289528395|gb|ADD02747.1| MraZ protein [Thermoanaerobacter italicus Ab9]
 gi|296842677|gb|ADH61193.1| MraZ protein [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 143

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 59/142 (41%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGRV +P  FR  L ++ +             + V + +  +  E K+
Sbjct: 1   MLMGQYEHTIDAKGRVIIPAKFREELGEKFVLTKGL-----DNCLFVYSLEEWKNIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +  ++D +GRIL+   +R +  IE +V F+G     ++W
Sbjct: 56  KTLPLTKKDARAFTRFFLAGAVECEIDKQGRILIPANLREYAKIEKDVIFIGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +    +   +  ++ +
Sbjct: 116 SKEVWEEYSNNTDVSF-EEIAE 136


>gi|289164198|ref|YP_003454336.1| hypothetical protein LLO_0854 [Legionella longbeachae NSW150]
 gi|288857371|emb|CBJ11199.1| conserved protein of unknown function [Legionella longbeachae
           NSW150]
          Length = 152

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 63/135 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR+++P  +R  L       L    D     + +  +   +  E  +
Sbjct: 1   MFRGINAITIDTKGRLAIPTRYRAALGADEKIPLVVTIDTEETCLLLYTAAQWQIIENNL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F+  A ++  L+ G    +++D+ GR+L+   +R +  +E +V  +G+GN F++W
Sbjct: 61  QKLPSFNAAARRIQRLLIGHATDVEVDTNGRVLLPTVLRNYAQLEKDVVMIGQGNKFEVW 120

Query: 123 NPQTFRKLQEESRNE 137
           N   +   +E+   E
Sbjct: 121 NKDIWETRREQWLAE 135


>gi|256752963|ref|ZP_05493789.1| MraZ protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|307266528|ref|ZP_07548061.1| MraZ protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326391683|ref|ZP_08213208.1| MraZ protein [Thermoanaerobacter ethanolicus JW 200]
 gi|256748158|gb|EEU61236.1| MraZ protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|306918447|gb|EFN48688.1| MraZ protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325992261|gb|EGD50728.1| MraZ protein [Thermoanaerobacter ethanolicus JW 200]
          Length = 146

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGRV +P  FR  L  R +             + V + D  +  E K+
Sbjct: 4   MLMGQYEHTIDAKGRVIIPAKFREELGDRFVLTKGL-----DNCLFVYSLDEWKNIEAKL 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +  ++D +GRIL+   +R    IE +V F+G     ++W
Sbjct: 59  KTLPLTKKDARAFTRFFLAGAVECEIDKQGRILIPANLREHAKIEKDVIFIGVSTRVEIW 118

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +    +   +  ++ +
Sbjct: 119 SKEVWEEYSNNTDVSF-EEIAE 139


>gi|261338925|ref|ZP_05966783.1| hypothetical protein ENTCAN_05123 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318750|gb|EFC57688.1| MraZ protein [Enterobacter cancerogenus ATCC 35316]
          Length = 152

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDQLIENASGQMVCTIDINSPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  + Q  ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPQERRVQRLLLGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +   E   +       L ++
Sbjct: 121 DETTWYQQVREDIDAEQSDSATLSER 146


>gi|237807291|ref|YP_002891731.1| cell division protein MraZ [Tolumonas auensis DSM 9187]
 gi|259509665|sp|C4LA16|MRAZ_TOLAT RecName: Full=Protein MraZ
 gi|237499552|gb|ACQ92145.1| MraZ protein [Tolumonas auensis DSM 9187]
          Length = 152

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 62/139 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGR++VP  +R  L + C   L C  D   P + +      E  E+K+
Sbjct: 1   MLRGAHAIALDTKGRLAVPTRYRDWLREECEGQLVCTIDIANPCLLLYPLCEWEEIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +    +L  L+ G     ++D  GR+L++  +R   G++ +V  VG+ N F++W
Sbjct: 61  KSLSGMNPVERRLQRLLLGYASECELDGNGRLLLSAPLRQHAGLDKQVMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   + +  +E        
Sbjct: 121 SETRWLQQVDEDIQALPEM 139


>gi|260596506|ref|YP_003209077.1| cell division protein MraZ [Cronobacter turicensis z3032]
 gi|260215683|emb|CBA28012.1| Protein mraZ [Cronobacter turicensis z3032]
          Length = 152

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+SVP  +R +L       + C  D   P + +         EQK+
Sbjct: 1   MFRGATLVNLDSKGRLSVPTRYRDLLNDASSGQMVCTIDIHHPCLLLYTLPEWVIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLAPVLRQHAGLTKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +   E   +       L ++
Sbjct: 121 DEVTWHQQVREDIDAEQSSSEVLSER 146


>gi|261345653|ref|ZP_05973297.1| MraZ protein [Providencia rustigianii DSM 4541]
 gi|282566135|gb|EFB71670.1| MraZ protein [Providencia rustigianii DSM 4541]
          Length = 152

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 70/143 (48%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L++     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYRGMLSEESKGQMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +    ++  L+ G     ++D+ GR+L+   +R   G+  EV  VG+ N F++W
Sbjct: 61  SKLSTMNPAERRVQRLLLGYASECQIDNAGRLLLASTLRQHAGLTKEVMLVGQINKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q +   Q+   +    +L ++
Sbjct: 121 DEQMW--YQQVENDIAAERLAEE 141


>gi|292490615|ref|YP_003526054.1| MraZ protein [Nitrosococcus halophilus Nc4]
 gi|291579210|gb|ADE13667.1| MraZ protein [Nitrosococcus halophilus Nc4]
          Length = 149

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 61/133 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D+KGR+S+P   R  L   C   +    D   P + +      E  EQK+
Sbjct: 1   MFRGITTLNLDAKGRLSIPAKHRRRLGTYCDGKVVVTIDLLDPCLQLYPLPEWEAVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + QA  +   + G  +  ++DS GRIL+   +RV   ++  +T VG+GN F+LW
Sbjct: 61  IALPSHNRQARYIKRQLIGHSVECELDSHGRILLPSELRVRADLKKNITLVGQGNKFELW 120

Query: 123 NPQTFRKLQEESR 135
           +   + +   E  
Sbjct: 121 DTGVWEQQMAEEE 133


>gi|54293888|ref|YP_126303.1| cell division protein MraZ [Legionella pneumophila str. Lens]
 gi|54296933|ref|YP_123302.1| cell division protein MraZ [Legionella pneumophila str. Paris]
 gi|148360439|ref|YP_001251646.1| MraZ protein [Legionella pneumophila str. Corby]
 gi|296106495|ref|YP_003618195.1| MraZ protein [Legionella pneumophila 2300/99 Alcoy]
 gi|68565706|sp|Q5WXZ5|MRAZ_LEGPL RecName: Full=Protein MraZ
 gi|68565707|sp|Q5X6J1|MRAZ_LEGPA RecName: Full=Protein MraZ
 gi|68565710|sp|Q5ZX20|MRAZ_LEGPH RecName: Full=Protein MraZ
 gi|167012252|sp|A5IG00|MRAZ_LEGPC RecName: Full=Protein MraZ
 gi|53750718|emb|CAH12125.1| hypothetical protein lpp0974 [Legionella pneumophila str. Paris]
 gi|53753720|emb|CAH15178.1| hypothetical protein lpl0944 [Legionella pneumophila str. Lens]
 gi|148282212|gb|ABQ56300.1| MraZ protein [Legionella pneumophila str. Corby]
 gi|295648396|gb|ADG24243.1| MraZ protein [Legionella pneumophila 2300/99 Alcoy]
 gi|307609706|emb|CBW99216.1| hypothetical protein LPW_09971 [Legionella pneumophila 130b]
          Length = 152

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 65/139 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR+++P  +R+ L       L    D     + +  +   +  E  +
Sbjct: 1   MFRGINAITIDTKGRLAIPTRYRSALGAEDKIPLVVTIDTEETCLLLYTAAQWQIIEDNL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F+  A ++  L+ G    +++D+ GR+L+   +R +  +E +V  +G+GN F++W
Sbjct: 61  QKLPSFNAAARRIQRLLIGHATDVEVDANGRVLLPTVLRNYAKLEKDVVMIGQGNKFEVW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           N + +   +E+   E    
Sbjct: 121 NKELWESKREQWLAEEASM 139


>gi|56459538|ref|YP_154819.1| cell division protein MraZ [Idiomarina loihiensis L2TR]
 gi|68565696|sp|Q5R0L8|MRAZ_IDILO RecName: Full=Protein MraZ
 gi|56178548|gb|AAV81270.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 152

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 64/134 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +DSKGR+++P  +R  L+  C   + C  D   P + +      +  EQK+
Sbjct: 1   MFRGATTLSLDSKGRLAIPAKYRHALSLDCEGKMVCTIDIKQPCLLLYPLPEWQIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +    +L  L+ G     +MD  GR+L++  +R   G+E ++  VG+ N F++W
Sbjct: 61  TRLSSMNPAERRLQRLLLGHADDCEMDKNGRLLLSAPLRQHAGLEKKLMLVGQLNKFEVW 120

Query: 123 NPQTFRKLQEESRN 136
           N   + +   +  +
Sbjct: 121 NEDAWHEQVAQDMD 134


>gi|331701054|ref|YP_004398013.1| protein mraZ [Lactobacillus buchneri NRRL B-30929]
 gi|329128397|gb|AEB72950.1| Protein mraZ [Lactobacillus buchneri NRRL B-30929]
          Length = 141

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 53/142 (37%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L  + +             +        E  EQKI
Sbjct: 1   MFMGEYQHNIDAKGRIIIPAKFRQDLGDKLVVTRGM-----DGCLFGYPMSEWEKVEQKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +       +  + D +GRI +   +R +  IE +   VG  N F++W
Sbjct: 56  DTLPVNKKDARYFTRFFFSAAVECEFDKQGRINIPATLRDYAKIEKKCVVVGVSNRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     ++   +  ++ +
Sbjct: 116 SDDRWNDFSNDAEENF-NEIAE 136


>gi|307275471|ref|ZP_07556613.1| protein MraZ [Enterococcus faecalis TX2134]
 gi|306507859|gb|EFM76987.1| protein MraZ [Enterococcus faecalis TX2134]
          Length = 161

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 54/144 (37%), Gaps = 6/144 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           ++  +      ID+KGR+ VP  FR  L ++ +             +     +     E 
Sbjct: 17  LAMLMGEYQHNIDAKGRLIVPSKFREELGEKFVVTRGM-----DGCLFGYPLNGWSQLEA 71

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ E       A       +      ++D +GRI +   +R    +E     +G  N  +
Sbjct: 72  KLQEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPANLRTHASLEKGCVVIGVSNRIE 131

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+ + +    +E+   +  +L +
Sbjct: 132 IWSDERWHAFSDEAEENF-DELAE 154


>gi|94501905|ref|ZP_01308415.1| hypothetical protein RED65_03035 [Oceanobacter sp. RED65]
 gi|94425958|gb|EAT10956.1| hypothetical protein RED65_03035 [Oceanobacter sp. RED65]
          Length = 151

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+ VP  +R +L +     L    D     + V      E  + K+
Sbjct: 1   MFRGVHHINLDAKGRMVVPTRYRQLLHESNDGALVVTIDTEERCLLVYPLHEWEPIQAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  A ++  L+ G    + MD+ GR+L+   +R + G+  +V  +G+GN F+LW
Sbjct: 61  EALPSFNPAARRIQRLIIGHATDVDMDTNGRMLLPGPLREYAGLNKKVVLMGQGNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     + R EY   +  
Sbjct: 121 DEDHWN----QCRQEYLDAMKD 138


>gi|219670082|ref|YP_002460517.1| cell division protein MraZ [Desulfitobacterium hafniense DCB-2]
 gi|254813274|sp|B8FT65|MRAZ_DESHD RecName: Full=Protein MraZ
 gi|219540342|gb|ACL22081.1| MraZ protein [Desulfitobacterium hafniense DCB-2]
          Length = 143

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L +R I             + V   D  +  E+K+
Sbjct: 1   MFMGEYLHTIDGKGRLIVPARFREALGERFIATKGL-----DHCLFVYPLDEWKVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A         G    ++D +GRIL+   +R +  ++ +   VG  +  ++W
Sbjct: 56  RALPFTQPEARAFVRFFFSGATECELDKQGRILLPANLREYAQLDKDAVLVGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ++ + Y  
Sbjct: 116 SQALWANYSRQAEDAYAS 133


>gi|89095268|ref|ZP_01168189.1| hypothetical protein MED92_15865 [Oceanospirillum sp. MED92]
 gi|89080475|gb|EAR59726.1| hypothetical protein MED92_15865 [Oceanospirillum sp. MED92]
          Length = 151

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 4/139 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  +A+ C   L    D     + +   +  E  + KI
Sbjct: 1   MFRGVNQINLDAKGRMAIPARYREKIAECCDGQLVATIDTEERCLLLYPLEEWEEIQAKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+ QA ++  L+ G    L MD  GR+L+   +R +  ++ ++  +G+G  F++W
Sbjct: 61  ESLPSFNPQARRIQRLLIGHATDLDMDGNGRLLLPAPLREYAELDKKIVLLGQGQKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   +      +R EY ++
Sbjct: 121 SESRWLS----TREEYLQE 135


>gi|227517911|ref|ZP_03947960.1| cell division protein MraZ [Enterococcus faecalis TX0104]
 gi|227555098|ref|ZP_03985145.1| cell division protein MraZ [Enterococcus faecalis HH22]
 gi|229546835|ref|ZP_04435560.1| cell division protein MraZ [Enterococcus faecalis TX1322]
 gi|229548929|ref|ZP_04437654.1| cell division protein MraZ [Enterococcus faecalis ATCC 29200]
 gi|293382537|ref|ZP_06628471.1| MraZ protein [Enterococcus faecalis R712]
 gi|293387862|ref|ZP_06632401.1| MraZ protein [Enterococcus faecalis S613]
 gi|294780577|ref|ZP_06745940.1| protein MraZ [Enterococcus faecalis PC1.1]
 gi|300859933|ref|ZP_07106021.1| protein MraZ [Enterococcus faecalis TUSoD Ef11]
 gi|307268068|ref|ZP_07549456.1| protein MraZ [Enterococcus faecalis TX4248]
 gi|307272002|ref|ZP_07553268.1| protein MraZ [Enterococcus faecalis TX0855]
 gi|307278961|ref|ZP_07560020.1| protein MraZ [Enterococcus faecalis TX0860]
 gi|307289410|ref|ZP_07569364.1| protein MraZ [Enterococcus faecalis TX0109]
 gi|307290050|ref|ZP_07569974.1| protein MraZ [Enterococcus faecalis TX0411]
 gi|312901053|ref|ZP_07760344.1| protein MraZ [Enterococcus faecalis TX0470]
 gi|312904550|ref|ZP_07763708.1| protein MraZ [Enterococcus faecalis TX0635]
 gi|312906860|ref|ZP_07765857.1| protein MraZ [Enterococcus faecalis DAPTO 512]
 gi|312952740|ref|ZP_07771602.1| protein MraZ [Enterococcus faecalis TX0102]
 gi|312978885|ref|ZP_07790611.1| protein MraZ [Enterococcus faecalis DAPTO 516]
 gi|227074665|gb|EEI12628.1| cell division protein MraZ [Enterococcus faecalis TX0104]
 gi|227175766|gb|EEI56738.1| cell division protein MraZ [Enterococcus faecalis HH22]
 gi|229305950|gb|EEN71946.1| cell division protein MraZ [Enterococcus faecalis ATCC 29200]
 gi|229308000|gb|EEN73987.1| cell division protein MraZ [Enterococcus faecalis TX1322]
 gi|291080085|gb|EFE17449.1| MraZ protein [Enterococcus faecalis R712]
 gi|291082709|gb|EFE19672.1| MraZ protein [Enterococcus faecalis S613]
 gi|294452404|gb|EFG20843.1| protein MraZ [Enterococcus faecalis PC1.1]
 gi|300850751|gb|EFK78500.1| protein MraZ [Enterococcus faecalis TUSoD Ef11]
 gi|306498892|gb|EFM68386.1| protein MraZ [Enterococcus faecalis TX0411]
 gi|306499665|gb|EFM69028.1| protein MraZ [Enterococcus faecalis TX0109]
 gi|306504348|gb|EFM73559.1| protein MraZ [Enterococcus faecalis TX0860]
 gi|306511297|gb|EFM80301.1| protein MraZ [Enterococcus faecalis TX0855]
 gi|306515709|gb|EFM84236.1| protein MraZ [Enterococcus faecalis TX4248]
 gi|310627114|gb|EFQ10397.1| protein MraZ [Enterococcus faecalis DAPTO 512]
 gi|310629256|gb|EFQ12539.1| protein MraZ [Enterococcus faecalis TX0102]
 gi|310632063|gb|EFQ15346.1| protein MraZ [Enterococcus faecalis TX0635]
 gi|311288322|gb|EFQ66878.1| protein MraZ [Enterococcus faecalis DAPTO 516]
 gi|311291879|gb|EFQ70435.1| protein MraZ [Enterococcus faecalis TX0470]
 gi|315026964|gb|EFT38896.1| protein MraZ [Enterococcus faecalis TX2137]
 gi|315029677|gb|EFT41609.1| protein MraZ [Enterococcus faecalis TX4000]
 gi|315031726|gb|EFT43658.1| protein MraZ [Enterococcus faecalis TX0017]
 gi|315034217|gb|EFT46149.1| protein MraZ [Enterococcus faecalis TX0027]
 gi|315144373|gb|EFT88389.1| protein MraZ [Enterococcus faecalis TX2141]
 gi|315147939|gb|EFT91955.1| protein MraZ [Enterococcus faecalis TX4244]
 gi|315149511|gb|EFT93527.1| protein MraZ [Enterococcus faecalis TX0012]
 gi|315153064|gb|EFT97080.1| protein MraZ [Enterococcus faecalis TX0031]
 gi|315156837|gb|EFU00854.1| protein MraZ [Enterococcus faecalis TX0043]
 gi|315157623|gb|EFU01640.1| protein MraZ [Enterococcus faecalis TX0312]
 gi|315162947|gb|EFU06964.1| protein MraZ [Enterococcus faecalis TX0645]
 gi|315165147|gb|EFU09164.1| protein MraZ [Enterococcus faecalis TX1302]
 gi|315168046|gb|EFU12063.1| protein MraZ [Enterococcus faecalis TX1341]
 gi|315171925|gb|EFU15942.1| protein MraZ [Enterococcus faecalis TX1342]
 gi|315173298|gb|EFU17315.1| protein MraZ [Enterococcus faecalis TX1346]
 gi|315574268|gb|EFU86459.1| protein MraZ [Enterococcus faecalis TX0309B]
 gi|315577396|gb|EFU89587.1| protein MraZ [Enterococcus faecalis TX0630]
 gi|315581577|gb|EFU93768.1| protein MraZ [Enterococcus faecalis TX0309A]
 gi|327534574|gb|AEA93408.1| cell division protein MraZ [Enterococcus faecalis OG1RF]
 gi|329574360|gb|EGG55932.1| protein MraZ [Enterococcus faecalis TX1467]
          Length = 161

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 54/144 (37%), Gaps = 6/144 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           ++  +      ID+KGR+ VP  FR  L ++ +             +     +     E 
Sbjct: 17  LAMLMGEYQHNIDAKGRLIVPSKFREELGEKFVVTRGM-----DGCLFGYPLNEWSQLEA 71

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ E       A       +      ++D +GRI +   +R    +E     +G  N  +
Sbjct: 72  KLQEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPANLRTHASLEKGCVVIGVSNRIE 131

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+ + +    +E+   +  +L +
Sbjct: 132 IWSDERWHAFSDEAEENF-DELAE 154


>gi|300722050|ref|YP_003711330.1| protein mraZ [Xenorhabdus nematophila ATCC 19061]
 gi|297628547|emb|CBJ89119.1| Protein mraZ [Xenorhabdus nematophila ATCC 19061]
          Length = 152

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPARYRETLNEESGGHMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRLLLAHTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q +   Q+   +    Q  Q+
Sbjct: 121 DEQVW--YQQVQSDIAAEQSTQE 141


>gi|227529005|ref|ZP_03959054.1| cell division protein MraZ [Lactobacillus vaginalis ATCC 49540]
 gi|227351017|gb|EEJ41308.1| cell division protein MraZ [Lactobacillus vaginalis ATCC 49540]
          Length = 142

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T  IDSKGR+ +P  FR +L    I             +     +  E  ++K+
Sbjct: 1   MFMGEYTHSIDSKGRLIIPAKFRELLGTHFIVTRGL-----DGCLFGYPLNEWEQLQEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A      ++      + D +GRI + D +     ++ +   VG  N  ++W
Sbjct: 56  KALPLTKRDARAFVRFLYSAATDCEFDKQGRINLPDTLCQHAKLQKKCVVVGVANRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +  E + +++  Q+ +
Sbjct: 116 STEKWEQFTESTEDDF-DQIAE 136


>gi|294635000|ref|ZP_06713517.1| MraZ protein [Edwardsiella tarda ATCC 23685]
 gi|291091599|gb|EFE24160.1| MraZ protein [Edwardsiella tarda ATCC 23685]
          Length = 152

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATTINLDSKGRLAVPTRYRDLLIEEAQGHMVCTIDLHHPCLLLYPLPQWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G++ +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLQKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + +T+ +      E+       L ++
Sbjct: 121 DEETWYQQVRDDIEAEQSATEILSER 146


>gi|323142010|ref|ZP_08076861.1| protein MraZ [Phascolarctobacterium sp. YIT 12067]
 gi|322413542|gb|EFY04410.1| protein MraZ [Phascolarctobacterium sp. YIT 12067]
          Length = 143

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      +D+KGR+++P   R  L  + I             + V + +     EQK+
Sbjct: 1   MLLGEYEHTLDAKGRLAMPAKLRESLGSKFIITKGL-----DGCLFVYDMEQWHQLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A   +  + GG    + D +GR+L+   +R   G+E +   VG G+  ++W
Sbjct: 56  AALPMSRKTARDFTRFLFGGACEGECDKQGRVLLPANLRRHAGLEKDAVIVGVGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +  EE+  +   +L ++
Sbjct: 116 DAGRWNEYNEENAEDVS-ELAEQ 137


>gi|315633808|ref|ZP_07889097.1| cell division protein MraZ [Aggregatibacter segnis ATCC 33393]
 gi|315477058|gb|EFU67801.1| cell division protein MraZ [Aggregatibacter segnis ATCC 33393]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 61/133 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D KGR+S+P  +R  L ++    + C  D   P + +      E  EQK+
Sbjct: 1   MFRGAATINLDVKGRISIPTRYRAELLEQNQGQMVCTVDIRQPCLLLYPLKEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F      L  ++ G     ++DS GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LGLSNFDPLQRTLQRVMLGYATECELDSAGRILISGPLRQHAKLEKSIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   ++   E+  
Sbjct: 121 SEAEWQAQIEKDM 133


>gi|251792014|ref|YP_003006734.1| cell division protein MraZ [Aggregatibacter aphrophilus NJ8700]
 gi|247533401|gb|ACS96647.1| MraZ protein [Aggregatibacter aphrophilus NJ8700]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 63/133 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L ++    + C  D   P + +      E+ EQK+
Sbjct: 1   MFRGASAVNLDAKGRLAIPTRYRAELLEQNQGQMVCTVDIRQPCLLLYPLKEWEFIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + + F      L  ++ G     ++D+ GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LDLSNFDPVQRSLQRVMLGYATECELDNAGRILISGPLRQHAKLEKSIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   ++   E+  
Sbjct: 121 SDAEWQAQVEKDM 133


>gi|89895662|ref|YP_519149.1| cell division protein MraZ [Desulfitobacterium hafniense Y51]
 gi|122482070|sp|Q24TD7|MRAZ_DESHY RecName: Full=Protein MraZ
 gi|89335110|dbj|BAE84705.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 143

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L +R I             + V   D  +  E+K+
Sbjct: 1   MFMGEYLHTIDGKGRLIVPARFREALGERFIATKGL-----DHCLFVYPLDEWKVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A         G    ++D +GRIL+   +R +  ++ +   VG  +  ++W
Sbjct: 56  RALPFTQPEARAFVRFFFSGATECELDKQGRILLPANLREYAQLDKDAVLVGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ++ + Y  
Sbjct: 116 SQALWADYSRQAEDAYAS 133


>gi|20808081|ref|NP_623252.1| cell division protein MraZ [Thermoanaerobacter tengcongensis MB4]
 gi|22001811|sp|Q8R9F8|MRAZ_THETN RecName: Full=Protein MraZ
 gi|20516664|gb|AAM24856.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 143

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 60/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      IDSKGRV +P  FR  L ++ +             + V + D  +  E+K+
Sbjct: 1   MLMGQYEHTIDSKGRVIIPAKFREELGEKFVLTKGL-----DNCLFVYSLDEWKNIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +  ++D +GRIL+   +R    IE +V F+G     ++W
Sbjct: 56  KTLPLTKKDARAFTRFFLAGAVECEVDKQGRILIPSHLREHAKIEKDVIFIGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +  + +   +  ++ +
Sbjct: 116 SKEVWEEYSKSTDVSF-EEIAE 136


>gi|145297476|ref|YP_001140317.1| cell division protein MraZ [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850248|gb|ABO88569.1| MraZ protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 60/138 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +DSKGR+++P  +R  L       L C  D   P + +   +  E  E+K+
Sbjct: 1   MLRGAHAISLDSKGRLAIPTKYRDWLRDESDGQLVCTIDIAHPCLLLYPLNEWEEIERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +    +L  L+ G     ++D  GR+L++  +R   G++ ++  VG+ N F+LW
Sbjct: 61  KMLSSMNPVERRLQPLLLGHATECELDGNGRLLLSQPLRSHAGLDKKIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +   +       
Sbjct: 121 DEARWHQQVNDDIQGLPE 138


>gi|288871269|ref|ZP_06117034.2| MraZ protein [Clostridium hathewayi DSM 13479]
 gi|288864077|gb|EFC96375.1| MraZ protein [Clostridium hathewayi DSM 13479]
          Length = 148

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           +S F+      +D+KGR+ VP  FR  L +  +             + V +++  +  E+
Sbjct: 6   ISMFMGEYNHTVDAKGRLIVPSKFREQLGEEFVVTKGL-----DGCLFVYDNEEWKALEE 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+      +  A + +     G    ++D +GRIL+   +R F GIE +   VG G+  +
Sbjct: 61  KLKSLPLTNTNARKFNRFFLAGASSCEVDKQGRILLPAVLREFAGIEKDAVLVGVGSRIE 120

Query: 121 LWNPQTFRKLQE-ESRNEYCRQL 142
           +W+   +      +   E    +
Sbjct: 121 IWSKDAWTAANTYDDMEEIAENM 143


>gi|256821905|ref|YP_003145868.1| MraZ protein [Kangiella koreensis DSM 16069]
 gi|256795444|gb|ACV26100.1| MraZ protein [Kangiella koreensis DSM 16069]
          Length = 151

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 61/138 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++VP  +R+     C   +    D F P + +      E  E K+
Sbjct: 1   MFRGATAINMDAKGRIAVPAKYRSRFEDVCSNQIVVTIDLFDPCLLLFPLPHWEQLEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             ++       ++  ++ G     ++DS GRIL+   +R +  +E ++   G+G  FQ+W
Sbjct: 61  DTFSNTDPNQRRIKRMLLGHASEHEIDSNGRILLPPVLREYAQLEKQLLLAGQGQTFQIW 120

Query: 123 NPQTFRKLQEESRNEYCR 140
           N + + K  E+       
Sbjct: 121 NEENWHKKIEQDVEALAE 138


>gi|322834429|ref|YP_004214456.1| MraZ protein [Rahnella sp. Y9602]
 gi|321169630|gb|ADW75329.1| MraZ protein [Rahnella sp. Y9602]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L++     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLSEESQGQMVCTIDLHHPCLLLYPLPEWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPIERRIQRLLLGHASECQMDNAGRLLIATTLRQHAGLAKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+ +  +E  +    Q  Q+
Sbjct: 121 DEQTWYQQVKEDID--AEQSSQE 141


>gi|238761548|ref|ZP_04622523.1| hypothetical protein ykris0001_10230 [Yersinia kristensenii ATCC
           33638]
 gi|238700062|gb|EEP92804.1| hypothetical protein ykris0001_10230 [Yersinia kristensenii ATCC
           33638]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYTLPAWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPTERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|197285926|ref|YP_002151798.1| cell division protein MraZ [Proteus mirabilis HI4320]
 gi|226710000|sp|B4F120|MRAZ_PROMH RecName: Full=Protein MraZ
 gi|194683413|emb|CAR44159.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 152

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +RT L +     + C  D   P + +      E  E K+
Sbjct: 1   MFRGATLVNLDSKGRITVPSRYRTTLNEASEGQMVCTIDLNQPCLLLYTLPEWEKIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  AALSSMNPAERRVQRLLLGHASECQMDSAGRLLLASTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q +   Q+   +    Q  Q+
Sbjct: 121 DEQVW--YQQIKEDILAEQTSQE 141


>gi|332160403|ref|YP_004296980.1| cell division protein MraZ [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607136|emb|CBY28634.1| cell division protein MraZ [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664633|gb|ADZ41277.1| cell division protein MraZ [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859313|emb|CBX69660.1| protein mraZ [Yersinia enterocolitica W22703]
          Length = 152

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYTLPAWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|311029919|ref|ZP_07708009.1| cell division protein MraZ [Bacillus sp. m3-13]
          Length = 143

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L +         +      +        +  E K+
Sbjct: 1   MFMGEYNHTIDAKGRMIVPAKFRDHLGE----TFVLTRGL-DKCLFGYPLSEWKTVEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A   +     G    ++D +GR+ +   +  +  ++ E   +G  N  ++W
Sbjct: 56  KQLPLTKKDARAFTRFFFSGASECELDKQGRVNIATPLVQYAQLDKECVVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +    E+S + +  
Sbjct: 116 SKENWNSFVEDSEDSFAE 133


>gi|311280939|ref|YP_003943170.1| MraZ protein [Enterobacter cloacae SCF1]
 gi|308750134|gb|ADO49886.1| MraZ protein [Enterobacter cloacae SCF1]
          Length = 152

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRDMLNENASGQMVCTIDIHHPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +  T+ +  +E   +       L ++
Sbjct: 121 DETTWYQRVKEDIDAEQSDSAVLSER 146


>gi|22127509|ref|NP_670932.1| cell division protein MraZ [Yersinia pestis KIM 10]
 gi|45443370|ref|NP_994909.1| cell division protein MraZ [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809546|ref|YP_653462.1| cell division protein MraZ [Yersinia pestis Antiqua]
 gi|108810577|ref|YP_646344.1| cell division protein MraZ [Yersinia pestis Nepal516]
 gi|145600351|ref|YP_001164427.1| cell division protein MraZ [Yersinia pestis Pestoides F]
 gi|150260419|ref|ZP_01917147.1| hypothetical protein YPE_2722 [Yersinia pestis CA88-4125]
 gi|162420646|ref|YP_001607304.1| cell division protein MraZ [Yersinia pestis Angola]
 gi|165928215|ref|ZP_02224047.1| mraZ protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165937886|ref|ZP_02226447.1| mraZ protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009083|ref|ZP_02229981.1| mraZ protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212171|ref|ZP_02238206.1| mraZ protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401293|ref|ZP_02306793.1| mraZ protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421965|ref|ZP_02313718.1| mraZ protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426480|ref|ZP_02318233.1| mraZ protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|218927742|ref|YP_002345617.1| cell division protein MraZ [Yersinia pestis CO92]
 gi|229837063|ref|ZP_04457228.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229840434|ref|ZP_04460593.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843024|ref|ZP_04463174.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229900769|ref|ZP_04515893.1| conserved protein [Yersinia pestis Nepal516]
 gi|270487861|ref|ZP_06204935.1| protein MraZ [Yersinia pestis KIM D27]
 gi|294502634|ref|YP_003566696.1| hypothetical protein YPZ3_0524 [Yersinia pestis Z176003]
 gi|20139013|sp|Q8ZIF8|MRAZ_YERPE RecName: Full=Protein MraZ
 gi|122382611|sp|Q1C205|MRAZ_YERPA RecName: Full=Protein MraZ
 gi|122385286|sp|Q1CMN6|MRAZ_YERPN RecName: Full=Protein MraZ
 gi|167012286|sp|A4TQ92|MRAZ_YERPP RecName: Full=Protein MraZ
 gi|226710024|sp|A9R133|MRAZ_YERPG RecName: Full=Protein MraZ
 gi|21960607|gb|AAM87183.1|AE013965_10 hypothetical protein y3635 [Yersinia pestis KIM 10]
 gi|45438239|gb|AAS63786.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108774225|gb|ABG16744.1| hypothetical protein YPN_0412 [Yersinia pestis Nepal516]
 gi|108781459|gb|ABG15517.1| hypothetical protein YPA_3555 [Yersinia pestis Antiqua]
 gi|115346353|emb|CAL19225.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145212047|gb|ABP41454.1| hypothetical protein YPDSF_3096 [Yersinia pestis Pestoides F]
 gi|149289827|gb|EDM39904.1| hypothetical protein YPE_2722 [Yersinia pestis CA88-4125]
 gi|162353461|gb|ABX87409.1| mraZ protein [Yersinia pestis Angola]
 gi|165914298|gb|EDR32914.1| mraZ protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919826|gb|EDR37127.1| mraZ protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165992422|gb|EDR44723.1| mraZ protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206917|gb|EDR51397.1| mraZ protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960102|gb|EDR56123.1| mraZ protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049318|gb|EDR60726.1| mraZ protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167054578|gb|EDR64386.1| mraZ protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229682108|gb|EEO78200.1| conserved protein [Yersinia pestis Nepal516]
 gi|229689900|gb|EEO81959.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696800|gb|EEO86847.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706006|gb|EEO92015.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262360664|gb|ACY57385.1| hypothetical protein YPD4_0476 [Yersinia pestis D106004]
 gi|270336365|gb|EFA47142.1| protein MraZ [Yersinia pestis KIM D27]
 gi|294353093|gb|ADE63434.1| hypothetical protein YPZ3_0524 [Yersinia pestis Z176003]
 gi|320016912|gb|ADW00484.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 152

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRESLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|123441023|ref|YP_001005012.1| cell division protein MraZ [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|167012284|sp|A1JJI4|MRAZ_YERE8 RecName: Full=Protein MraZ
 gi|122087984|emb|CAL10772.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 152

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYTLPAWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|296133668|ref|YP_003640915.1| MraZ protein [Thermincola sp. JR]
 gi|296032246|gb|ADG83014.1| MraZ protein [Thermincola potens JR]
          Length = 145

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGRV +P  FR  L  + I             + +   +     EQK+
Sbjct: 1   MFMGEFQHTIDAKGRVIIPAKFREGLGDKFIATKGL-----DNCLFLYPMEEWRLLEQKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+   +R    ++ EV  +G     ++W
Sbjct: 56  KSLPFTRADARAFVRFFFSGATECEVDKQGRILLPANLRSHARLDKEVVVIGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + K   +S + Y  +L +K
Sbjct: 116 SREEWEKYSRQSESTY-EELAEK 137


>gi|116334057|ref|YP_795584.1| cell division protein MraZ [Lactobacillus brevis ATCC 367]
 gi|122269259|sp|Q03QG9|MRAZ_LACBA RecName: Full=Protein MraZ
 gi|116099404|gb|ABJ64553.1| hypothetical protein, MraZ [Lactobacillus brevis ATCC 367]
          Length = 143

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR  L ++ +             +           ++K+
Sbjct: 1   MFMGEFEHSVDTKGRLIIPAKFREQLGEQFVVTRGM-----DGCLFGYPMTEWTALQEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A       +      ++D +GRI +   +R    +  +   VG  N F++W
Sbjct: 56  KALPVNRKDARAFVRFFYSAATECELDKQGRINLPKSLRDHAALTKQCVIVGVANRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +     ++  ++   + +
Sbjct: 116 SAERWNDFSTKAEEDF-DDIAE 136


>gi|302389507|ref|YP_003825328.1| MraZ protein [Thermosediminibacter oceani DSM 16646]
 gi|302200135|gb|ADL07705.1| MraZ protein [Thermosediminibacter oceani DSM 16646]
          Length = 143

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR +L    I             + V   D     EQK+
Sbjct: 1   MFMGQFQHSLDAKGRLIIPSKFRELLGDSFILTKGL-----DRCLFVYPKDEWCLLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G + +++D +GRIL+   +R + GIE +V  +G  N  ++W
Sbjct: 56  KTLPLTKKDARAFIRFFFSGAVEVEIDKQGRILIPPMLREYAGIEKDVVIIGVSNRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    +E+ + Y  ++ +
Sbjct: 116 SQKEWEAYCKEAESSY-EEIAE 136


>gi|238786714|ref|ZP_04630515.1| hypothetical protein yfred0001_16780 [Yersinia frederiksenii ATCC
           33641]
 gi|238725082|gb|EEQ16721.1| hypothetical protein yfred0001_16780 [Yersinia frederiksenii ATCC
           33641]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SKLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|148543818|ref|YP_001271188.1| cell division protein MraZ [Lactobacillus reuteri DSM 20016]
 gi|184153221|ref|YP_001841562.1| hypothetical protein LAR_0566 [Lactobacillus reuteri JCM 1112]
 gi|194468374|ref|ZP_03074360.1| MraZ protein [Lactobacillus reuteri 100-23]
 gi|227544881|ref|ZP_03974930.1| cell division protein MraZ [Lactobacillus reuteri CF48-3A]
 gi|300909899|ref|ZP_07127359.1| cell division protein MraZ [Lactobacillus reuteri SD2112]
 gi|325682651|ref|ZP_08162168.1| cell division protein MraZ [Lactobacillus reuteri MM4-1A]
 gi|167012251|sp|A5VJ27|MRAZ_LACRD RecName: Full=Protein MraZ
 gi|226709990|sp|B2G6K0|MRAZ_LACRJ RecName: Full=Protein MraZ
 gi|77745353|gb|ABB02577.1| unknown [Lactobacillus reuteri]
 gi|148530852|gb|ABQ82851.1| MraZ protein [Lactobacillus reuteri DSM 20016]
 gi|183224565|dbj|BAG25082.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|194453227|gb|EDX42125.1| MraZ protein [Lactobacillus reuteri 100-23]
 gi|227185155|gb|EEI65226.1| cell division protein MraZ [Lactobacillus reuteri CF48-3A]
 gi|300892547|gb|EFK85907.1| cell division protein MraZ [Lactobacillus reuteri SD2112]
 gi|324978490|gb|EGC15440.1| cell division protein MraZ [Lactobacillus reuteri MM4-1A]
          Length = 142

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 54/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +   T  IDSKGR+ +P  FR  L    I             +     +     EQK+
Sbjct: 1   MLMGEFTHTIDSKGRLIIPAKFREQLGAHFIVTRGL-----DGCLFGYPLNEWAILEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A      ++      ++D +GRI +   +R    +E +   VG  N  ++W
Sbjct: 56  KALPLTKRDARAFVRFLYSAATDCEIDKQGRINIPITLRTHASLEKKCVIVGVSNRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + K   E+ + +  ++ +
Sbjct: 116 SAERWNKFTSETADNF-DEIAE 136


>gi|270157408|ref|ZP_06186065.1| MraZ protein [Legionella longbeachae D-4968]
 gi|269989433|gb|EEZ95687.1| MraZ protein [Legionella longbeachae D-4968]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 63/135 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR+++P  +R  L       L    D     + +  +   +  E  +
Sbjct: 1   MFRGINAITIDTKGRLAIPTRYRAALRADEKIPLVVTIDTEETCLLLYTAAQWQIIENNL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F+  A ++  L+ G    +++D+ GR+L+   +R +  +E +V  +G+GN F++W
Sbjct: 61  QKLPSFNAAARRIQRLLIGHATDVEVDTNGRVLLPTVLRNYAQLEKDVVMIGQGNKFEVW 120

Query: 123 NPQTFRKLQEESRNE 137
           N   +   +E+   E
Sbjct: 121 NKDIWETRREQWLAE 135


>gi|51595029|ref|YP_069220.1| cell division protein MraZ [Yersinia pseudotuberculosis IP 32953]
 gi|153947014|ref|YP_001402353.1| cell division protein MraZ [Yersinia pseudotuberculosis IP 31758]
 gi|170025742|ref|YP_001722247.1| cell division protein MraZ [Yersinia pseudotuberculosis YPIII]
 gi|186894035|ref|YP_001871147.1| cell division protein MraZ [Yersinia pseudotuberculosis PB1/+]
 gi|90103503|sp|Q66EL4|MRAZ_YERPS RecName: Full=Protein MraZ
 gi|167012285|sp|A7FM75|MRAZ_YERP3 RecName: Full=Protein MraZ
 gi|226710023|sp|B2K4D7|MRAZ_YERPB RecName: Full=Protein MraZ
 gi|226710025|sp|B1JK90|MRAZ_YERPY RecName: Full=Protein MraZ
 gi|51588311|emb|CAH19919.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|152958509|gb|ABS45970.1| mraZ protein [Yersinia pseudotuberculosis IP 31758]
 gi|169752276|gb|ACA69794.1| MraZ protein [Yersinia pseudotuberculosis YPIII]
 gi|186697061|gb|ACC87690.1| MraZ protein [Yersinia pseudotuberculosis PB1/+]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRESLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|238791164|ref|ZP_04634803.1| hypothetical protein yinte0001_29130 [Yersinia intermedia ATCC
           29909]
 gi|238797716|ref|ZP_04641211.1| hypothetical protein ymoll0001_7950 [Yersinia mollaretii ATCC
           43969]
 gi|238718468|gb|EEQ10289.1| hypothetical protein ymoll0001_7950 [Yersinia mollaretii ATCC
           43969]
 gi|238729297|gb|EEQ20812.1| hypothetical protein yinte0001_29130 [Yersinia intermedia ATCC
           29909]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|253576121|ref|ZP_04853453.1| mraZ protein [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844464|gb|EES72480.1| mraZ protein [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 145

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR +L    +             + V      E  EQK+
Sbjct: 1   MFMGEFQHSIDDKGRIIIPAKFRELLGSSFVVTRGL-----DQCLFVYPMQEWEVLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    + D +GR+ +   +R +  +E +   +G  N  ++W
Sbjct: 56  KALPLMKSDARAFTRFFFSGATECEWDKQGRVNLPSNLRQYAKLEKDCVVLGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +  T+ +  ++S + +  ++ +K
Sbjct: 116 SKDTWEQYFQQSEDTF-NEIAEK 137


>gi|167037219|ref|YP_001664797.1| cell division protein MraZ [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|320115638|ref|YP_004185797.1| MraZ protein [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|226710017|sp|B0K8J8|MRAZ_THEP3 RecName: Full=Protein MraZ
 gi|166856053|gb|ABY94461.1| MraZ protein [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928729|gb|ADV79414.1| MraZ protein [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 143

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGRV +P  FR  L  R +             + V + +  +  E K+
Sbjct: 1   MLMGQYEHTIDAKGRVIIPAKFRGELGDRFVLTKGL-----DNCLFVYSLEEWKNIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +  ++D +GRIL+   +R    IE +V F+G     ++W
Sbjct: 56  KTLPLTKKDARAFTRFFLAGAVECEIDKQGRILIPANLREHAKIEKDVIFIGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +    +   +  ++ +
Sbjct: 116 SKEVWEEYSNNTDVSF-EEIAE 136


>gi|291563992|emb|CBL42808.1| mraZ protein [butyrate-producing bacterium SS3/4]
          Length = 141

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  ID+KGR+ VP  FR  L    +             + V  +   + FE+K+
Sbjct: 1   MFIGEYSHTIDAKGRLIVPSKFREQLGDEFVVTKGL-----DGCLFVYENSEWKSFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + S     G    ++D +GRIL+   +R F  +E +V  VG G+  ++W
Sbjct: 56  HALPLTNANARKFSRFFLAGACACEVDRQGRILIPSVLREFAKLEKDVVLVGVGSRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQL 142
           N   +  K   +   E    +
Sbjct: 116 NKAVWNEKNVYDDMEEIAENM 136


>gi|238760088|ref|ZP_04621238.1| hypothetical protein yaldo0001_27680 [Yersinia aldovae ATCC 35236]
 gi|238701707|gb|EEP94274.1| hypothetical protein yaldo0001_27680 [Yersinia aldovae ATCC 35236]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLTEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|157368997|ref|YP_001476986.1| cell division protein MraZ [Serratia proteamaculans 568]
 gi|167012273|sp|A8G9R8|MRAZ_SERP5 RecName: Full=Protein MraZ
 gi|157320761|gb|ABV39858.1| MraZ protein [Serratia proteamaculans 568]
          Length = 152

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L ++    + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRELLNEQSEGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLATTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|317129307|ref|YP_004095589.1| MraZ protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474255|gb|ADU30858.1| MraZ protein [Bacillus cellulosilyticus DSM 2522]
          Length = 143

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 50/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L    +             + V   D  +  EQK+
Sbjct: 1   MFMGEFHHSIDEKGRMIVPAKFRESLGSSFVVTRGM-----DKCLFVYPEDEWKQLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +R +  +  E   +G  N  ++W
Sbjct: 56  KTLPFTKKDARAFTRFFFSGATECELDKQGRVNIASTLRNYAQLTKECVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +   ES   +  
Sbjct: 116 SKAIWEEYFAESEESFAE 133


>gi|308048059|ref|YP_003911625.1| MraZ protein [Ferrimonas balearica DSM 9799]
 gi|307630249|gb|ADN74551.1| MraZ protein [Ferrimonas balearica DSM 9799]
          Length = 152

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 62/138 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L  +C   L C  D   P + +      E  EQK+
Sbjct: 1   MFRGANAITMDSKGRLTVPTRYRDSLRSQCGGQLICTVDIQSPCLLLYPLPEWERVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  L+ G     ++D  GR+L++  +R + G++  V  VG+ N F+LW
Sbjct: 61  MSLSDTQPAERAIKRLLLGYATEGELDKAGRLLLSAPLRQYAGLDKSVMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   ++   + +  +   
Sbjct: 121 SEANWQDQIQAAHQQVSE 138


>gi|270291463|ref|ZP_06197685.1| mraZ protein [Pediococcus acidilactici 7_4]
 gi|270280309|gb|EFA26145.1| mraZ protein [Pediococcus acidilactici 7_4]
          Length = 143

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR  L +  +             +        +  E+K+
Sbjct: 1   MFMGEFEHSLDNKGRLIIPSKFRDQLGEDFVITRGL-----DGCLFGYPLSEWKLVEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++              +         D +GRI++   +RV   ++ E   VG  N  ++W
Sbjct: 56  SQLPSNKKNNRAFVRFMFADAAQCNFDKQGRIIIPKKLRVHADLQKECVLVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   +    EE+   +   + +
Sbjct: 116 NKARWESAIEETEANF-DDIAE 136


>gi|312869517|ref|ZP_07729672.1| protein MraZ [Lactobacillus oris PB013-T2-3]
 gi|311094964|gb|EFQ53253.1| protein MraZ [Lactobacillus oris PB013-T2-3]
          Length = 142

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 51/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ +P  FR  L    +             +        +  E K+
Sbjct: 1   MLMGEYNHVIDAKGRLIIPAKFRDQLGASFVITRGL-----DGCLFGYPQAEWQRLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A      ++      ++D +GR+ +   +R    ++ +   +G  N F++W
Sbjct: 56  AALPLTKRDARAFVRFLYSAATECELDRQGRVNIPAILRQHASLQKDCVIIGVSNRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +      + + +  ++ +
Sbjct: 116 SADRWNDYSATTADNF-DEIAE 136


>gi|119944894|ref|YP_942574.1| MraZ protein [Psychromonas ingrahamii 37]
 gi|167012264|sp|A1SU10|MRAZ_PSYIN RecName: Full=Protein MraZ
 gi|119863498|gb|ABM02975.1| MraZ protein [Psychromonas ingrahamii 37]
          Length = 152

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 57/135 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGR+++P  +R  L   C     C  D   P + +   +     E K+
Sbjct: 1   MLRGANAINLDTKGRIAIPTRYRDWLGDTCQGQFVCTIDIQSPCLLIYPLNEWLLIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  + Q  +L  L+ G     ++D  GR L+   +R    ++ +V  VG+ N F+LW
Sbjct: 61  RALSSTNPQERRLQRLILGYATESELDKSGRALIAPTLRQHAKLQKKVMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNE 137
           +   + +  +    +
Sbjct: 121 DEDMWNQQIKNDLED 135


>gi|229541209|ref|ZP_04430269.1| MraZ protein [Bacillus coagulans 36D1]
 gi|229325629|gb|EEN91304.1| MraZ protein [Bacillus coagulans 36D1]
          Length = 143

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 51/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L           +      I    +D  +  E+K+
Sbjct: 1   MFMGEYRHNIDVKGRLIVPAKFREQLGD----TFVITRGL-DRCIFGYPADEWKQVEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    + D +GRIL+   +  +  +E E   +G  N  ++W
Sbjct: 56  KSLPLTKKDARAFTRFFFSGATECEWDKQGRILIPAPLLSYAKLEKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  +ES   +  
Sbjct: 116 SKDLWEEYFQESEASFAD 133


>gi|239623437|ref|ZP_04666468.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521468|gb|EEQ61334.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 141

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 55/141 (39%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L    +             + V  +      E+K+
Sbjct: 1   MFMGEYNHTVDAKGRLIVPSKFREQLGDEFVVTKGL-----DNCLFVYENSEWTALEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    + S  +  G    ++D +GRIL+   +R F GIE +   VG G+  ++W
Sbjct: 56  RTLPLTNAAGRKFSRFLLAGATTCEVDKQGRILLPAILREFAGIEKDAVLVGVGSRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQL 142
           +   +      +   E    +
Sbjct: 116 SKDKWIEANTFDDMEEIAEHM 136


>gi|329295549|ref|ZP_08252885.1| cell division protein MraZ [Plautia stali symbiont]
          Length = 152

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRELLLAESQGQMVCTIDLHQPCLLLYTLPEWEIIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 61  AQLSSMNPNERRVQRLLLGHASECQMDNAGRLLLANTLRQHASLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSAQEPLSER 146


>gi|303240802|ref|ZP_07327315.1| MraZ protein [Acetivibrio cellulolyticus CD2]
 gi|302591690|gb|EFL61425.1| MraZ protein [Acetivibrio cellulolyticus CD2]
          Length = 143

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 53/144 (36%), Gaps = 8/144 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGRV VP  FR  L ++ I             +   +++     E K+
Sbjct: 1   MFYGEYQHSVDAKGRVIVPSKFRDGLGEKFIVTKGL-----DNCLFAYSAEEWSNLETKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G    ++D +GRIL+   +R + G++ ++  +G     ++W
Sbjct: 56  KSLPFTDKDVRAFVRFFFAGATECEVDKQGRILLPQNLREYAGLDKDIYVIGVSTRVEIW 115

Query: 123 NPQTFRKL---QEESRNEYCRQLL 143
           +   +      +  S +    ++ 
Sbjct: 116 DKAKWENYSGDENMSADNIAEKMA 139


>gi|152979595|ref|YP_001345224.1| cell division protein MraZ [Actinobacillus succinogenes 130Z]
 gi|171704377|sp|A6VQP2|MRAZ_ACTSZ RecName: Full=Protein MraZ
 gi|150841318|gb|ABR75289.1| MraZ protein [Actinobacillus succinogenes 130Z]
          Length = 152

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 58/133 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  + ++    L C  D   P + +      E  EQK+
Sbjct: 1   MFRGASAINLDAKGRLAIPTRYRPEILEQNQGQLVCTVDIRQPCLLLYPLSEWEMIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F      L  ++ G      +D  GRIL+++ +R    +E  +  VG+ N F++W
Sbjct: 61  LSLANFDPALRSLQRVMLGYATECALDGAGRILLSEPLRQRAKLEKNIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   +    E+  
Sbjct: 121 SESEWNAQIEQDM 133


>gi|88704091|ref|ZP_01101806.1| Protein mraZ [Congregibacter litoralis KT71]
 gi|88701918|gb|EAQ99022.1| Protein mraZ [Congregibacter litoralis KT71]
          Length = 151

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 68/147 (46%), Gaps = 6/147 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P   R  L ++C  ++    D     + +      E  EQ +
Sbjct: 1   MFRGVQHINMDAKGRLAIPARQREPLLEQCAGEIVVTIDTQTSCLCIYPLPAWEQIEQDL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    +   L+ G    +++DS GR+L+   +R +  +E ++  VG+GN  +LW
Sbjct: 61  QKLPSLNPAVKRFQRLMLGYATDIQLDSNGRMLLPPSLREYARLEKKLVLVGQGNKMELW 120

Query: 123 NPQTFRKLQEESRNE------YCRQLL 143
           + + +   ++++  +      +  +L+
Sbjct: 121 SEELWIVERDKALEDVGADEPWPDELM 147


>gi|251788241|ref|YP_003002962.1| cell division protein MraZ [Dickeya zeae Ech1591]
 gi|307132592|ref|YP_003884608.1| hypothetical protein Dda3937_02447 [Dickeya dadantii 3937]
 gi|247536862|gb|ACT05483.1| MraZ protein [Dickeya zeae Ech1591]
 gi|306530121|gb|ADN00052.1| conserved protein [Dickeya dadantii 3937]
          Length = 152

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/146 (26%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRDLLNEEAQGQMVCTIDLHQPCLLLYLLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRILIASTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +  +E   +       L ++
Sbjct: 121 DEQTWYRQVKEDIDAEQSTQEPLSER 146


>gi|160880612|ref|YP_001559580.1| MraZ protein [Clostridium phytofermentans ISDg]
 gi|189028614|sp|A9KM87|MRAZ_CLOPH RecName: Full=Protein MraZ
 gi|160429278|gb|ABX42841.1| MraZ protein [Clostridium phytofermentans ISDg]
          Length = 141

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L +  +  +          + V  ++  ++F +++
Sbjct: 1   MFMGEYNHIIDAKGRIIVPSKFRDSLGEHFVVTVGL-----DGCLFVYPNEEWQHFVEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + +A QL      G    ++D +GRIL+   +R   G++ ++ FVG  +  ++W
Sbjct: 56  KNLPG-NKEARQLQRYFMAGAADCEVDKQGRILIPGNLRQHAGLDKDIVFVGVLSKIEIW 114

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +     ++ +E    + +
Sbjct: 115 SKERWESNSYDNMDEIADHMSE 136


>gi|256846967|ref|ZP_05552413.1| mraZ [Lactobacillus coleohominis 101-4-CHN]
 gi|256715631|gb|EEU30606.1| mraZ [Lactobacillus coleohominis 101-4-CHN]
          Length = 142

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR+ L +R +             +S  + +  +  +Q++
Sbjct: 1   MFMGEFNHSIDNKGRLIIPAKFRSQLGERFVITRGM-----DKCLSGYSMNEWDQLKQQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +         Q   L++   I  + D +GR+ ++  +  +  I  +   VG  ++F++W
Sbjct: 56  EKLPMTKKNVRQFVRLIYSAAIECEFDRQGRVNLSKTLINYANISKKCVVVGVSSHFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++K  +++  ++  ++ +
Sbjct: 116 DEDAWQKYSDQAAEDF-DEVAE 136


>gi|254781106|ref|YP_003065519.1| cell division protein MraZ [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040783|gb|ACT57579.1| cell division protein MraZ [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 145

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 145/145 (100%), Positives = 145/145 (100%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ
Sbjct: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ
Sbjct: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LWNPQTFRKLQEESRNEYCRQLLQK
Sbjct: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145


>gi|297583941|ref|YP_003699721.1| MraZ protein [Bacillus selenitireducens MLS10]
 gi|297142398|gb|ADH99155.1| MraZ protein [Bacillus selenitireducens MLS10]
          Length = 143

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 49/138 (35%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L  + I             + V         E K+
Sbjct: 1   MFMGEHHHNIDDKGRMIIPARFREELGAKFIVTRGM-----DKCLFVYPQKEWNVIEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR  +   +R +  +E E   +G  N  ++W
Sbjct: 56  KSLPFTKKDARAFTRFFFSGATECELDKQGRANIPVTLRTYADLEKECVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   ++   EES   +  
Sbjct: 116 SKSVWQTYFEESEESFSD 133


>gi|26988062|ref|NP_743487.1| cell division protein MraZ [Pseudomonas putida KT2440]
 gi|24982786|gb|AAN66951.1|AE016324_1 conserved hypothetical protein TIGR00242 [Pseudomonas putida
           KT2440]
          Length = 157

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 59/133 (44%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F       +D+KGR+++P  +R  L  RC   L    D   P + V   D  E  E K
Sbjct: 6   AVFRGANAVSLDAKGRLAMPSRYRDELDSRCNGQLIVTIDAVDPCLCVYPLDEWEQIEAK 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +        +  +L  L+ G  + L++D  GR L+   +R +  ++ +   VG+ N FQL
Sbjct: 66  LRALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKKAMLVGQLNKFQL 125

Query: 122 WNPQTFRKLQEES 134
           W+   +  +    
Sbjct: 126 WDEDAWNAVSAAD 138


>gi|212712748|ref|ZP_03320876.1| hypothetical protein PROVALCAL_03845 [Providencia alcalifaciens DSM
           30120]
 gi|212684664|gb|EEB44192.1| hypothetical protein PROVALCAL_03845 [Providencia alcalifaciens DSM
           30120]
          Length = 152

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 68/140 (48%), Gaps = 3/140 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L++     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYRGMLSEESKGQMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +    ++  L+ G     ++D+ GR+L+   +R   G+  EV  VG+ N F++W
Sbjct: 61  SKLSTMNPVERRVQRLLLGHASECQIDNAGRLLLASTLRQHAGLTKEVMLVGQINKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQL 142
           + Q +    ++  N+   + 
Sbjct: 121 DEQMW---YQQVENDIAAER 137


>gi|270263950|ref|ZP_06192218.1| protein MraZ [Serratia odorifera 4Rx13]
 gi|270042143|gb|EFA15239.1| protein MraZ [Serratia odorifera 4Rx13]
          Length = 152

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L ++    + C  D     + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEQSQGQMVCTIDLHQSCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLATTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|323701279|ref|ZP_08112954.1| MraZ protein [Desulfotomaculum nigrificans DSM 574]
 gi|323533881|gb|EGB23745.1| MraZ protein [Desulfotomaculum nigrificans DSM 574]
          Length = 142

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L  R I             + V         EQK+
Sbjct: 1   MFMGEFQHNIDPKGRLIIPARFREGLGDRFIVTKGL-----DNCLFVYPPAEWAEVEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+ + +R +  ++ E   VG     ++W
Sbjct: 56  KSLPFARADARAFVRFFFSGATECEVDKQGRILLPNNLREYARLDKETVIVGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
               + +   ++   +  +L +K
Sbjct: 116 AKDEWDRYNAKAEASF-EELAEK 137


>gi|332288561|ref|YP_004419413.1| cell division protein MraZ [Gallibacterium anatis UMN179]
 gi|330431457|gb|AEC16516.1| cell division protein MraZ [Gallibacterium anatis UMN179]
          Length = 152

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L ++    L C  D   P + +      E  EQK+
Sbjct: 1   MFRGASLINLDAKGRLAIPTRYRAELQEKEQGQLICTADIRQPCLLLYPLSEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F     +L  ++ G     ++D  GRIL++  +R    +E E+  VG+ N F++W
Sbjct: 61  LQLPNFDETGRRLQRVMLGYATECELDKTGRILLSPALRQHAALEKEIMLVGQLNKFEIW 120

Query: 123 NPQTF 127
               +
Sbjct: 121 QADRW 125


>gi|242238091|ref|YP_002986272.1| cell division protein MraZ [Dickeya dadantii Ech703]
 gi|242130148|gb|ACS84450.1| MraZ protein [Dickeya dadantii Ech703]
          Length = 152

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 64/134 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRELLNEEAQGQMVCTIDLHQPCLLLYLLPEWELIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +       ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMHPAERRVQRLLLGHASECQMDGAGRLLIAPTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRN 136
           + QT+ +  +E  +
Sbjct: 121 DEQTWYRQVKEDMD 134


>gi|271502051|ref|YP_003335077.1| MraZ protein [Dickeya dadantii Ech586]
 gi|270345606|gb|ACZ78371.1| MraZ protein [Dickeya dadantii Ech586]
          Length = 152

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 39/146 (26%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRDLLNEEAQGQMVCTIDLHQPCLLLYLLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRILIASTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +  +E   +       L ++
Sbjct: 121 DEQTWYRQVKEDIDAEQSTQEPLSER 146


>gi|163794518|ref|ZP_02188489.1| hypothetical protein BAL199_04874 [alpha proteobacterium BAL199]
 gi|159180242|gb|EDP64765.1| hypothetical protein BAL199_04874 [alpha proteobacterium BAL199]
          Length = 156

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 68/140 (48%), Gaps = 1/140 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS    KID KGRVSVP  FR  L Q   T L  +  F  P I     + +E   +
Sbjct: 1   MAVFLSTFANKIDKKGRVSVPATFRAALEQEKSTGLILYPSFKHPCIEGCGDERIEQIAE 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   + FS +A  L   +    I L +D +GR++M   +  F  I++   FVG+G  FQ
Sbjct: 61  SIDALDAFSEEAENLQ-TILADSIRLTVDGDGRVMMPKELIDFAEIDDTAVFVGQGKSFQ 119

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P T+   + E R    +
Sbjct: 120 IWKPATYETYRSEKRARARQ 139


>gi|320540414|ref|ZP_08040064.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029345|gb|EFW11374.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 152

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAIPTRYRDSLHEESQGQMVCTIDLCQPCLLLYPLPEWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLATTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + +T+ +  +   +++      L ++
Sbjct: 121 DERTWYQQVKDDIDAKQSPQEPLSER 146


>gi|170718773|ref|YP_001783957.1| cell division protein MraZ [Haemophilus somnus 2336]
 gi|189028622|sp|B0US58|MRAZ_HAES2 RecName: Full=Protein MraZ
 gi|168826902|gb|ACA32273.1| MraZ protein [Haemophilus somnus 2336]
          Length = 152

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 65/133 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R  + +     + C  D   P + +   +  E  EQK+
Sbjct: 1   MFRGASAVNLDSKGRIAIPTRYRPEILEINQGQMVCTVDIRQPCLLLYPLNQWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ + F+ +   L  ++ G     ++DS GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  SKLSNFNPEERSLQRVMLGYATECELDSAGRILISAPLRQHAKLEKSIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   ++   E+  
Sbjct: 121 SESEWQAQIEKDM 133


>gi|220933940|ref|YP_002512839.1| MraZ protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|254813294|sp|B8GMM0|MRAZ_THISH RecName: Full=Protein MraZ
 gi|219995250|gb|ACL71852.1| MraZ protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 150

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 1/135 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L + C   L    D     + V      E  EQ +
Sbjct: 1   MFRGVANLNLDTKGRMAMPSRYRDRLVETCEGRLVITVD-RDGCLLVYPQPEWERIEQAL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   Q  +L  L+ G     ++D +GRIL+   +R + G++  V  VG+GN F+LW
Sbjct: 60  MSRPNMDRQVRRLQRLLVGHATECELDGQGRILLPPPLRDYAGLDKRVVLVGQGNKFELW 119

Query: 123 NPQTFRKLQEESRNE 137
           +  T+ K ++E   E
Sbjct: 120 DEDTWVKSRDEWFKE 134


>gi|114566355|ref|YP_753509.1| hypothetical protein Swol_0817 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122318564|sp|Q0AYR6|MRAZ_SYNWW RecName: Full=Protein MraZ
 gi|114337290|gb|ABI68138.1| protein of unknown function UPF0040 [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 143

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      +D KGR+++P  FR  +  + +             I +   D  +  E+K+
Sbjct: 1   MFLGEYQHSLDEKGRITIPAKFREEIGYKFVATKGL-----DNCIFLYPQDEWQLIEKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G   L +D +GR ++   +R + GI+ +V  +G G   ++W
Sbjct: 56  RSLPFTRADVRSFVRFFFSGAAELDLDRQGRSVLPLNLREYAGIDRDVIIIGVGTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    E +++ Y  ++ +
Sbjct: 116 STEKWTDYNENAQSSY-EEIAE 136


>gi|323486708|ref|ZP_08092029.1| hypothetical protein HMPREF9474_03780 [Clostridium symbiosum
           WAL-14163]
 gi|323692153|ref|ZP_08106396.1| MraZ protein [Clostridium symbiosum WAL-14673]
 gi|323400089|gb|EGA92466.1| hypothetical protein HMPREF9474_03780 [Clostridium symbiosum
           WAL-14163]
 gi|323503727|gb|EGB19546.1| MraZ protein [Clostridium symbiosum WAL-14673]
          Length = 144

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           ++ F+      ID+KGR+ VP  FR  L    +             + V ++   + FE+
Sbjct: 2   IAMFMGEYNHTIDAKGRLIVPSKFREQLGDEFVVTKGL-----DGCLFVYDNSEWKNFEE 56

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+      +  A + S     G    ++D +GRIL+   +R F  +E EV  VG G+  +
Sbjct: 57  KLQSLPLTNTNARKFSRFFLAGASACEVDKQGRILLPAVLREFACLEKEVVLVGVGSRIE 116

Query: 121 LWNPQTF-RKLQEESRNEYCRQL 142
           +WN  T+  K   +  +E    +
Sbjct: 117 IWNKATWTEKNVYDDMDEIAENM 139


>gi|160935715|ref|ZP_02083090.1| hypothetical protein CLOBOL_00605 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441459|gb|EDP19169.1| hypothetical protein CLOBOL_00605 [Clostridium bolteae ATCC
           BAA-613]
          Length = 141

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 55/141 (39%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L    +             + V  +      E+K+
Sbjct: 1   MFMGEYNHTVDAKGRLIVPSKFREQLGDEFVVTKGL-----DNCLFVYENSEWAALEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    + S  +  G    ++D +GRIL+   +R F GIE +   VG G+  ++W
Sbjct: 56  RTLPLTNAAGRKFSRFLLAGATTCEVDKQGRILLPAVLREFAGIEKDAVLVGVGSRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQL 142
           +   +      +   E    +
Sbjct: 116 SKDKWLDANTFDDMEEIAEHM 136


>gi|91791713|ref|YP_561364.1| cell division protein MraZ [Shewanella denitrificans OS217]
 gi|123166542|sp|Q12SD5|MRAZ_SHEDO RecName: Full=Protein MraZ
 gi|91713715|gb|ABE53641.1| protein of unknown function UPF0040 [Shewanella denitrificans
           OS217]
          Length = 152

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 57/133 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINMDAKGRIAIPMRYRDQLHVHGTGVIVITIDIQSQCLLIYPLQEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +         + G     ++DS GR+L+   +R + G++ +   VG  N F+LW
Sbjct: 61  LTLSDTNPVERSFKRRLLGHAHECELDSHGRVLVPPTLRQYAGLDKKAMLVGLLNKFELW 120

Query: 123 NPQTFRKLQEESR 135
           +   +++  ++S+
Sbjct: 121 DEAAWQQQMDDSQ 133


>gi|56964130|ref|YP_175861.1| cell division protein MraZ [Bacillus clausii KSM-K16]
 gi|90103480|sp|Q5WFG0|MRAZ_BACSK RecName: Full=Protein MraZ
 gi|56910373|dbj|BAD64900.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 143

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 51/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      ID KGR+ VP  FR  L     T     +      + V      +  E ++
Sbjct: 1   MFLGEYRHTIDEKGRMIVPAKFREHLG----TPFVITRGL-DNCLFVYPQSEWDKLESQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A   +     G    ++D +GR+ +   +R +  +E E   +G  N  ++W
Sbjct: 56  KELPFTKKDARAFTRFFFSGASECELDKQGRMNVPQPLREYAKLEKECVVIGVSNRMEVW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     +S + +  
Sbjct: 116 SKTLWEDYVSQSEDSFAD 133


>gi|317493288|ref|ZP_07951710.1| mraZ protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918681|gb|EFV40018.1| mraZ protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 152

 Score =  140 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D KGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATTINLDGKGRLAVPMRYRELLLEESQGQMVCTIDLHQPCLLLYTLPQWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRIQRLLLGHASECQMDSAGRLLIASTLRQHAGLTKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + + + +  +E   ++      L ++
Sbjct: 121 DEENWYQQVKEDIDAQQTVTEPLSER 146


>gi|268591764|ref|ZP_06125985.1| MraZ protein [Providencia rettgeri DSM 1131]
 gi|291312725|gb|EFE53178.1| MraZ protein [Providencia rettgeri DSM 1131]
          Length = 152

 Score =  140 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 3/141 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYRGMLNEESKGQMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSTMNPAERRVQRLLLGHASECQMDNAGRLLLASTLRQHAGLTKEVMLVGQINKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           + QT+    ++  ++   + L
Sbjct: 121 DEQTW---YQQVEDDIAAERL 138


>gi|290476462|ref|YP_003469367.1| protein mraZ [Xenorhabdus bovienii SS-2004]
 gi|289175800|emb|CBJ82603.1| Protein mraZ [Xenorhabdus bovienii SS-2004]
          Length = 152

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 1/136 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPARYREKLNEESTGQMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  ++   ++  L+ G     +MDS GR+L+ + +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNLAERRVQRLLLGHASECQMDSAGRLLLANTLRQHAGLTKEVMLVGQFNKFELW 120

Query: 123 NPQTF-RKLQEESRNE 137
           + Q + +++Q +   E
Sbjct: 121 DEQAWYQQVQNDIEAE 136


>gi|183599910|ref|ZP_02961403.1| hypothetical protein PROSTU_03431 [Providencia stuartii ATCC 25827]
 gi|188022185|gb|EDU60225.1| hypothetical protein PROSTU_03431 [Providencia stuartii ATCC 25827]
          Length = 152

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 69/143 (48%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L++     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLTVPTRYRGMLSEESKGQMVCTIDLHQPCLLLYTLPEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSTMNPAERRVQRLLLGHASECQMDSSGRLLLASTLRQHAGLTKEVMLVGQINKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+   Q+   +    +  Q+
Sbjct: 121 DEQTW--YQQVEEDIAAERQTQE 141


>gi|261823025|ref|YP_003261131.1| cell division protein MraZ [Pectobacterium wasabiae WPP163]
 gi|261607038|gb|ACX89524.1| MraZ protein [Pectobacterium wasabiae WPP163]
          Length = 152

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREMLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R    ++ EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLIANTLRQHADLKKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|288939886|ref|YP_003442126.1| MraZ protein [Allochromatium vinosum DSM 180]
 gi|288895258|gb|ADC61094.1| MraZ protein [Allochromatium vinosum DSM 180]
          Length = 151

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 2/144 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R  L     T L    D     + +      +  E+K 
Sbjct: 1   MFRGVTIVNLDSKGRLAIPSRYRERLEAMSGTRLVVTVD-RDRCLLLYPESEWDIIERKF 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A  L  L  G    + +D++GRIL+   +R F  ++  V FVG G  F++W
Sbjct: 60  AALPALDPTARALQRLYVGNAQEVDIDAQGRILLPVHLREFASLDKRVAFVGLGVKFEIW 119

Query: 123 NPQTFRKLQEESRNEYC-RQLLQK 145
           +   +    E + N+    +L  +
Sbjct: 120 DESAWCARTEAALNDLAIAELATE 143


>gi|49076224|gb|AAT49537.1| PA4421 [synthetic construct]
          Length = 152

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 59/132 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  RC   L    D   P ++V      E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELVSRCAGQLIVTIDAVDPCLTVYPLPEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RELPSLREETRRLQRLLIGNAVDLELDGNGRFLIPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  + E  
Sbjct: 121 DEDAWNAMAEAD 132


>gi|117618920|ref|YP_858332.1| MraZ protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560327|gb|ABK37275.1| MraZ protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 152

 Score =  139 bits (351), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 61/138 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +DSKGR+++P  +R  L       L C  D   P + +   +  E  E+K+
Sbjct: 1   MLRGAHAISLDSKGRLAIPTKYRDWLRDESEGQLVCTIDIAHPCLLLYPLNEWEEIERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +    +L  L+ G     ++D  GR+L++  +R   G++ ++  VG+ N F+LW
Sbjct: 61  KTLSSMNPLERRLQRLLLGHATECELDGNGRLLLSQPLRSHAGLDKKIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +++   +       
Sbjct: 121 DEARWQQQVNDDIQGLPE 138


>gi|253988585|ref|YP_003039941.1| cell division protein MraZ [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780035|emb|CAQ83196.1| conserved hypothetical protein mraz [Photorhabdus asymbiotica]
          Length = 152

 Score =  139 bits (351), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 68/141 (48%), Gaps = 3/141 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRAMLNEESQGQMVCTIDLHQPCLLLYTLSEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLANTLRQHAGLVKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           + Q +    ++ +++   +  
Sbjct: 121 DEQAW---YQQVKDDIAAEQS 138


>gi|327392715|dbj|BAK10137.1| protein MraZ [Pantoea ananatis AJ13355]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRNLLNEESQGQMVCTIDLHQPCLLLYTLPAWEIIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 61  ASLSSMNPLERRVQRLLLGHASECQMDNAGRLLVANTLRQHANLSKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +   E   +       L ++
Sbjct: 121 DEQTWYQQVREDIDAEQSAQAPLSER 146


>gi|259501654|ref|ZP_05744556.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|315653717|ref|ZP_07906637.1| cell division protein MraZ [Lactobacillus iners ATCC 55195]
 gi|259166939|gb|EEW51434.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|315489079|gb|EFU78721.1| cell division protein MraZ [Lactobacillus iners ATCC 55195]
          Length = 145

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 60/144 (41%), Gaps = 6/144 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+      +DSKGR+ +P  FR  +          F       I        +  E 
Sbjct: 1   MAMFMGEYHHNLDSKGRLIIPAKFRDQIGDE-----IIFTRGMEGCIFGYPQAEWQKIEA 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  +
Sbjct: 56  KLAKLPLTQRSARKFTRLFYSGAMETEFDKQGRVNLTATLKEHADLIKECVIVGVSNRIE 115

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+   ++K  +E+ + Y   + +
Sbjct: 116 IWSEDRWQKFADEADDNY-DDIAE 138


>gi|37527527|ref|NP_930871.1| cell division protein MraZ [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|51316316|sp|Q7N138|MRAZ_PHOLL RecName: Full=Protein MraZ
 gi|36786962|emb|CAE16036.1| Protein MraZ [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATQINLDSKGRLTVPTRYRAMLNEESQGQMVCTIDLHQPCLLLYTLSEWEIIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLANTLRQHAGLVKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q +   Q+   +    Q  Q+
Sbjct: 121 DEQAW--YQQVKDDIAAEQSTQE 141


>gi|326795779|ref|YP_004313599.1| protein mraZ [Marinomonas mediterranea MMB-1]
 gi|326546543|gb|ADZ91763.1| Protein mraZ [Marinomonas mediterranea MMB-1]
          Length = 156

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 65/141 (46%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR+S+P   R  L       +    D     + +   D  E  ++K+ 
Sbjct: 7   FRGIHQISVDAKGRMSLPARLRDELVDEDDNHVVITIDPSSRCLLLYPLDEWEQIQEKLD 66

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
               F  QA +L  L+ G    L++D  GR+L+   +R F  +E +VT +G+G   ++W+
Sbjct: 67  RLPSFQPQARRLQRLLVGHATDLEIDKAGRVLLPAPLRDFAKLEKKVTLLGQGKKIEIWS 126

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            + +   ++E  +E   +  Q
Sbjct: 127 LEEWESQRDEYLSEAALEDFQ 147


>gi|238752423|ref|ZP_04613900.1| hypothetical protein yrohd0001_4840 [Yersinia rohdei ATCC 43380]
 gi|238709356|gb|EEQ01597.1| hypothetical protein yrohd0001_4840 [Yersinia rohdei ATCC 43380]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D     + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRDLLNEESHGQMVCTIDLHQACLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +    ++  L+ G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SKLSSMNPAERRVQRLLLGHASECQMDSAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|52080115|ref|YP_078906.1| cell division protein MraZ [Bacillus licheniformis ATCC 14580]
 gi|52003326|gb|AAU23268.1| conserved protein MraZ [Bacillus licheniformis ATCC 14580]
          Length = 154

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      IDSKGR+ VP  FR  L ++ +             +        +  E+K+
Sbjct: 12  MFMGEYQHTIDSKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMSEWKLIEEKL 66

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  N  +LW
Sbjct: 67  KALPLTKKDARAFTRFFFSGATECELDKQGRINIASPLLNYAKLEKECVVIGVSNRIELW 126

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +  EE  + +  
Sbjct: 127 SKEIWEQYVEEQEDSFAE 144


>gi|15599617|ref|NP_253111.1| cell division protein MraZ [Pseudomonas aeruginosa PAO1]
 gi|116052454|ref|YP_792767.1| cell division protein MraZ [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893512|ref|YP_002442381.1| cell division protein MraZ [Pseudomonas aeruginosa LESB58]
 gi|254238916|ref|ZP_04932239.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244768|ref|ZP_04938090.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296391130|ref|ZP_06880605.1| cell division protein MraZ [Pseudomonas aeruginosa PAb1]
 gi|20139183|sp|Q9HVZ4|MRAZ_PSEAE RecName: Full=Protein MraZ
 gi|122257539|sp|Q02H19|MRAZ_PSEAB RecName: Full=Protein MraZ
 gi|226710001|sp|B7UZJ9|MRAZ_PSEA8 RecName: Full=Protein MraZ
 gi|9950653|gb|AAG07809.1|AE004856_20 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587675|gb|ABJ13690.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170847|gb|EAZ56358.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198146|gb|EAZ62209.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773740|emb|CAW29554.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 151

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 59/132 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  RC   L    D   P ++V      E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELVSRCAGQLIVTIDAVDPCLTVYPLPEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RELPSLREETRRLQRLLIGNAVDLELDGNGRFLIPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  + E  
Sbjct: 121 DEDAWNAMAEAD 132


>gi|225389941|ref|ZP_03759665.1| hypothetical protein CLOSTASPAR_03691 [Clostridium asparagiforme
           DSM 15981]
 gi|225043995|gb|EEG54241.1| hypothetical protein CLOSTASPAR_03691 [Clostridium asparagiforme
           DSM 15981]
          Length = 141

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 57/141 (40%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ VP  FR  L    +             + V  +      E+K+
Sbjct: 1   MFMGEYNHTVDSKGRLIVPSKFREQLGDEFVVTKGL-----DNCLFVYENSEWAKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + S  +  G    ++D +GRIL+   +R F GIE +   VG G+  ++W
Sbjct: 56  RTLPLTNTAARKFSRFLLAGATTCEVDKQGRILLPAILREFAGIEKDSVLVGVGSRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQL 142
           + + +      +   E    +
Sbjct: 116 SKERWLEANTFDDMEEIAEHM 136


>gi|198282534|ref|YP_002218855.1| MraZ protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666931|ref|YP_002424724.1| mraZ protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226709948|sp|B7J3W1|MRAZ_ACIF2 RecName: Full=Protein MraZ
 gi|226709949|sp|B5ELD2|MRAZ_ACIF5 RecName: Full=Protein MraZ
 gi|198247055|gb|ACH82648.1| MraZ protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519144|gb|ACK79730.1| mraZ protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 151

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 4/136 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFF----FPAISVGNSDLLEYF 58
            F       +DSKGR++VP  FR  L   C   L    D         +        E  
Sbjct: 1   MFRGTHRHSLDSKGRMNVPARFRDWLNAHCDGQLVVTIDAQSQKGERCLVAYPLPTWEKV 60

Query: 59  EQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
           E++IAE    +  A Q   L  G    L++D++ RIL++  +R F  ++ E+  VG+ + 
Sbjct: 61  ERRIAELPSNNPAARQFQRLFVGQSEELRLDAQARILLSPNLRKFAELDKELVLVGQIDK 120

Query: 119 FQLWNPQTFRKLQEES 134
           F++W+   +   QE  
Sbjct: 121 FEIWDAARWDACQETW 136


>gi|157373542|ref|YP_001472142.1| cell division protein MraZ [Shewanella sediminis HAW-EB3]
 gi|189028639|sp|A8FQ91|MRAZ_SHESH RecName: Full=Protein MraZ
 gi|157315916|gb|ABV35014.1| MraZ protein [Shewanella sediminis HAW-EB3]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 60/139 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L     + +    DF  P + +   D     E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPKRYREPLHAEFNSQIVITVDFQSPCLLLYPFDEWSKIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  L+ G     ++D  GRIL+   +R +  +E     VG+ N F+LW
Sbjct: 61  LLLSDTRATERAMKRLLLGYAHECELDGNGRILLPPPLRQYANLEKRAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   ++K  E+SR     +
Sbjct: 121 DETAWQKQIEQSRETIQSE 139


>gi|294142813|ref|YP_003558791.1| protein mraZ [Shewanella violacea DSS12]
 gi|20139166|sp|Q9F1N9|MRAZ_SHEVD RecName: Full=Protein MraZ
 gi|11761326|dbj|BAB19193.1| MraZ [Shewanella violacea]
 gi|293329282|dbj|BAJ04013.1| protein mraZ [Shewanella violacea DSS12]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 58/139 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       L    DF    + +   D     E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPKRYREPLRAEYNGQLVITVDFQSSCLLLYPLDEWSKIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  L+ G     ++D  GR+L+   +R +  +E     VG+ N F+LW
Sbjct: 61  LLLSDTRASERAMKRLLLGYAHECELDGNGRLLLPPPLRQYANLEKHAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   +++  E+SR     +
Sbjct: 121 DEAAWQQQIEQSRETIRSE 139


>gi|88858793|ref|ZP_01133434.1| hypothetical protein PTD2_07314 [Pseudoalteromonas tunicata D2]
 gi|88819019|gb|EAR28833.1| hypothetical protein PTD2_07314 [Pseudoalteromonas tunicata D2]
          Length = 152

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 72/148 (48%), Gaps = 7/148 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR+++P  +RT+L   C   + C  D     + +      +  E K+
Sbjct: 1   MFRGAFSISLDDKGRLAIPTKYRTLLQADCEGQMVCTVDLQQACLLLYPLSEWQLIESKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +  +    ++  ++ G  +  ++D  GRIL++  +R   G+  ++  VG+ N F++W
Sbjct: 61  LKLSNMNPHERRVQRVLLGNAMDCQVDKNGRILLSAPLRAHAGLNKKLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQ-----EESRNEYCRQLLQK 145
           +  ++++       +E + ++  +L ++
Sbjct: 121 DEDSWQQQMQADIAQEQQGDF--ELTER 146


>gi|257867493|ref|ZP_05647146.1| MraZ family protein [Enterococcus casseliflavus EC30]
 gi|257873822|ref|ZP_05653475.1| MraZ family protein [Enterococcus casseliflavus EC10]
 gi|257877572|ref|ZP_05657225.1| MraZ family protein [Enterococcus casseliflavus EC20]
 gi|257801549|gb|EEV30479.1| MraZ family protein [Enterococcus casseliflavus EC30]
 gi|257807986|gb|EEV36808.1| MraZ family protein [Enterococcus casseliflavus EC10]
 gi|257811738|gb|EEV40558.1| MraZ family protein [Enterococcus casseliflavus EC20]
          Length = 143

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP   R  L ++ +             +        E  E+K+
Sbjct: 1   MFMGEFQHSIDAKGRLIVPSKLREKLGEKFVVTRGL-----DGCLFGYPLSEWEKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R    +      +G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPVTLRNHADLTKSCVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++   EE+   +  ++ +
Sbjct: 116 DETRWQAFSEEAEENF-DEIAE 136


>gi|52785489|ref|YP_091318.1| cell division protein MraZ [Bacillus licheniformis ATCC 14580]
 gi|319646110|ref|ZP_08000340.1| mraZ protein [Bacillus sp. BT1B_CT2]
 gi|90103479|sp|Q65JY9|MRAZ_BACLD RecName: Full=Protein MraZ
 gi|52347991|gb|AAU40625.1| YllB [Bacillus licheniformis ATCC 14580]
 gi|317391860|gb|EFV72657.1| mraZ protein [Bacillus sp. BT1B_CT2]
          Length = 143

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      IDSKGR+ VP  FR  L ++ +             +        +  E+K+
Sbjct: 1   MFMGEYQHTIDSKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMSEWKLIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGATECELDKQGRINIASPLLNYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +  EE  + +  
Sbjct: 116 SKEIWEQYVEEQEDSFAE 133


>gi|304310310|ref|YP_003809908.1| Protein mraZ [gamma proteobacterium HdN1]
 gi|301796043|emb|CBL44247.1| Protein mraZ [gamma proteobacterium HdN1]
          Length = 152

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 66/135 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR+++P  +R  + +RC   +    D     + +      +  E+KI
Sbjct: 1   MFRGLTSINMDPKGRMALPTRYRDAVVERCSGGMIATIDTEEKCLLLYPLPDWQEIERKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  A ++  L+ G    +++DS GRI++   +R + G++  +  VG+G  F++W
Sbjct: 61  EALPSFNKAARRVQRLLIGHASEVELDSAGRIMIPQVLREYAGLDKRILLVGQGKKFEIW 120

Query: 123 NPQTFRKLQEESRNE 137
           +   +   ++E  +E
Sbjct: 121 SEDAWNAKRDEWLDE 135


>gi|291616263|ref|YP_003519005.1| MraZ [Pantoea ananatis LMG 20103]
 gi|291151293|gb|ADD75877.1| MraZ [Pantoea ananatis LMG 20103]
          Length = 158

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  E+K+
Sbjct: 7   MFRGATLVNLDSKGRLAVPTRYRNLLNEESQGQMVCTIDLHQPCLLLYTLPAWEIIEKKL 66

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 67  ASLSSMNPLERRVQRLLLGHASECQMDNAGRLLVANTLRQHANLSKEVMLVGQFNKFELW 126

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +   E   +       L ++
Sbjct: 127 DEQTWYQQVREDIDAEQSAQAPLSER 152


>gi|145637121|ref|ZP_01792784.1| hypothetical protein CGSHiHH_02638 [Haemophilus influenzae PittHH]
 gi|145269775|gb|EDK09715.1| hypothetical protein CGSHiHH_02638 [Haemophilus influenzae PittHH]
          Length = 151

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 62/134 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D   P + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGQMVCTVDIRQPCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|90020486|ref|YP_526313.1| cell division protein MraZ [Saccharophagus degradans 2-40]
 gi|122996465|sp|Q21MH8|MRAZ_SACD2 RecName: Full=Protein MraZ
 gi|89950086|gb|ABD80101.1| MraZ family protein [Saccharophagus degradans 2-40]
          Length = 147

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D+KGR+++P  +R  LA  C   +          + V           KI
Sbjct: 1   MFQGSHAITMDAKGRMAIPAKYRDTLADACEGRIVVTAHTQDRCLLVYPETEWAEILPKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  A +   L+ G    L++D  GR+L+   +R +   + ++  VG G  F+LW
Sbjct: 61  EALPSFNKAALRAQRLLIGYATTLELDGNGRVLLPPTLRDYANFDKKLMLVGLGKKFELW 120

Query: 123 NPQTFRKLQEESR--NEYCRQLL 143
           + + +     +    +E  +++L
Sbjct: 121 SEEAWFASIADVDDGDELPQEML 143


>gi|332686266|ref|YP_004456040.1| cell division protein MraZ [Melissococcus plutonius ATCC 35311]
 gi|332370275|dbj|BAK21231.1| cell division protein MraZ [Melissococcus plutonius ATCC 35311]
          Length = 143

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L  + +             +     +     E+K+
Sbjct: 1   MFMGEFQHNIDVKGRLIVPSKFRERLGGQFVVTRGM-----DGCLFGYPQNEWILLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R +  ++ E   VG  N  ++W
Sbjct: 56  QEMPLSKKDARTFIRFFYSAATECEIDKQGRINIPANLREYAYLKKECVIVGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N + +++   E+   +  +L +
Sbjct: 116 NQERWQEFSTEAAANF-DELAE 136


>gi|308185650|ref|YP_003929781.1| Protein mraZ [Pantoea vagans C9-1]
 gi|308056160|gb|ADO08332.1| Protein mraZ [Pantoea vagans C9-1]
          Length = 152

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRDLLIGESQGQMVCTIDLHQPCLLLYTLPEWEIIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 61  ARLSSMNPLERRVQRLLLGHASECQMDNAGRLLLANTLRQHAKLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +      ++       L ++
Sbjct: 121 DEQTWYQQVRDDIDAEQSAQEPLSER 146


>gi|303228402|ref|ZP_07315235.1| protein MraZ [Veillonella atypica ACS-134-V-Col7a]
 gi|303230824|ref|ZP_07317571.1| protein MraZ [Veillonella atypica ACS-049-V-Sch6]
 gi|302514584|gb|EFL56579.1| protein MraZ [Veillonella atypica ACS-049-V-Sch6]
 gi|302516904|gb|EFL58813.1| protein MraZ [Veillonella atypica ACS-134-V-Col7a]
          Length = 143

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 54/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P   R  L   C+             I++  ++  E   + +
Sbjct: 1   MFMGEYNHTIDAKGRLIIPAKIREQLGDHCVLSKGL-----DNCIAIYTAESWEQLSKTL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A  +     G    L+ D +GRIL+   +R    ++ +   +G G+  ++W
Sbjct: 56  QSLPSNKANARAIKRFYFGSAAELEFDKQGRILVPSALREHAELQKDAVIIGTGDKVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + F     E  +     L +
Sbjct: 116 SRERFDAYDAEVADSV-ESLAE 136


>gi|77166321|ref|YP_344846.1| hypothetical protein Noc_2870 [Nitrosococcus oceani ATCC 19707]
 gi|254435490|ref|ZP_05048997.1| mraZ protein [Nitrosococcus oceani AFC27]
 gi|91207202|sp|Q3J780|MRAZ_NITOC RecName: Full=Protein MraZ
 gi|76884635|gb|ABA59316.1| Protein of unknown function UPF0040 [Nitrosococcus oceani ATCC
           19707]
 gi|207088601|gb|EDZ65873.1| mraZ protein [Nitrosococcus oceani AFC27]
          Length = 149

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 63/143 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D+KGR+S+P  +R  L   C   +    D   P + +      E  E+K+
Sbjct: 1   MFRGITTLNLDAKGRLSIPAKYRKSLGICCDGKVIITVDLLEPCLQLYPLPEWEIVERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + QA  +   + G     ++D  GRIL+   +R  T +   ++ VG+GN F+LW
Sbjct: 61  VALPSHNRQARYIKRRLIGHAEECELDGHGRILLPLELRSRTELGKNISLVGQGNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +   +       +L ++
Sbjct: 121 DSMVWERQMAKEEASAKEELTRE 143


>gi|145627904|ref|ZP_01783705.1| hypothetical protein CGSHi22121_02665 [Haemophilus influenzae
           22.1-21]
 gi|145639351|ref|ZP_01794957.1| hypothetical protein CGSHiII_01334 [Haemophilus influenzae PittII]
 gi|144979679|gb|EDJ89338.1| hypothetical protein CGSHi22121_02665 [Haemophilus influenzae
           22.1-21]
 gi|145271654|gb|EDK11565.1| hypothetical protein CGSHiII_01334 [Haemophilus influenzae PittII]
 gi|309751225|gb|ADO81209.1| MraZ protein [Haemophilus influenzae R2866]
          Length = 151

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 62/134 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D   P + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGQMVCTVDIRQPCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|301169869|emb|CBW29473.1| conserved protein [Haemophilus influenzae 10810]
 gi|309973404|gb|ADO96605.1| MraZ protein [Haemophilus influenzae R2846]
          Length = 151

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 62/134 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D   P + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGKMVCTVDIRQPCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|238754427|ref|ZP_04615782.1| hypothetical protein yruck0001_23600 [Yersinia ruckeri ATCC 29473]
 gi|238707256|gb|EEP99618.1| hypothetical protein yruck0001_23600 [Yersinia ruckeri ATCC 29473]
          Length = 167

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 3/147 (2%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK
Sbjct: 15  TMFRGATVVNLDSKGRLAVPTRYRDLLNEEMQGQMVCTIDLHQPCLLLYPLPEWEIIEQK 74

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           ++  +       ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+L
Sbjct: 75  LSRLSSMISAERRIQRLLLGHASECQMDGSGRLLIAATLRQHAGLSKEVMLVGQLNKFEL 134

Query: 122 WNPQTFRKLQE---ESRNEYCRQLLQK 145
           W+ QT+ +  +   +++      L ++
Sbjct: 135 WDEQTWYQQVKDDIDAQQSTQEPLSER 161


>gi|317046888|ref|YP_004114536.1| MraZ protein [Pantoea sp. At-9b]
 gi|316948505|gb|ADU67980.1| MraZ protein [Pantoea sp. At-9b]
          Length = 152

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRELLIGESQGQMVCTIDLHQPCLLLYTLPEWEIIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRLLLANTLRQHANLAKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSAQEPLSER 146


>gi|293392869|ref|ZP_06637187.1| cell division protein MraZ [Serratia odorifera DSM 4582]
 gi|291424728|gb|EFE97939.1| cell division protein MraZ [Serratia odorifera DSM 4582]
          Length = 152

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRETLIEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GR+L+   +R    +  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRLLIASTLRQHAALTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSSQEPLSER 146


>gi|29375570|ref|NP_814724.1| cell division protein MraZ [Enterococcus faecalis V583]
 gi|255971442|ref|ZP_05422028.1| cell division protein mraZ [Enterococcus faecalis T1]
 gi|255974057|ref|ZP_05424643.1| cell division protein MraZ [Enterococcus faecalis T2]
 gi|256617912|ref|ZP_05474758.1| yllB [Enterococcus faecalis ATCC 4200]
 gi|256761746|ref|ZP_05502326.1| cell division protein mraZ [Enterococcus faecalis T3]
 gi|256852641|ref|ZP_05558012.1| MraZ [Enterococcus faecalis T8]
 gi|256957081|ref|ZP_05561252.1| yllB [Enterococcus faecalis DS5]
 gi|256960172|ref|ZP_05564343.1| cell division protein mraZ [Enterococcus faecalis Merz96]
 gi|256962586|ref|ZP_05566757.1| cell division protein mraZ [Enterococcus faecalis HIP11704]
 gi|257077877|ref|ZP_05572238.1| mraZ [Enterococcus faecalis JH1]
 gi|257081241|ref|ZP_05575602.1| cell division protein MraZ [Enterococcus faecalis E1Sol]
 gi|257083899|ref|ZP_05578260.1| cell division protein mraZ [Enterococcus faecalis Fly1]
 gi|257086347|ref|ZP_05580708.1| MraZ protein [Enterococcus faecalis D6]
 gi|257089397|ref|ZP_05583758.1| cell division protein mraZ [Enterococcus faecalis CH188]
 gi|257415607|ref|ZP_05592601.1| cell division protein mraZ [Enterococcus faecalis AR01/DG]
 gi|257418578|ref|ZP_05595572.1| cell division protein mraZ [Enterococcus faecalis T11]
 gi|257421237|ref|ZP_05598227.1| cell division protein mraZ [Enterococcus faecalis X98]
 gi|30179791|sp|O07103|MRAZ_ENTFA RecName: Full=Protein MraZ
 gi|29343031|gb|AAO80794.1| conserved hypothetical protein TIGR00242 [Enterococcus faecalis
           V583]
 gi|255962460|gb|EET94936.1| cell division protein mraZ [Enterococcus faecalis T1]
 gi|255966929|gb|EET97551.1| cell division protein MraZ [Enterococcus faecalis T2]
 gi|256597439|gb|EEU16615.1| yllB [Enterococcus faecalis ATCC 4200]
 gi|256682997|gb|EEU22692.1| cell division protein mraZ [Enterococcus faecalis T3]
 gi|256711986|gb|EEU27023.1| MraZ [Enterococcus faecalis T8]
 gi|256947577|gb|EEU64209.1| yllB [Enterococcus faecalis DS5]
 gi|256950668|gb|EEU67300.1| cell division protein mraZ [Enterococcus faecalis Merz96]
 gi|256953082|gb|EEU69714.1| cell division protein mraZ [Enterococcus faecalis HIP11704]
 gi|256985907|gb|EEU73209.1| mraZ [Enterococcus faecalis JH1]
 gi|256989271|gb|EEU76573.1| cell division protein MraZ [Enterococcus faecalis E1Sol]
 gi|256991929|gb|EEU79231.1| cell division protein mraZ [Enterococcus faecalis Fly1]
 gi|256994377|gb|EEU81679.1| MraZ protein [Enterococcus faecalis D6]
 gi|256998209|gb|EEU84729.1| cell division protein mraZ [Enterococcus faecalis CH188]
 gi|257157435|gb|EEU87395.1| cell division protein mraZ [Enterococcus faecalis ARO1/DG]
 gi|257160406|gb|EEU90366.1| cell division protein mraZ [Enterococcus faecalis T11]
 gi|257163061|gb|EEU93021.1| cell division protein mraZ [Enterococcus faecalis X98]
 gi|295113834|emb|CBL32471.1| mraZ protein [Enterococcus sp. 7L76]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP  FR  L ++ +             +     +     E K+
Sbjct: 1   MLMGEYQHNIDAKGRLIVPSKFREELGEKFVVTRGM-----DGCLFGYPLNEWSQLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R    +E     +G  N  ++W
Sbjct: 56  QEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPANLRTHASLEKGCVVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    +E+   +  +L +
Sbjct: 116 SDERWHAFSDEAEENF-DELAE 136


>gi|304396554|ref|ZP_07378435.1| MraZ protein [Pantoea sp. aB]
 gi|304356063|gb|EFM20429.1| MraZ protein [Pantoea sp. aB]
          Length = 152

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRELLIGESQGQMVCTIDLHQPCLLLYTLPEWEIIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MD+ GR+L+ + +R    +  EV  VG+ N F+LW
Sbjct: 61  ARLSSMNPLERRVQRLLLGHASECQMDNAGRLLLANTLRQHAKLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +      ++       L ++
Sbjct: 121 DEQTWYQQVRDDIDAEQSAQEPLSER 146


>gi|218133492|ref|ZP_03462296.1| hypothetical protein BACPEC_01359 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990867|gb|EEC56873.1| hypothetical protein BACPEC_01359 [Bacteroides pectinophilus ATCC
           43243]
          Length = 146

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 59/138 (42%), Gaps = 4/138 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L           + F    +   ++   + FE+KI
Sbjct: 1   MFMGEYNHTIDAKGRLIVPAKFREALGDE----FVVTRGFDKECLIAYDNTEWQKFEEKI 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +  A  L     GG    ++D +GRIL+   +R   G+  +V FVG  ++ ++W
Sbjct: 57  NELPNTNADARLLRRYFLGGAASCEVDKQGRILLPASLRELAGLTKDVVFVGMASHIEIW 116

Query: 123 NPQTFRKLQEESRNEYCR 140
           +  T+         +  R
Sbjct: 117 DRATYDDKMNLDDIDISR 134


>gi|317121699|ref|YP_004101702.1| MraZ protein [Thermaerobacter marianensis DSM 12885]
 gi|315591679|gb|ADU50975.1| MraZ protein [Thermaerobacter marianensis DSM 12885]
          Length = 180

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D KGR+ VP   R  L +     L   +      + V         E K+
Sbjct: 38  MLIGEYRHTVDDKGRLFVPAKLRDELGEP----LVITRGL-DQCLFVFPPGEWSSLEAKL 92

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A     ++  G      D +GRIL+   +R + GI+ E   +G GN  ++W
Sbjct: 93  RALPLAQSSARAFVRMLLSGASECVPDKQGRILLPQTLREYAGIDREAVLIGVGNRVEIW 152

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
             + + +  EE+ +E   Q+ ++
Sbjct: 153 AAERWTRYVEEA-SEAYSQIAEQ 174


>gi|149181746|ref|ZP_01860238.1| hypothetical protein BSG1_18325 [Bacillus sp. SG-1]
 gi|148850594|gb|EDL64752.1| hypothetical protein BSG1_18325 [Bacillus sp. SG-1]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 51/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L    +             +     +     E+K+
Sbjct: 1   MFMGEYQHNIDNKGRLIVPSKFREHLGDAFVLTRGL-----DQCLFGYPLEEWRALEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D  GRI +   +  +  +E E   +G  N  ++W
Sbjct: 56  KSLPLTKKDARAFTRFFFSGATECELDKTGRINIPSTLTDYARLEKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     +S + +  +L +
Sbjct: 116 SKALWEDYFSQSEDSFA-ELAE 136


>gi|145630228|ref|ZP_01786010.1| hypothetical protein CGSHi22421_09253 [Haemophilus influenzae
           R3021]
 gi|145633141|ref|ZP_01788873.1| hypothetical protein CGSHi3655_06249 [Haemophilus influenzae 3655]
 gi|260581822|ref|ZP_05849618.1| mraZ protein [Haemophilus influenzae NT127]
 gi|144984509|gb|EDJ91932.1| hypothetical protein CGSHi22421_09253 [Haemophilus influenzae
           R3021]
 gi|144986367|gb|EDJ92946.1| hypothetical protein CGSHi3655_06249 [Haemophilus influenzae 3655]
 gi|260095015|gb|EEW78907.1| mraZ protein [Haemophilus influenzae NT127]
          Length = 151

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 62/134 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D   P + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGKMVCTVDIRQPCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|15615139|ref|NP_243442.1| cell division protein MraZ [Bacillus halodurans C-125]
 gi|20139209|sp|Q9K9R9|MRAZ_BACHD RecName: Full=Protein MraZ
 gi|10175197|dbj|BAB06295.1| BH2576 [Bacillus halodurans C-125]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 51/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR  L +         +      + V      +  E+ +
Sbjct: 1   MFMGEYRHNVDEKGRMIIPAKFREELGE----TFVVTRGL-DRCLFVYPQVEWKKLEESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +R F  ++ E   +G  N  ++W
Sbjct: 56  KNLPFTKKDARAFTRFFFSGATECELDKQGRVNIASPLREFAQLKKECVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +   ES   +  
Sbjct: 116 SKELWEEYFAESEESFSE 133


>gi|144897764|emb|CAM74628.1| Protein mraZ [Magnetospirillum gryphiswaldense MSR-1]
          Length = 159

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 44/140 (31%), Positives = 69/140 (49%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  FLS +  K+D KGRVSVP  FRT L+Q+    +  ++ F    I     D +E    
Sbjct: 1   MGLFLSTIVNKVDRKGRVSVPASFRTTLSQQIFQGIIAYRSFTASCIEGCGMDFMERLSD 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
               ++ FS +   +S L+      L  D EGRIL+ + +    G+     FVG+G  FQ
Sbjct: 61  STQTFDAFSPEQEDISALIFADARQLAWDPEGRILLPEDLIEHAGLSETAAFVGKGQTFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P+ ++ ++ E R    +
Sbjct: 121 IWQPEAYKAMEAEIRARALK 140


>gi|330811588|ref|YP_004356050.1| cell division protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379696|gb|AEA71046.1| Putative cell division protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 151

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 56/132 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELVSRSSGQLIVTIDAVDPCLCVYPLDEWEIIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWNAVSAAD 132


>gi|292898410|ref|YP_003537779.1| hypothetical protein EAM_0689 [Erwinia amylovora ATCC 49946]
 gi|291198258|emb|CBJ45364.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
          Length = 152

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDGKGRLAVPTRYRDMLIEGSQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R    +  EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRILLASTLRQHASLSKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +  +E   +     + L ++
Sbjct: 121 DEQTWYQQVKEDIDAEQSSQQPLSER 146


>gi|194014392|ref|ZP_03053009.1| MraZ protein [Bacillus pumilus ATCC 7061]
 gi|194013418|gb|EDW22983.1| MraZ protein [Bacillus pumilus ATCC 7061]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L ++ +             +        +  E+K+
Sbjct: 1   MFMGEYQHTIDTKGRMIIPAKFRDGLGEQFVLTRGL-----DQCLFGYPMSEWKLIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G +   +D +GRI +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGAVECDLDKQGRINIASNLLQYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 116 SKSIWEQYTEEQEDSFAE 133


>gi|182677676|ref|YP_001831822.1| hypothetical protein Bind_0683 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|226709953|sp|B2IGF1|MRAZ_BEII9 RecName: Full=Protein MraZ
 gi|182633559|gb|ACB94333.1| protein of unknown function UPF0040 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 164

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 3/148 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RF+S+ T ++D+KGRVS+P  FR +LA+     LY        AI  G   LL   ++
Sbjct: 1   MDRFVSHFTNRLDAKGRVSIPASFRAVLARDGFEGLYVHPSIDAEAIDCGGHGLLREIDE 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            +   +P+S + +  S  + G    LK+DSEGR+++T+ ++ + GI +EVTFVG+G  FQ
Sbjct: 61  LLGRLSPYSEERDMFSTALLGTSEILKVDSEGRVVLTENVKTYAGIGSEVTFVGQGYKFQ 120

Query: 121 LWNPQTFRKLQEESRN---EYCRQLLQK 145
           +W P  FR   EE+RN   +  +QL  +
Sbjct: 121 IWEPGRFRTHLEEARNRVRDLRKQLSSR 148


>gi|188585921|ref|YP_001917466.1| MraZ protein [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226709995|sp|B2A2G3|MRAZ_NATTJ RecName: Full=Protein MraZ
 gi|179350608|gb|ACB84878.1| MraZ protein [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGRV VP  FR  L    +             I V   +  +  E+KI
Sbjct: 1   MFMGEFRHSLDSKGRVIVPAKFRKGLGDNFVATRGL-----DNCIFVYPMNEWKVLEEKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A   S     G    ++D +GRI +   +R +  ++ +V  +G  N  ++W
Sbjct: 56  RQLPLTKSDARAFSRFFLSGASECELDKQGRISLPSNLRDYAALQKDVVIIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +   Q+++ + +   + ++
Sbjct: 116 SQEKWDNYQQQAESSF-ENIAEE 137


>gi|50122746|ref|YP_051913.1| cell division protein MraZ [Pectobacterium atrosepticum SCRI1043]
 gi|90103484|sp|Q6D0H4|MRAZ_ERWCT RecName: Full=Protein MraZ
 gi|49613272|emb|CAG76723.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 152

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREMLYGESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R    ++ EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLIANTLRQHADLKKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|238918669|ref|YP_002932183.1| cell division protein MraZ [Edwardsiella ictaluri 93-146]
 gi|259509654|sp|C5B9E7|MRAZ_EDWI9 RecName: Full=Protein MraZ
 gi|238868237|gb|ACR67948.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 152

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 6/148 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATNINLDSKGRLAVPIRYRDLLIEEAQGHMVCTIDLHHPCLLLYPLSQWEVIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+T  +R   G+  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDGAGRLLITATLRQHAGLHKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQ------EESRNEYCRQLLQ 144
           + +T+ +        E+S  E   + LQ
Sbjct: 121 DEETWYQQVREDIEAEQSATEIPSERLQ 148


>gi|77460903|ref|YP_350410.1| cell division protein MraZ [Pseudomonas fluorescens Pf0-1]
 gi|91207209|sp|Q3K735|MRAZ_PSEPF RecName: Full=Protein MraZ
 gi|77384906|gb|ABA76419.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 151

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 56/132 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELDSRSSGQLIVTIDAVDPCLCVYPLDEWEIIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWNAVSAAD 132


>gi|260912994|ref|ZP_05919479.1| cell division protein MraZ [Pasteurella dagmatis ATCC 43325]
 gi|260632984|gb|EEX51150.1| cell division protein MraZ [Pasteurella dagmatis ATCC 43325]
          Length = 152

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 57/132 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R+ + +     + C  D   P + +      E  EQKI
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRSEILEESQGLMVCTVDLQQPCLVLYTLIEWENIEQKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                       L  +V G     ++D  GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  KALPNLDPNTRALQRVVIGHATECELDRAGRILISPTLRQRVNLEKNLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEES 134
           N   + +  E  
Sbjct: 121 NESVWNRQIEAD 132


>gi|113460495|ref|YP_718559.1| cell division protein MraZ [Haemophilus somnus 129PT]
 gi|122945146|sp|Q0I1E2|MRAZ_HAES1 RecName: Full=Protein MraZ
 gi|112822538|gb|ABI24627.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 152

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 64/133 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R  + +     + C  D     + +   +  E  EQK+
Sbjct: 1   MFRGASAVNLDSKGRIAIPTRYRPEILEINQGQMVCTVDIRQSCLLLYPLNQWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ + F+ +   L  ++ G     ++DS GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  SKLSNFNPEERSLQRVMLGYATECELDSAGRILISAPLRQHAKLEKSIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   ++   E+  
Sbjct: 121 SESEWQAQIEKDM 133


>gi|154252854|ref|YP_001413678.1| hypothetical protein Plav_2412 [Parvibaculum lavamentivorans DS-1]
 gi|205445844|sp|A7HVT8|MRAZ_PARL1 RecName: Full=Protein MraZ
 gi|154156804|gb|ABS64021.1| protein of unknown function UPF0040 [Parvibaculum lavamentivorans
           DS-1]
          Length = 161

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 1/138 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFF-PAISVGNSDLLEYFE 59
           M+ F    T KIDSKGRVSVP  FR +   + +  + CF        I        E  +
Sbjct: 1   MNSFRGRYTNKIDSKGRVSVPAKFRAVSIAQGLNGIICFPPLSEGKFIEGCGPAFSEEID 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           + +   +PFS + + L+ ++ G    L  D++GR+ + D +R   G+ +EV FVG G  F
Sbjct: 61  RMLDRLDPFSEERDMLASVLLGESAELMFDADGRVNLPDNLRELAGLTDEVVFVGAGPRF 120

Query: 120 QLWNPQTFRKLQEESRNE 137
           Q+W P  +     E++  
Sbjct: 121 QIWEPGAYAAFAVEAQKR 138


>gi|70732393|ref|YP_262149.1| cell division protein MraZ [Pseudomonas fluorescens Pf-5]
 gi|91207207|sp|Q4K6I4|MRAZ_PSEF5 RecName: Full=Protein MraZ
 gi|68346692|gb|AAY94298.1| mraZ protein [Pseudomonas fluorescens Pf-5]
          Length = 151

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 56/132 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELVSRSSGQLIVTIDAVDPCLCVYPLDEWELIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWNAVSAAD 132


>gi|227364722|ref|ZP_03848771.1| cell division protein MraZ [Lactobacillus reuteri MM2-3]
 gi|227070181|gb|EEI08555.1| cell division protein MraZ [Lactobacillus reuteri MM2-3]
          Length = 140

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 54/140 (38%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +   T  IDSKGR+ +P  FR  L    I             +     +     EQK+  
Sbjct: 1   MGEFTHTIDSKGRLIIPAKFREQLGAHFIVTRGL-----DGCLFGYPLNEWAILEQKLKA 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A      ++      ++D +GRI +   +R    +E +   VG  N  ++W+ 
Sbjct: 56  LPLTKRDARAFVRFLYSAATDCEIDKQGRINIPITLRTHASLEKKCVIVGVSNRLEIWSA 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
           + + K   E+ + +  ++ +
Sbjct: 116 ERWNKFTSETADNF-DEIAE 134


>gi|227113995|ref|ZP_03827651.1| cell division protein MraZ [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227327099|ref|ZP_03831123.1| cell division protein MraZ [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 152

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREMLNGESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R    ++ EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLIANTLRQHADLKKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +      ++       L ++
Sbjct: 121 DEQTWYQQVRDDIDAEQSTQEPLSER 146


>gi|251797884|ref|YP_003012615.1| cell division protein MraZ [Paenibacillus sp. JDR-2]
 gi|247545510|gb|ACT02529.1| MraZ protein [Paenibacillus sp. JDR-2]
          Length = 145

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L       ++         + V         EQK+
Sbjct: 1   MFMGEYQHTIDEKGRIIIPSKFRESLG-----TIFIATRGLDNCLFVYPMSEWSVLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +R +  ++ +   +G     ++W
Sbjct: 56  KSLPLMKSDARAFTRFFFSGATECELDKQGRVNIPAHLREYAKLDKDCMVLGVSGRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +  T+     +S   +  ++ +K
Sbjct: 116 SKSTWEGYYAQSEQAF-NEIAEK 137


>gi|332982168|ref|YP_004463609.1| MraZ protein [Mahella australiensis 50-1 BON]
 gi|332699846|gb|AEE96787.1| MraZ protein [Mahella australiensis 50-1 BON]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L  + +             + V + D     EQ++
Sbjct: 1   MFMGEYRHTIDQKGRLIIPSKFRDDLGDKFVATKGL-----DRCLFVYSPDEWSNLEQRL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G    ++D +GRIL+   +R +  +  +V  VG     ++W
Sbjct: 56  KALPLTNKDARAFVRFFFAGATECEIDKQGRILLPANLREYASLVKDVVLVGVLTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +  E++  ++   + ++
Sbjct: 116 SKDIWDEYNEQANLDH-ESIAER 137


>gi|158320403|ref|YP_001512910.1| MraZ protein [Alkaliphilus oremlandii OhILAs]
 gi|167011855|sp|A8MH27|MRAZ_ALKOO RecName: Full=Protein MraZ
 gi|158140602|gb|ABW18914.1| MraZ protein [Alkaliphilus oremlandii OhILAs]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 59/145 (40%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGRVS+P  FR  L +  I             + + +SD     E K+
Sbjct: 1   MFIGEYNHAVDTKGRVSIPAKFREELGEHFILTKGL-----DNCLFIYSSDEWGILENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G    ++DS+GRI +   +R    +E E   +G G   ++W
Sbjct: 56  KQLPMTNKDARAFVRFFFSGASECELDSQGRIRIPANLREHALLEKEAIIIGVGTRVEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   + K   +   S +E   ++ +
Sbjct: 116 SNVEWEKYNSDDNLSYDEIANKMAE 140


>gi|71279607|ref|YP_271122.1| cell division protein MraZ [Colwellia psychrerythraea 34H]
 gi|91207189|sp|Q47VQ0|MRAZ_COLP3 RecName: Full=Protein MraZ
 gi|71145347|gb|AAZ25820.1| mraZ protein [Colwellia psychrerythraea 34H]
          Length = 152

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 61/146 (41%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSK R+++P  +R  L   C   + C  D   P + +      E  E K+
Sbjct: 1   MFRGTSAITLDSKNRITIPTKYREELFADCQGKMVCTVDIQHPCLLLYPLPEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  + Q   L  ++ G     +MD  GR+L+   +R    +E  V  VG+   F++W
Sbjct: 61  CNLSSMNPQERLLQQVILGNASDCEMDKNGRLLINGPLRQHASLEKNVMLVGQLKKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCR---QLLQK 145
           +   ++    +  ++      +L ++
Sbjct: 121 HDTAWQSQMLQGISKIQSGEIELTER 146


>gi|292489366|ref|YP_003532253.1| protein MraZ [Erwinia amylovora CFBP1430]
 gi|291554800|emb|CBA22631.1| Protein mraZ [Erwinia amylovora CFBP1430]
 gi|312173531|emb|CBX81785.1| Protein mraZ [Erwinia amylovora ATCC BAA-2158]
          Length = 157

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 6   MFRGATLVNLDGKGRLAVPTRYRDMLIEGSQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 65

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R    +  EV  VG+ N F+LW
Sbjct: 66  SRLSSMNPAERRVQRLLLGHASECQMDNAGRILLASTLRQHASLSKEVMLVGQFNKFELW 125

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +  +E   +     + L ++
Sbjct: 126 DEQTWYQQVKEDIDAEQSSQQPLSER 151


>gi|323489492|ref|ZP_08094719.1| protein mraZ [Planococcus donghaensis MPA1U2]
 gi|323396623|gb|EGA89442.1| protein mraZ [Planococcus donghaensis MPA1U2]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHSVDAKGRLIIPAKFRELLGDHFVITRGL-----DQCLFGYTMEEWQKIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A   +     G   +++D +GR+ +   +  +  +E E   +G  N F++W
Sbjct: 56  KELPVTKKDARAFTRFFFSGASEVELDKQGRVNIPTTLISYAKLEKECIILGVSNRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
              ++      S + +  
Sbjct: 116 AKDSWESYFAASEDSFSE 133


>gi|313893668|ref|ZP_07827236.1| protein MraZ [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441812|gb|EFR60236.1| protein MraZ [Veillonella sp. oral taxon 158 str. F0412]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P   R  L   CI             +++   +  +     +
Sbjct: 1   MFMGEYNHTIDTKGRMIIPAKIREQLGDLCIVTKGL-----DDCLAIYTQEAWKKISDAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        L   V G    L+ D +GR+L+   +R +  ++ +   VG G++ ++W
Sbjct: 56  QSQSSTKASVRALKRFVFGSAAELEYDKQGRVLIPVPLREYASLDKQAVIVGAGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    ++   E   +L++
Sbjct: 116 SREKYD-YYDDQVAESMEELVE 136


>gi|260584185|ref|ZP_05851933.1| MraZ protein [Granulicatella elegans ATCC 700633]
 gi|260158811|gb|EEW93879.1| MraZ protein [Granulicatella elegans ATCC 700633]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP  FR  L           +      +     D  +   QK+
Sbjct: 1   MLIGEYQHTIDAKGRMIVPAKFREDLG----FTFVVTRGL-DGCLYGYPLDQWQLLRQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +E       A   +   +     ++ D +GRI +T  +R   G+      +G  +  ++W
Sbjct: 56  SELPQSKKDARAFARFFNSAASEVEFDKQGRINITPTLREHAGLVKNCRVIGVNDRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + ++    E+   +  +L ++
Sbjct: 116 DEERWKAYIAETEENF-EELAEQ 137


>gi|146305948|ref|YP_001186413.1| cell division protein MraZ [Pseudomonas mendocina ymp]
 gi|167012262|sp|A4XQR5|MRAZ_PSEMY RecName: Full=Protein MraZ
 gi|145574149|gb|ABP83681.1| MraZ protein [Pseudomonas mendocina ymp]
          Length = 151

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 60/132 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  RC   L    D   P + V      E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELVARCNGQLIVTIDAVDPCLCVYPLAEWELIENKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E   F  +  +L  L+ G  + L++D+ GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RELASFREENRRLQRLLIGNAVDLELDASGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  + E  
Sbjct: 121 DEDAWNAVAEAD 132


>gi|315639625|ref|ZP_07894765.1| MarZ family protein [Enterococcus italicus DSM 15952]
 gi|315484586|gb|EFU75042.1| MarZ family protein [Enterococcus italicus DSM 15952]
          Length = 143

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP   R  L ++ I             +           E K+
Sbjct: 1   MLMGEFQHSIDAKGRLIVPAKLREQLGEKFIVTRGL-----DGCLFGYPLSEWNQLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +E       A       +      ++D +GRI +   +R    +      +G  N  ++W
Sbjct: 56  SEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPTTLREHAKLTKACVIIGVANRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    EE+   +  ++ +
Sbjct: 116 DEEKWHAFSEEAEENF-DEIAE 136


>gi|217979580|ref|YP_002363727.1| protein of unknown function UPF0040 [Methylocella silvestris BL2]
 gi|254813285|sp|B8ETL3|MRAZ_METSB RecName: Full=Protein MraZ
 gi|217504956|gb|ACK52365.1| protein of unknown function UPF0040 [Methylocella silvestris BL2]
          Length = 164

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 79/144 (54%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  ++S+ T K+D+KGRVS+P  FR +L +     LY        A+  G   LL   + 
Sbjct: 1   MDGYVSHYTNKLDAKGRVSIPAPFRAVLVRDGFDGLYVHPSIDQEALDCGGHALLREIDG 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            ++  +P+S + +  S  + G    LK+DSEGR ++T+ ++ + GI  EVTFVG G+ FQ
Sbjct: 61  LLSGLSPYSEERDLFSTALIGTSEILKVDSEGRTILTETLKSYAGITGEVTFVGHGHKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W P  FR   EE+RN       Q
Sbjct: 121 IWEPGRFRAHLEEARNRVRDLRRQ 144


>gi|259047020|ref|ZP_05737421.1| cell division protein MraZ [Granulicatella adiacens ATCC 49175]
 gi|259036339|gb|EEW37594.1| cell division protein MraZ [Granulicatella adiacens ATCC 49175]
          Length = 161

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP  FR  L           +      +     +  E  + K+
Sbjct: 19  MLIGEYQHTIDAKGRMIVPAKFREDLG----FTFIVTRGL-DGCLYGYPLEQWELIQNKL 73

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A   +  ++   I ++ D +GR+ ++  +R + G+E     +G  +  ++W
Sbjct: 74  RDLPQSKKDARAFTRFMNSAAIEVEFDKQGRVNISQTLRAYAGLEKNCRVIGNNDRIEIW 133

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N + +++   E+   +  +L +
Sbjct: 134 NEERWQEYIAETEENF-EELAE 154


>gi|16078577|ref|NP_389396.1| cell division protein MraZ [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221309384|ref|ZP_03591231.1| cell division protein MraZ [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221313711|ref|ZP_03595516.1| cell division protein MraZ [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221318633|ref|ZP_03599927.1| cell division protein MraZ [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221322907|ref|ZP_03604201.1| cell division protein MraZ [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|296331088|ref|ZP_06873562.1| cell division protein MraZ [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674243|ref|YP_003865915.1| putative protein involved in cell division or replication [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|321315276|ref|YP_004207563.1| cell division protein MraZ [Bacillus subtilis BSn5]
 gi|1730596|sp|P55343|MRAZ_BACSU RecName: Full=Protein MraZ
 gi|1122759|emb|CAA92524.1| unknown [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633884|emb|CAB13386.1| putative protein involved in cell division or replication [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|296151732|gb|EFG92607.1| cell division protein MraZ [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412487|gb|ADM37606.1| putative protein involved in cell division or replication [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|320021550|gb|ADV96536.1| cell division protein MraZ [Bacillus subtilis BSn5]
          Length = 143

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L ++ +             +        +  E+K+
Sbjct: 1   MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMHEWKQIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 116 SKVIWEQYTEEQEDSFAE 133


>gi|88799432|ref|ZP_01115009.1| hypothetical protein MED297_03587 [Reinekea sp. MED297]
 gi|88777742|gb|EAR08940.1| hypothetical protein MED297_03587 [Reinekea sp. MED297]
          Length = 158

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 6/148 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  +D+KGRV+VP  +R +L       L    D     + V      E  ++KI
Sbjct: 8   MLRGVHSLALDAKGRVAVPSRYRAMLDAAAENQLVITIDTESRCLLVYPLPEWEVIQEKI 67

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  + F+  A ++  L+ G    + +DS GR+L++  +R + G++ +V  +G+GN F+LW
Sbjct: 68  SALSSFNKAARRIQRLLIGYATDVDIDSAGRVLISAPLREYAGLDKKVVLLGQGNKFELW 127

Query: 123 NPQTFRKLQEE------SRNEYCRQLLQ 144
           +   + + ++E      +      +L Q
Sbjct: 128 SEAEWEQARDEYIAAAGTDESMTEELEQ 155


>gi|258593047|emb|CBE69358.1| Protein mraZ [NC10 bacterium 'Dutch sediment']
          Length = 149

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 63/144 (43%), Gaps = 2/144 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    ID KGR+S+P  +R IL +R   +L      F   I        +  EQ +
Sbjct: 1   MFRGSFEHAIDDKGRLSIPARYREILKRRRERELILVDPLFDACIVAYPIKAWQQIEQNL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +     +  + + L+    +   +DS+GRIL+   +R    +  +V  VG  +  ++W
Sbjct: 61  LSHGNSDRKFREYARLISAHAVESTVDSQGRILIPPQLREKADLRRDVVIVGVLDKIEIW 120

Query: 123 NPQTFRKLQEESRN--EYCRQLLQ 144
           N + +     + R+  +Y  +L +
Sbjct: 121 NRERWTSFCAQERDPEDYAGKLAE 144


>gi|253689962|ref|YP_003019152.1| MraZ protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259509659|sp|C6DEV2|MRAZ_PECCP RecName: Full=Protein MraZ
 gi|251756540|gb|ACT14616.1| MraZ protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 152

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L       + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREMLNGESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MDS GR+L+ + +R    ++ EV  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDSAGRLLIANTLRQHADLKKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+ +   +  +    Q  Q+
Sbjct: 121 DEQTWYQQVRDDID--AEQSTQE 141


>gi|254362470|ref|ZP_04978578.1| hypothetical protein MHA_2077 [Mannheimia haemolytica PHL213]
 gi|261493506|ref|ZP_05990028.1| hypothetical protein COK_1911 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495859|ref|ZP_05992291.1| hypothetical protein COI_1618 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153094062|gb|EDN74974.1| hypothetical protein MHA_2077 [Mannheimia haemolytica PHL213]
 gi|261308486|gb|EEY09757.1| hypothetical protein COI_1618 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310839|gb|EEY12020.1| hypothetical protein COK_1911 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 152

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 63/132 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  IDSKGR+++P  +R  L ++    L C  D   P + +      E  EQK+
Sbjct: 1   MFRGASSISIDSKGRIAIPTRYRAELLEKHHGILVCTVDIRQPCLLLYPLHEWEMVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     ++  ++ G     +MDS GRIL++  +R    +E ++  VG+ N F++W
Sbjct: 61  LALSNFDPVQRRIQRVMQGFATECEMDSAGRILLSPTLRQHAQLEQQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEES 134
             + ++    E 
Sbjct: 121 QDKQWQAQIAED 132


>gi|332976271|gb|EGK13133.1| cell division protein MraZ [Desmospora sp. 8437]
          Length = 145

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR  L +  +             + V      +  EQK+
Sbjct: 1   MFMGEYRHSVDDKGRLIIPSKFREDLGEAFVITRGL-----DHCLFVYPMPEWKQLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +R F  +E +   +G  +  ++W
Sbjct: 56  KSLPFTKADARAFTRFFFSGATVAELDKQGRVNLPGNLREFAKLEKDCVVIGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    E S++ +  ++ +K
Sbjct: 116 SKEAWASYYETSQDSF-NEIAEK 137


>gi|229829370|ref|ZP_04455439.1| hypothetical protein GCWU000342_01459 [Shuttleworthia satelles DSM
           14600]
 gi|229792533|gb|EEP28647.1| hypothetical protein GCWU000342_01459 [Shuttleworthia satelles DSM
           14600]
          Length = 143

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  L +         +      + V +++     E KI
Sbjct: 1   MFMGEYEHSVDSKGRLIIPARFREELGE----GFVMTKGL-DGCLFVYSAEEWHKLETKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +  A +       G    ++D +GR L+   +R + G+  +V   G     ++W
Sbjct: 56  HETPMTTKDARKFMRFFFAGAATCEIDKQGRTLIPPSLRAYAGLSKDVVLAGVSTRIEIW 115

Query: 123 NPQTFRKLQE-ESRNEYCRQLLQ 144
           + + + +    E  +E    +  
Sbjct: 116 DKKLWDETNSYEDMDEVAEHMAD 138


>gi|254469983|ref|ZP_05083387.1| protein MraZ [Pseudovibrio sp. JE062]
 gi|211960294|gb|EEA95490.1| protein MraZ [Pseudovibrio sp. JE062]
          Length = 156

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 86/143 (60%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+S+ T ++D+KGRVS+P  FR  LA+     LYCF   F  A+  G + L    ++
Sbjct: 1   MAGFVSHFTNRVDAKGRVSIPAPFRAALAKDGFEGLYCFPSPFQEAVDAGGNGLTAEIQK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++  ++  S++ + LS  ++G    LK+D +GRI++++ IR  TGI+ EVTFVG+G  FQ
Sbjct: 61  RLDAFSTLSMEYDALSTALYGASETLKIDRDGRIVLSEMIRNHTGIDGEVTFVGQGFKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W P  F K ++E+       L 
Sbjct: 121 IWEPTRFAKHRDEAMKRALAVLS 143


>gi|259907408|ref|YP_002647764.1| cell division protein MraZ [Erwinia pyrifoliae Ep1/96]
 gi|224963030|emb|CAX54513.1| Protein MraZ [Erwinia pyrifoliae Ep1/96]
 gi|310765091|gb|ADP10041.1| Protein mraZ [Erwinia sp. Ejp617]
          Length = 152

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDGKGRLAVPTRYRDMLNEGSQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R    +  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPVERRVQRLLLGHASECQMDNAGRILLASTLRQHASLSKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+ +  +E  +    Q  Q+
Sbjct: 121 DEQTWYQQVKEDID--AEQSSQQ 141


>gi|325571380|ref|ZP_08146880.1| cell division protein MraZ [Enterococcus casseliflavus ATCC 12755]
 gi|325155856|gb|EGC68052.1| cell division protein MraZ [Enterococcus casseliflavus ATCC 12755]
          Length = 158

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           +S F+      ID+KGR+ VP   R  L ++ +             +        E  E+
Sbjct: 14  LSMFMGEFQHSIDAKGRLIVPSKLREKLGEKFVVTRGL-----DGCLFGYPLSEWEKLEE 68

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ E       A       +      ++D +GRI +   +R    +      +G  N   
Sbjct: 69  KLNEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPVTLRNHADLTKSCVIIGVSNRIG 128

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+   ++   EE+   +  ++ +
Sbjct: 129 IWDETRWQAFSEEAEENF-DEIAE 151


>gi|291519054|emb|CBK74275.1| mraZ protein [Butyrivibrio fibrisolvens 16/4]
          Length = 143

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+K R+ +P  FR  L +  +             + V      +  E+K 
Sbjct: 1   MFMGEYSHNLDAKNRLIMPAKFREQLGEHFVATKGL-----DGCLFVYPLSEWQNIEEKF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +  A + S     G     +D +GR+L+   ++ + GI+ EV  VG  N  ++W
Sbjct: 56  REIPRTTKDARKFSRFFFAGAAECDIDKQGRVLIPANLKEYAGIDKEVVSVGVLNRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQLLQ 144
           + + +  +   +  +E    + +
Sbjct: 116 SKERWTEEGTYDDMDEIAEHMAE 138


>gi|167470125|ref|ZP_02334829.1| mraZ protein [Yersinia pestis FV-1]
          Length = 152

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L +     + C  D   P + + +    E  EQK+
Sbjct: 1   MFRGATMVNLDSKGRLAVPTRYRESLNEESQGQMVCTIDLHQPCMLLYSLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     +    ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW
Sbjct: 61  SRLLSMNPDERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           + QT+ +  +   ++       L ++
Sbjct: 121 DEQTWYQQVKDDIDAEQSTQEPLSER 146


>gi|325578830|ref|ZP_08148877.1| cell division protein MraZ [Haemophilus parainfluenzae ATCC 33392]
 gi|301155877|emb|CBW15346.1| conserved protein [Haemophilus parainfluenzae T3T1]
 gi|325159654|gb|EGC71786.1| cell division protein MraZ [Haemophilus parainfluenzae ATCC 33392]
          Length = 152

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 63/134 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGRV++P  +R  + ++    + C  D   P + +   D  E  EQK+
Sbjct: 1   MFRGAAAVNLDAKGRVAIPTRYRAEIMEKNQGQMVCTVDIRQPCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LSLSNFDPNQRRLQRVMLGYATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +    +E   
Sbjct: 121 SDTEWYAQIDEDIE 134


>gi|118590901|ref|ZP_01548301.1| MraZ protein [Stappia aggregata IAM 12614]
 gi|118436423|gb|EAV43064.1| MraZ protein [Stappia aggregata IAM 12614]
          Length = 155

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/145 (33%), Positives = 83/145 (57%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+S+ T ++D+KGRVS+P  FR++L +     LYC       A+  G +DLL    +
Sbjct: 1   MAGFVSHFTNRLDAKGRVSIPAPFRSVLVRDGFEGLYCIASPHCAAVDAGGNDLLAEINK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +   +   S   + L++ + G    L++D +GR+ ++D IR  TGI ++VTFVG    FQ
Sbjct: 61  RSEAFAKLSPDHDALAIALFGASENLRIDGDGRMTISDTIRDHTGITDQVTFVGMNYKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W P+ FR+ + E++      L ++
Sbjct: 121 IWEPEKFREFRAEAQRRALAMLSEQ 145


>gi|167854992|ref|ZP_02477766.1| hypothetical protein HPS_10095 [Haemophilus parasuis 29755]
 gi|219870382|ref|YP_002474757.1| cell division protein MraZ [Haemophilus parasuis SH0165]
 gi|254813281|sp|B8F3A7|MRAZ_HAEPS RecName: Full=Protein MraZ
 gi|167853840|gb|EDS25080.1| hypothetical protein HPS_10095 [Haemophilus parasuis 29755]
 gi|219690586|gb|ACL31809.1| cell division protein MraZ, possible DNA-binding transcription
           factor [Haemophilus parasuis SH0165]
          Length = 152

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 62/132 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  IDSKGR+++P  +R  L +       C  D   P + +      E  EQK+
Sbjct: 1   MFRGATSISIDSKGRIAIPTRYRAELLESYHGSFVCTVDIRQPCLLLYPLHEWEIVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     ++  ++ G     +MDS GRIL++  +R    +E ++  VG+ N F++W
Sbjct: 61  LALSNFDPAQRRIQRVMQGFATECEMDSAGRILLSPTLRQHAQLEQQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEES 134
             Q ++K   E 
Sbjct: 121 QDQQWQKQISED 132


>gi|291484064|dbj|BAI85139.1| cell division protein MraZ [Bacillus subtilis subsp. natto BEST195]
          Length = 148

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L ++ +             +        +  E+K+
Sbjct: 6   MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMHEWKQIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E E   +G  N  +LW
Sbjct: 61  KALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELW 120

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 121 SKVIWEQYTEEQEDSFAE 138


>gi|157963631|ref|YP_001503665.1| cell division protein MraZ [Shewanella pealeana ATCC 700345]
 gi|189028638|sp|A8H993|MRAZ_SHEPA RecName: Full=Protein MraZ
 gi|157848631|gb|ABV89130.1| MraZ protein [Shewanella pealeana ATCC 700345]
          Length = 152

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 57/139 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       L    D     + +      E    K+
Sbjct: 1   MFSGASAINLDAKGRIAIPKRYRESLHACHNNQLVITVDIQSSCLLLYPIHEWEQVAAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +        +  ++ G     ++D  GR+L+   +R +  ++     VG+ N F+LW
Sbjct: 61  ASLSDTQPTERAIKRMLLGYAHECELDGNGRMLLPPPLRQYANLDKRAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   +++  E+SR     +
Sbjct: 121 DEAAWQQQIEQSRIAILNE 139


>gi|300813308|ref|ZP_07093663.1| protein MraZ [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300512579|gb|EFK39724.1| protein MraZ [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 142

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 55/145 (37%), Gaps = 9/145 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D KGRV++P  FR  L      +    +      + +  +   E  E K+
Sbjct: 1   MLIGEYYHSLDPKGRVTIPSKFREDL-----NEFVMTKGLDD-CLFLYPNSEWEKIENKL 54

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +            G     +D +GR+L+   +R +  I++    VG  N  ++W
Sbjct: 55  KELPMTNKAVRSFVRTFFSGACDCAIDKQGRVLIPQNLRDYANIKDSSVIVGLSNRAEIW 114

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           + + + K   E   +  E   ++ +
Sbjct: 115 SQENWEKYNSEEGLTYEELAEKMSE 139


>gi|261405656|ref|YP_003241897.1| cell division protein MraZ [Paenibacillus sp. Y412MC10]
 gi|329924118|ref|ZP_08279351.1| protein MraZ [Paenibacillus sp. HGF5]
 gi|261282119|gb|ACX64090.1| MraZ protein [Paenibacillus sp. Y412MC10]
 gi|328940850|gb|EGG37160.1| protein MraZ [Paenibacillus sp. HGF5]
          Length = 145

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR +L    I             + V   D     EQK+
Sbjct: 1   MFMGEFQHSIDDKGRIIIPAKFRDLLGTSFIVTRGL-----DNCLFVYPKDEWAIMEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    + D +GR+ +   +R F  +E E   +G  +  ++W
Sbjct: 56  KSLPLMKSDARAFTRFFFSGATECEWDKQGRVNLPGNLREFAKLEKECVVIGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + ++   ++S   +   + +K
Sbjct: 116 SKEQWQNYYQQSEEAFND-IAEK 137


>gi|300112934|ref|YP_003759509.1| MraZ protein [Nitrosococcus watsonii C-113]
 gi|299538871|gb|ADJ27188.1| MraZ protein [Nitrosococcus watsonii C-113]
          Length = 149

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 63/143 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +D+KGR+S+P  +R  L   C + +    D     + +      E  E+K+
Sbjct: 1   MFRGITTLNLDAKGRLSIPAKYRKSLGICCESKVVITVDLLESCLQLYPLPEWEAVERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + QA  +   + G     ++DS GRIL+   +R    +   +T VG+GN F+LW
Sbjct: 61  IALPSHNRQARYIKRQLIGHAEERELDSHGRILLPLELRSRVELGKNITLVGQGNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           N   + +   +       +L ++
Sbjct: 121 NAAVWEQQIAKEEALNKEELTRE 143


>gi|308173478|ref|YP_003920183.1| cell division or replication protein [Bacillus amyloliquefaciens
           DSM 7]
 gi|307606342|emb|CBI42713.1| putative protein involved in cell division or replication [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553592|gb|AEB24084.1| cell division protein MraZ [Bacillus amyloliquefaciens TA208]
 gi|328911614|gb|AEB63210.1| putative protein involved in cell division or replication [Bacillus
           amyloliquefaciens LL3]
          Length = 143

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L ++ +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMNEWKLIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 116 SKVIWEQYTEEQEDSFAE 133


>gi|326791424|ref|YP_004309245.1| MraZ protein [Clostridium lentocellum DSM 5427]
 gi|326542188|gb|ADZ84047.1| MraZ protein [Clostridium lentocellum DSM 5427]
          Length = 142

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 61/144 (42%), Gaps = 6/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGRV VP  +R  L +  I             + +        FEQK+
Sbjct: 1   MFIGEYKHSLDEKGRVIVPSKYREKLGECFILTKGL-----DGCLFIYPLSEWMLFEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 ++ A +       G +    D +GRIL+   +RV++ IE ++ F+G  N  ++W
Sbjct: 56  KGLPLTNLNARKFVRFFLSGAVECTTDKQGRILIPTHLRVYSEIEKDIVFIGMSNRIEVW 115

Query: 123 NPQTFRKLQEESRN-EYCRQLLQK 145
           +   +     ES + E   + +++
Sbjct: 116 SNSKWEAYNNESLDVELLAEQMEE 139


>gi|53803410|ref|YP_114851.1| cell division protein MraZ [Methylococcus capsulatus str. Bath]
 gi|90103495|sp|Q604U9|MRAZ_METCA RecName: Full=Protein MraZ
 gi|53757171|gb|AAU91462.1| mraZ protein [Methylococcus capsulatus str. Bath]
          Length = 152

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 68/142 (47%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR++VP  +R+ L + C   L          + +      E  E+K+
Sbjct: 1   MFRGVNSISLDDKGRMAVPTRYRSELRESCEGQLVVTVG-TDTCLLLFPLPEFEELERKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    + Q  +L  L+ G     ++D +GR L+ + +R F  ++ +V  +G+GN F++W
Sbjct: 60  VKLPALNKQVKRLQRLLIGHAAECELDGQGRFLIPEPLRRFASLDKQVVLIGQGNKFEIW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + + ++E   E   + L+
Sbjct: 120 DEVLWDRCRQEWLEEASLEGLE 141


>gi|295092798|emb|CBK78905.1| mraZ protein [Clostridium cf. saccharolyticum K10]
          Length = 141

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  ID+KGR+ +P  FR  L    +             + V ++     FE+K+
Sbjct: 1   MFKGEYSHTIDAKGRLIMPSKFREQLGDEFVVTKGL-----DGCLFVYDNSEWTAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + +     G    ++D +GRIL+   +R F  +E EVT VG G+  ++W
Sbjct: 56  RALPLTNQNARKFTRFFLAGASDCEVDRQGRILIPAVLREFAHLEKEVTLVGVGSRIEIW 115

Query: 123 NPQTFRKLQE-ESRNEYCRQL 142
           N   + +    +   +    +
Sbjct: 116 NRALWEEKNVYDDMEDIAENM 136


>gi|163787482|ref|ZP_02181929.1| hypothetical protein FBALC1_03047 [Flavobacteriales bacterium
           ALC-1]
 gi|159877370|gb|EDP71427.1| hypothetical protein FBALC1_03047 [Flavobacteriales bacterium
           ALC-1]
          Length = 156

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+     K D KGR+ +P V +  LA          +  F P + +          Q
Sbjct: 1   MNSFIGTYECKADVKGRLMIPAVLKKQLAGALQEGFVLKRAVFQPCLELYPMSEWNSMMQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ + N F  + N        G   +++DS GR+L+   +  F+GI  +V      N  +
Sbjct: 61  KVNKLNRFKKKNNDFIRRFTAGVKIIEVDSTGRLLIPKDLISFSGISKQVVLASAVNIIE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   + +  +++ +++   L ++
Sbjct: 121 IWDKDKYEQAIDDAASDFAD-LAEE 144


>gi|157964707|ref|YP_001499531.1| cell division protein MraZ [Rickettsia massiliae MTU5]
 gi|157844483|gb|ABV84984.1| MraZ protein [Rickettsia massiliae MTU5]
          Length = 168

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 64/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I V     +E   Q
Sbjct: 20  MNVFLSKYVNGVDKKNRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGISHIEKLRQ 79

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGR+++   +    GIE +  FVG+G  F+
Sbjct: 80  MIETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFE 139

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 140 IWQPQNFEKYLNAAQK 155


>gi|16273055|ref|NP_439287.1| cell division protein MraZ [Haemophilus influenzae Rd KW20]
 gi|68249678|ref|YP_248790.1| cell division protein MraZ [Haemophilus influenzae 86-028NP]
 gi|148826258|ref|YP_001291011.1| cell division protein MraZ [Haemophilus influenzae PittEE]
 gi|229846160|ref|ZP_04466272.1| cell division protein MraZ [Haemophilus influenzae 7P49H1]
 gi|260580213|ref|ZP_05848043.1| mraZ protein [Haemophilus influenzae RdAW]
 gi|1175482|sp|P45056|MRAZ_HAEIN RecName: Full=Protein MraZ
 gi|81335892|sp|Q4QLG7|MRAZ_HAEI8 RecName: Full=Protein MraZ
 gi|167012245|sp|A5UCX7|MRAZ_HAEIE RecName: Full=Protein MraZ
 gi|1574684|gb|AAC22784.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|68057877|gb|AAX88130.1| MraZ [Haemophilus influenzae 86-028NP]
 gi|148716418|gb|ABQ98628.1| hypothetical protein CGSHiEE_06405 [Haemophilus influenzae PittEE]
 gi|229811164|gb|EEP46881.1| cell division protein MraZ [Haemophilus influenzae 7P49H1]
 gi|260093497|gb|EEW77430.1| mraZ protein [Haemophilus influenzae RdAW]
          Length = 151

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 61/134 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D     + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGQMVCTVDIRQSCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|315646022|ref|ZP_07899143.1| MraZ protein [Paenibacillus vortex V453]
 gi|315278783|gb|EFU42097.1| MraZ protein [Paenibacillus vortex V453]
          Length = 145

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR +L    I             + V   D     EQK+
Sbjct: 1   MFMGEFQHSIDDKGRIIIPAKFRDLLGNSFIVTRGL-----DNCLFVYPRDEWAIMEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    + D +GR+ +   +R F  +E E   +G  +  ++W
Sbjct: 56  KSLPLMKSDARAFTRFFFSGATECEWDKQGRVNLPGNLREFAKLEKECVVIGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + ++   ++S   +   + +K
Sbjct: 116 SKEQWQNYYQQSEETFND-IAEK 137


>gi|238060256|ref|ZP_04604965.1| mraZ protein [Micromonospora sp. ATCC 39149]
 gi|237882067|gb|EEP70895.1| mraZ protein [Micromonospora sp. ATCC 39149]
          Length = 143

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      +   +      + V      +    ++
Sbjct: 1   MFLGTHTPRLDEKGRLILPAKFRDGLA----GGVVITKG-QDRCLYVFPMPEFQRIADQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A   S +          D +GR+ +   +R + G++ ++  +G     ++W
Sbjct: 56  RAQPMTNKAARAYSRVFFASAHDEVPDKQGRVTVPAHLRAYAGLDRDLVVIGASTRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES +++  
Sbjct: 116 DKAAWESYLAESEDDFAD 133


>gi|330469298|ref|YP_004407041.1| cell division protein MraZ [Verrucosispora maris AB-18-032]
 gi|328812269|gb|AEB46441.1| cell division protein MraZ [Verrucosispora maris AB-18-032]
          Length = 143

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      +   +      + V  +   +    ++
Sbjct: 1   MFLGTHTPRLDDKGRLILPAKFRDELA----GGVVITKG-QERCLYVFPTPEFQRIADQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   S +          D +GR+ +   +R + G++ ++  +G     ++W
Sbjct: 56  RAQPMTHKAARAYSRVFFASAHDEVPDKQGRVTIPAHLRSYAGLDRDLVVIGASTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES +++  
Sbjct: 116 DKVAWETYLAESEDDFAD 133


>gi|311068033|ref|YP_003972956.1| cell division protein MraZ [Bacillus atrophaeus 1942]
 gi|310868550|gb|ADP32025.1| cell division protein MraZ [Bacillus atrophaeus 1942]
          Length = 143

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L ++ +             +        +  E+K+
Sbjct: 1   MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMHEWKLIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 116 SKVIWEQYTEEQEDSFAE 133


>gi|283477241|emb|CAY73149.1| Protein mraZ [Erwinia pyrifoliae DSM 12163]
          Length = 158

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 7   MFRGATLVNLDGKGRLAVPTRYRDMLNEGSQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 66

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+   +R    +  +V  VG+ N F+LW
Sbjct: 67  SRLSSMNPVERRVQRLLLGHASECQMDNAGRILLASTLRQHASLSKQVMLVGQFNKFELW 126

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+ +  +E  +    Q  Q+
Sbjct: 127 DEQTWYQQVKEDID--AEQSSQQ 147


>gi|152996636|ref|YP_001341471.1| MraZ protein [Marinomonas sp. MWYL1]
 gi|189028624|sp|A6VYK7|MRAZ_MARMS RecName: Full=Protein MraZ
 gi|150837560|gb|ABR71536.1| MraZ protein [Marinomonas sp. MWYL1]
          Length = 151

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 68/142 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P   R  LAQ     +    D     + +      E  +QK+
Sbjct: 1   MFRGIHQVSVDAKGRMSLPARLRDDLAQYDDDGVVVTIDPVSRCLLLYPLSEWELIQQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  QA +L  L+ G    L++D  GRIL+   +R F  ++ ++T +G+G   ++W
Sbjct: 61  DKLPTFQPQARRLQRLLVGHATDLEVDKAGRILLPAPLREFARLDKKLTILGQGKKLEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +   +E+  ++   + LQ
Sbjct: 121 SQEEWEAQREDYLSQDALEDLQ 142


>gi|145635579|ref|ZP_01791277.1| hypothetical protein CGSHiAA_07381 [Haemophilus influenzae PittAA]
 gi|229844916|ref|ZP_04465054.1| cell division protein MraZ [Haemophilus influenzae 6P18H1]
 gi|319776630|ref|YP_004139118.1| MraZ protein [Haemophilus influenzae F3047]
 gi|319897404|ref|YP_004135601.1| mraz protein [Haemophilus influenzae F3031]
 gi|329124143|ref|ZP_08252690.1| cell division protein MraZ [Haemophilus aegyptius ATCC 11116]
 gi|145267141|gb|EDK07147.1| hypothetical protein CGSHiAA_07381 [Haemophilus influenzae PittAA]
 gi|229812297|gb|EEP47988.1| cell division protein MraZ [Haemophilus influenzae 6P18H1]
 gi|317432910|emb|CBY81276.1| MraZ protein [Haemophilus influenzae F3031]
 gi|317451221|emb|CBY87454.1| MraZ protein [Haemophilus influenzae F3047]
 gi|327467568|gb|EGF13066.1| cell division protein MraZ [Haemophilus aegyptius ATCC 11116]
          Length = 151

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 61/134 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D     + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGQMVCTVDIRQSCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|229588481|ref|YP_002870600.1| cell division protein MraZ [Pseudomonas fluorescens SBW25]
 gi|312959048|ref|ZP_07773567.1| MraZ [Pseudomonas fluorescens WH6]
 gi|259509660|sp|C3KBY5|MRAZ_PSEFS RecName: Full=Protein MraZ
 gi|229360347|emb|CAY47204.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
 gi|311286818|gb|EFQ65380.1| MraZ [Pseudomonas fluorescens WH6]
          Length = 151

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 56/132 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + V   D  E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELISRSSGQLIITIDAVDPCLCVYPLDEWELIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQLW
Sbjct: 61  RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           +   +  +    
Sbjct: 121 DEDAWDAVSAAD 132


>gi|269798181|ref|YP_003312081.1| MraZ protein [Veillonella parvula DSM 2008]
 gi|282850410|ref|ZP_06259789.1| protein MraZ [Veillonella parvula ATCC 17745]
 gi|294792048|ref|ZP_06757196.1| MraZ protein [Veillonella sp. 6_1_27]
 gi|294793913|ref|ZP_06759050.1| MraZ protein [Veillonella sp. 3_1_44]
 gi|269094810|gb|ACZ24801.1| MraZ protein [Veillonella parvula DSM 2008]
 gi|282579903|gb|EFB85307.1| protein MraZ [Veillonella parvula ATCC 17745]
 gi|294455483|gb|EFG23855.1| MraZ protein [Veillonella sp. 3_1_44]
 gi|294457278|gb|EFG25640.1| MraZ protein [Veillonella sp. 6_1_27]
          Length = 143

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P   R  L   CI             +++   +  +     +
Sbjct: 1   MFMGEYNHTIDTKGRMIIPAKIREQLGDLCIVTKGL-----DNCLAIYTEEAWKKISTAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        L   V G    L+ D +GR+L+   +R +  ++ +   VG G++ ++W
Sbjct: 56  QSQSSTKASVRALKRFVFGSAAELEYDKQGRVLIPVPLREYASLDKQAVIVGAGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    +E   E   +L++
Sbjct: 116 SREKYD-FYDEQVAESMEELVE 136


>gi|158426171|ref|YP_001527463.1| MraZ protein [Azorhizobium caulinodans ORS 571]
 gi|172047923|sp|A8HZ71|MRAZ_AZOC5 RecName: Full=Protein MraZ
 gi|158333060|dbj|BAF90545.1| MraZ protein [Azorhizobium caulinodans ORS 571]
          Length = 157

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 50/140 (35%), Positives = 84/140 (60%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RF+S  T ++D+KGRVS+P  +RT+LA+     L+C      PA+  G + L+   E 
Sbjct: 1   MDRFVSTYTMRLDAKGRVSIPAPYRTVLAKDGTDLLHCHPSLAEPALDAGGTSLMAEIEA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            IA Y P+S    +L+  ++G    L++D EGR+++T+ ++    I ++VTFVG G+ F+
Sbjct: 61  LIARYPPYSEAREELAAALYGTTEMLRIDPEGRVVLTESLKTHAAIADQVTFVGLGHKFR 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P+ FR    E+R +  +
Sbjct: 121 IWEPERFRAHLAEAREKVRQ 140


>gi|134102315|ref|YP_001107976.1| MraZ protein [Saccharopolyspora erythraea NRRL 2338]
 gi|291003723|ref|ZP_06561696.1| MraZ protein [Saccharopolyspora erythraea NRRL 2338]
 gi|167012272|sp|A4FLX6|MRAZ_SACEN RecName: Full=Protein MraZ
 gi|133914938|emb|CAM05051.1| MraZ protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 143

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+++P  FR  LA   +             + V      E   +K+
Sbjct: 1   MFLGTHHPKLDDKGRLTLPAKFREALAGGLMVTK-----GQDHCLYVFPRAEFEQMARKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +         +  G    + D +GRI +   +R + G+  E   +G  N  ++W
Sbjct: 56  AEAPFTNESVRAYQRYLFAGTDEQQPDGQGRISIAAELRRYAGLTKECVVIGAINRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N + ++   +E   +Y +   +
Sbjct: 116 NAERWQTYLDEHEEDYAQAREE 137


>gi|152985701|ref|YP_001350329.1| cell division protein MraZ [Pseudomonas aeruginosa PA7]
 gi|150960859|gb|ABR82884.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 163

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 59/133 (44%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F       +D+KGR+++P  +R  L  RC   L    D   P ++V      E  E K
Sbjct: 12  DVFRGANAISLDAKGRLAMPSRYRDELVSRCAGQLIVTIDAVDPCLTVYPLPEWELIEAK 71

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + E      +  +L  L+ G  + L++D  GR L+   +R +  ++     VG+ N FQL
Sbjct: 72  LRELPSLREETRRLQRLLIGNAVDLELDGNGRFLIPPRLREYAKLDKRAMLVGQLNKFQL 131

Query: 122 WNPQTFRKLQEES 134
           W+   +  + E  
Sbjct: 132 WDEDAWNAMAEAD 144


>gi|82703618|ref|YP_413184.1| cell division protein MraZ [Nitrosospira multiformis ATCC 25196]
 gi|91207201|sp|Q2Y629|MRAZ_NITMU RecName: Full=Protein MraZ
 gi|82411683|gb|ABB75792.1| Protein of unknown function UPF0040 [Nitrosospira multiformis ATCC
           25196]
          Length = 147

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 4/143 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++VP  +R  L   C   L    D     + +    + E  EQK+
Sbjct: 1   MFRGGTPVSLDNKGRLAVPARYRETLISLCAGHLIVTADPS-KCLLIYPQPVWEPIEQKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F+ Q   L  L+ G    ++MD  GRIL+   +R F G+  EV  VG+G  F+LW
Sbjct: 60  NSLSSFNPQTRSLQRLLVGNACDVEMDGVGRILVPPSLRAFAGLNKEVVLVGQGAKFELW 119

Query: 123 NPQTFRKLQEES---RNEYCRQL 142
           + + +    E +   R+   ++L
Sbjct: 120 DSEKWNLQMESALAFRDGIPQEL 142


>gi|125973497|ref|YP_001037407.1| MraZ protein [Clostridium thermocellum ATCC 27405]
 gi|256003313|ref|ZP_05428304.1| MraZ protein [Clostridium thermocellum DSM 2360]
 gi|281417698|ref|ZP_06248718.1| MraZ protein [Clostridium thermocellum JW20]
 gi|167011872|sp|A3DE35|MRAZ_CLOTH RecName: Full=Protein MraZ
 gi|125713722|gb|ABN52214.1| MraZ protein [Clostridium thermocellum ATCC 27405]
 gi|255992603|gb|EEU02694.1| MraZ protein [Clostridium thermocellum DSM 2360]
 gi|281409100|gb|EFB39358.1| MraZ protein [Clostridium thermocellum JW20]
          Length = 143

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGRV +P  FR  L ++ I             +   + +     E K+
Sbjct: 1   MFYGEYQHSVDAKGRVIIPSKFREGLGEKFILTKGL-----DNCLFAYSLEEWSNLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G   +++D +GRIL+   +R + G+E +V  +G     ++W
Sbjct: 56  RSLPFTDKDVRAFVRFFFAGAAEVEVDKQGRILIPQNLREYAGLEKDVYIIGVSTRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +     +  N     + +K
Sbjct: 116 DKSKWESYSGD-ENMSAESIAEK 137


>gi|145641288|ref|ZP_01796868.1| hypothetical protein CGSHiR3021_05784 [Haemophilus influenzae
           R3021]
 gi|145274125|gb|EDK13991.1| hypothetical protein CGSHiR3021_05784 [Haemophilus influenzae
           22.4-21]
          Length = 151

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 61/134 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D     + +   D  E  EQK+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGKMVCTVDIRQSCLLLYPLDEWEKIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILLSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|2149900|gb|AAC45630.1| unknown [Enterococcus faecalis]
          Length = 143

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP  FR  L ++ +             +     +     E K+
Sbjct: 1   MLMGEYQHNIDAKGRLIVPSKFREELGEKFVVTRGM-----DGCLFGYPLNEWSQLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R    +E     +G  N  ++W
Sbjct: 56  QEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPANLRTHASLEKGCVVIGVSNGIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    +E+   +  +L +
Sbjct: 116 SDERWHAFSDEAEENF-DELAE 136


>gi|259503027|ref|ZP_05745929.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259168893|gb|EEW53388.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 140

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 50/140 (35%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ +P  FR  L    +             +        +  E K+  
Sbjct: 1   MGEYNHVIDAKGRLIIPAKFRDQLGAAFVITRGL-----DGCLFGYPQAEWQRLEAKLTS 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A      ++      ++D +GR+ +   +R    ++ +   +G  N F++W+ 
Sbjct: 56  LPLTKRDARAFVRFLYSAATECELDRQGRVNIPAILRQHAALQKDCVIIGVSNRFEIWSA 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
             +      + + +  ++ +
Sbjct: 116 DRWNDYSTTTADNF-DEIAE 134


>gi|257870251|ref|ZP_05649904.1| cell division protein MraZ [Enterococcus gallinarum EG2]
 gi|257804415|gb|EEV33237.1| cell division protein MraZ [Enterococcus gallinarum EG2]
          Length = 143

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 51/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP   R  L ++ +             +        E  E+K+
Sbjct: 1   MFMGEFQHSIDAKGRLIVPSKLREKLGEKFVVTRGL-----DGCLFGYPLSEWEKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R    +      +G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECEIDKQGRINIPATLREHASLMKSCVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++    E+   +  ++ +
Sbjct: 116 DEARWQAFTTEAEENF-DEIAE 136


>gi|153809803|ref|ZP_01962471.1| hypothetical protein RUMOBE_00184 [Ruminococcus obeum ATCC 29174]
 gi|149833981|gb|EDM89061.1| hypothetical protein RUMOBE_00184 [Ruminococcus obeum ATCC 29174]
          Length = 143

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 61/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR +L +  +             +S+   D    FE+K+
Sbjct: 1   MFMGEYNHTIDAKGRLIIPSKFRELLGEEFVLTKGL-----DGCLSIYPMDEWNAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A   +     G    ++D +GRIL+   +R F G+E +V   G  N  ++W
Sbjct: 56  RALPLTNKNARTFTRFFVAGATNCELDKQGRILVPQTLREFAGLEKDVVLTGNLNRIEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +  +    +   + +Q
Sbjct: 116 SKEKWSENCDYDDMDSIAEGMQ 137


>gi|288553171|ref|YP_003425106.1| cell division protein MraZ [Bacillus pseudofirmus OF4]
 gi|288544331|gb|ADC48214.1| cell division protein MraZ [Bacillus pseudofirmus OF4]
          Length = 143

 Score =  137 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 56/142 (39%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR  L    +             + V   D  +  E+K+
Sbjct: 1   MFMGEYRHNVDEKGRMIIPAKFRESLGSSFVVTRGL-----DRCLFVYPLDEWKRLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +R +  +E E   +G  N  ++W
Sbjct: 56  KTLPFTKKDARAFTRFFFSGAAECELDKQGRVNIAQTLREYAELEKECVIIGVSNRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + +  EES + +  ++ +
Sbjct: 116 SKAKWEEYFEESDDSF-GEIAE 136


>gi|299534664|ref|ZP_07047996.1| protein mraZ [Lysinibacillus fusiformis ZC1]
 gi|298730037|gb|EFI70580.1| protein mraZ [Lysinibacillus fusiformis ZC1]
          Length = 143

 Score =  137 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 49/142 (34%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L +         +      +     +     E+K+
Sbjct: 1   MFMGEYQHSVDAKGRLIVPAKFREALGE----TFVVTRGL-DNCLFGYPMNEWRKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                        +     G   +++D +GRI +   +     +  E   +G  N  ++W
Sbjct: 56  KGLPMTKKDTRAFARFFFSGATEVEIDKQGRINIPATLMQHAHLVKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
               +     ES   +  ++ +
Sbjct: 116 AKDAWEAYFSESEQSF-NEIAE 136


>gi|302868933|ref|YP_003837570.1| MraZ protein [Micromonospora aurantiaca ATCC 27029]
 gi|315504597|ref|YP_004083484.1| mraz protein [Micromonospora sp. L5]
 gi|302571792|gb|ADL47994.1| MraZ protein [Micromonospora aurantiaca ATCC 27029]
 gi|315411216|gb|ADU09333.1| MraZ protein [Micromonospora sp. L5]
          Length = 143

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      +   +      + V      +    ++
Sbjct: 1   MFLGTHTPRLDDKGRLILPAKFRDELA----GGVVITKG-QERCLYVFPMPEFQRIADQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S  A   S +          D +GR+ +   +R +  ++ ++  +G     ++W
Sbjct: 56  RAQPMTSKAARAYSRVFFASAHDEVPDKQGRVTIPGHLRSYAALDRDLVVIGASTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES +++  
Sbjct: 116 DKAAWEAYLAESEDDFAD 133


>gi|154245797|ref|YP_001416755.1| hypothetical protein Xaut_1853 [Xanthobacter autotrophicus Py2]
 gi|226710022|sp|A7IGF5|MRAZ_XANP2 RecName: Full=Protein MraZ
 gi|154159882|gb|ABS67098.1| protein of unknown function UPF0040 [Xanthobacter autotrophicus
           Py2]
          Length = 157

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 78/140 (55%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RF+S  T ++D+KGRVS+P  FRT+LA+     LYC      PA+  G + L+   + 
Sbjct: 1   MDRFVSTYTMRLDAKGRVSIPAPFRTVLAKDGADGLYCHPSLAEPALDAGGNRLVGEIDA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I  Y P+S    +L+  ++G    L++D EGR++++D ++    I ++V FVG G+ F+
Sbjct: 61  LIESYPPYSEAREELAAALYGTSETLRIDPEGRVVLSDTLKAHAAITDQVAFVGLGHKFR 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P+  +    E+      
Sbjct: 121 IWEPERLKAHLAEATQRVRE 140


>gi|325662360|ref|ZP_08150969.1| mraZ protein [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086163|ref|ZP_08335245.1| mraZ protein [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325471362|gb|EGC74585.1| mraZ protein [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330406322|gb|EGG85836.1| mraZ protein [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 145

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    IDSKGR+ +P  FR IL    +             + V   +  + FE+K+
Sbjct: 1   MLTGEYNHSIDSKGRLIIPAKFREILGDSFVITKGL-----DNCLFVYPDNEWKLFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A   +    G  +   +D +GR+L++  +R F G+E EV  VG  +  ++W
Sbjct: 56  RTLPLTNKNARTFTRFFLGSAVEGVLDKQGRVLISSALRDFAGLEKEVVLVGVLDRVEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   + +   E   + ++    + +
Sbjct: 116 DKAKWDESNAEVEANMDDIAGHMEE 140


>gi|225021916|ref|ZP_03711108.1| hypothetical protein CORMATOL_01948 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945303|gb|EEG26512.1| hypothetical protein CORMATOL_01948 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 143

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREELAGGLMVTK-----GQDHSLAVYPKEEFVRIARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    +  A      +       + D +GRI +T   R + G+  E   +G  ++ ++W
Sbjct: 56  AQLPRSNPAARAFIRNLTASADEQRPDGQGRITITPDHRKYAGLTKECVVIGAMDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +   Q ++ + +  
Sbjct: 116 DAEAWAHYQADTESAFAD 133


>gi|290969164|ref|ZP_06560689.1| protein MraZ [Megasphaera genomosp. type_1 str. 28L]
 gi|290780670|gb|EFD93273.1| protein MraZ [Megasphaera genomosp. type_1 str. 28L]
          Length = 146

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 54/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T  ID+KGRV +P  FR  L   C+             +SV  ++        +
Sbjct: 1   MFMGEFTHSIDAKGRVILPAKFREELGLHCVVTRGL-----EGCLSVYTAENWLSLANSM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +              + G    ++ D +GRIL+   +R +  +  +VT +G G+  ++W
Sbjct: 56  KKLKASKENVRAFKRFLFGSAAEVEFDRQGRILIPAALREYAKLTKDVTVLGTGDKIEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   +            E    L +
Sbjct: 116 DKGAYETYAAAIVPDMEEIAESLHE 140


>gi|90407775|ref|ZP_01215953.1| hypothetical protein PCNPT3_04621 [Psychromonas sp. CNPT3]
 gi|90311135|gb|EAS39242.1| hypothetical protein PCNPT3_04621 [Psychromonas sp. CNPT3]
          Length = 152

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 59/132 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    ID+KGR+++P  +R  L Q C     C  D   P + +   +     E+K+
Sbjct: 1   MLRGASAINIDNKGRIAIPTRYRDELMQMCQGKFVCTIDLQSPCLLLYPLNEWLLIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +    Q  +L  L+ G     ++D  GR L+   +R    +E ++  VG+ N F+LW
Sbjct: 61  SGLSSTDPQQRRLQRLILGYASESELDKGGRTLIAPILRTHAKLEKKLMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEES 134
           +   + K  ++ 
Sbjct: 121 DEALWLKQVQQD 132


>gi|89099598|ref|ZP_01172473.1| hypothetical protein B14911_11452 [Bacillus sp. NRRL B-14911]
 gi|89085751|gb|EAR64877.1| hypothetical protein B14911_11452 [Bacillus sp. NRRL B-14911]
          Length = 143

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 49/138 (35%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L +  I             +        +  E K+
Sbjct: 1   MFMGEYHHNVDTKGRLIVPAKFRDNLGEMFILTRGL-----DQCLFGYPLSEWKQLETKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI ++  +  +  +E E   VG  N  ++W
Sbjct: 56  KGLPLTKKDARAFTRFFFSGASECELDKQGRINISSPLMQYAKLEKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES   +  
Sbjct: 116 SKHLWEDFFAESEESFAE 133


>gi|119773486|ref|YP_926226.1| cell division protein MraZ [Shewanella amazonensis SB2B]
 gi|167012274|sp|A1S2F0|MRAZ_SHEAM RecName: Full=Protein MraZ
 gi|119765986|gb|ABL98556.1| MraZ protein [Shewanella amazonensis SB2B]
          Length = 152

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 61/139 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       L    D     + +  +D     E K+
Sbjct: 1   MFKGASAINLDAKGRIAIPTRYREPLLSAHEGKLVITVDIQANCLLIYPADEWSLIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  ++ G    ++MDS GR+L+   +R +  ++ +   VG+ N F+LW
Sbjct: 61  LKLSDTQPTERALKRMLLGYAHEIEMDSNGRLLLPPPLRQYAQLDKKAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   ++   + +++    +
Sbjct: 121 DEAQWQAQIQSAQDVIRSE 139


>gi|295109201|emb|CBL23154.1| mraZ protein [Ruminococcus obeum A2-162]
          Length = 143

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR +L +  +             +S+   D  + FE+K+
Sbjct: 1   MFMGEYNHTIDAKGRLIIPSKFRELLGEEFVLTKGL-----DGCLSIYPMDEWKAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A   +     G    ++D +GRIL+   +R F G+E +V   G  N  ++W
Sbjct: 56  RALPLTNKNARTFTRFFVAGATNCELDKQGRILVPQTLREFAGLEKDVVLTGNLNRIEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +  +    +   + +Q
Sbjct: 116 SKEKWSENCDYDDMDSIAEGMQ 137


>gi|253580156|ref|ZP_04857423.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848675|gb|EES76638.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 146

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 61/144 (42%), Gaps = 6/144 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F+      ID+KGR+ +P  FR +L +  +             + +   D  E FE K
Sbjct: 3   NMFMGEYNHTIDAKGRLIIPSKFRELLGEEFVLTRGL-----DGCLYIYPMDEWESFEMK 57

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A   S     G    ++D +GRIL+   +R F G+E +V   G  N  ++
Sbjct: 58  LRSLPLTNKNARTFSRFFVAGATTCELDRQGRILVPQTLREFAGLEKDVVLTGNLNRIEV 117

Query: 122 WNPQTFRKLQE-ESRNEYCRQLLQ 144
           W+ + + ++ + +  +     +  
Sbjct: 118 WSKEKWNEICDYDDMDSIAESMQD 141


>gi|319649674|ref|ZP_08003830.1| hypothetical protein HMPREF1013_00434 [Bacillus sp. 2_A_57_CT2]
 gi|317398836|gb|EFV79518.1| hypothetical protein HMPREF1013_00434 [Bacillus sp. 2_A_57_CT2]
          Length = 143

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 49/138 (35%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L +         +      +     D     E+K+
Sbjct: 1   MFMGEFHHNVDNKGRLIVPSKFRDNLGE----TFVLTRGL-DQCLFGYPMDEWRQLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  N  ++W
Sbjct: 56  KGLPLTKKDARAFTRFFFSGATECEIDKQGRINIASPLLQYAKLEKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES   +  
Sbjct: 116 SKNLWEDYFAESEESFAD 133


>gi|74316128|ref|YP_313868.1| hypothetical protein Tbd_0110 [Thiobacillus denitrificans ATCC
           25259]
 gi|91207108|sp|Q3SMI2|MRAZ_THIDA RecName: Full=Protein MraZ
 gi|74055623|gb|AAZ96063.1| Protein of unknown function UPF0040 [Thiobacillus denitrificans
           ATCC 25259]
          Length = 148

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T  +DSK R+ VP  +R  L       +    D     + +      E  E+K+
Sbjct: 1   MFRGVATVSLDSKNRLVVPARYRDALLVNGAGRVVVTADP-GQCLLLYPLPEWEPIEKKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F+ +   L  L+ G    + MDS GR+L+   +R F  ++  V  VG+G+  +LW
Sbjct: 60  TALSDFNPRTRSLKQLLVGYAHDIDMDSAGRVLLPPMLRKFAELDKNVVLVGQGSKVELW 119

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           N   +     ++ + + ++
Sbjct: 120 NEARWEAQVAQALS-FSQE 137


>gi|282882929|ref|ZP_06291534.1| protein MraZ [Peptoniphilus lacrimalis 315-B]
 gi|281297340|gb|EFA89831.1| protein MraZ [Peptoniphilus lacrimalis 315-B]
          Length = 142

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 55/145 (37%), Gaps = 9/145 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D KGRV +P  FR  L++         +      + +  +   E  E K+
Sbjct: 1   MLIGEYYHSLDPKGRVIIPSKFREDLSE-----FVMTKGL-DECLFLYPNSEWEKIENKL 54

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +            G     +D +GR+L+   +R +  I++    VG  N  ++W
Sbjct: 55  KELPMTNKAVRSFVRTFFSGACDCAIDKQGRVLIPQNLRDYANIKDSSVIVGLSNRAEIW 114

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           + + + K   E   +  E   ++ +
Sbjct: 115 SQENWEKYNSEEGLTYEELAEKMSE 139


>gi|258514332|ref|YP_003190554.1| MraZ protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257778037|gb|ACV61931.1| MraZ protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 145

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 58/143 (40%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L +R +             +++         EQK+
Sbjct: 1   MFMGEHQHTIDNKGRMIIPARFREELGERFVMTKGL-----EGCLALYPLQEWSVLEQKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A  L+  +  G    ++D +GRIL+ + +R    +  +V  +G  +  ++W
Sbjct: 56  RSLPFTRKDARALARFIFSGASECEIDKQGRILIPNNLREHAKLVKDVVVIGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +     E+      ++ +K
Sbjct: 116 SKAEWEAYSNETAVSV-EEIAEK 137


>gi|91205354|ref|YP_537709.1| cell division protein MraZ [Rickettsia bellii RML369-C]
 gi|157826955|ref|YP_001496019.1| cell division protein MraZ [Rickettsia bellii OSU 85-389]
 gi|122425756|sp|Q1RJ44|MRAZ_RICBR RecName: Full=Protein MraZ
 gi|167012268|sp|A8GVV5|MRAZ_RICB8 RecName: Full=Protein MraZ
 gi|91068898|gb|ABE04620.1| MraZ protein [Rickettsia bellii RML369-C]
 gi|157802259|gb|ABV78982.1| hypothetical protein A1I_03085 [Rickettsia bellii OSU 85-389]
          Length = 150

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 1/137 (0%)

Query: 1   MSRFLSNV-TQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59
           M+ FLS      ID KGRVSVP  +R +L +     +  +       I       +E   
Sbjct: 1   MNIFLSKFINNNIDKKGRVSVPANYRAVLGKEAFNGIIAYPSIRNNCIEACGISHIEKLR 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           Q I   +P+S + +    ++ G  + L  D EGR+++   +    GIE++V FVG+G  F
Sbjct: 61  QMIESLDPYSEERDAFETIIFGEAVQLSFDGEGRVILPASLMQHAGIEDQVCFVGKGVIF 120

Query: 120 QLWNPQTFRKLQEESRN 136
           ++W PQ F+     ++ 
Sbjct: 121 EIWQPQNFKDYLASAQK 137


>gi|319892165|ref|YP_004149040.1| Cell division protein MraZ [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161861|gb|ADV05404.1| Cell division protein MraZ [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464736|gb|ADX76889.1| MraZ protein [Staphylococcus pseudintermedius ED99]
          Length = 143

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGR+ VP  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYENKLDAKGRMIVPSKFRYDLNERFILTRGL-----DKCLFGYTLEEWQTIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  ++ E T +G  N  ++W
Sbjct: 56  KSLPLTKRDARKFVRMFFSGAIEVEIDKQGRINIPAKLREYAHLDKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +  T+    +ES   +  ++ +
Sbjct: 116 DRNTWNDFYDESEESF-EEIAE 136


>gi|238916663|ref|YP_002930180.1| MraZ protein [Eubacterium eligens ATCC 27750]
 gi|238872023|gb|ACR71733.1| MraZ protein [Eubacterium eligens ATCC 27750]
          Length = 164

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 8/143 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP  FR +L    +             + V  +D  + FE+K+
Sbjct: 20  MLMGEYNHTIDAKGRLIVPAKFREVLGDEFVVTKGL-----DNCLFVYPNDEWQKFEEKL 74

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A Q +     G   +++D +GRIL+   +R F G+E +V  VG  +  ++W
Sbjct: 75  QTLPLTNKNARQFTRFFLAGAASVEVDKQGRILLPSVLREFAGLEKDVVLVGVASRIEIW 134

Query: 123 NPQTFRKLQ---EESRNEYCRQL 142
           +   + +     ++  +E    +
Sbjct: 135 SKDRWLQSISTYDDDMDEVAANM 157


>gi|165975467|ref|YP_001651060.1| cell division protein MraZ [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|303250488|ref|ZP_07336685.1| cell division protein MraZ [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303251831|ref|ZP_07338002.1| cell division protein MraZ [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307244810|ref|ZP_07526909.1| hypothetical protein appser1_240 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249132|ref|ZP_07531139.1| hypothetical protein appser2_20940 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249208|ref|ZP_07531205.1| hypothetical protein appser4_250 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307251530|ref|ZP_07533437.1| hypothetical protein appser6_540 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253764|ref|ZP_07535618.1| hypothetical protein appser9_240 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256030|ref|ZP_07537818.1| hypothetical protein appser10_360 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258221|ref|ZP_07539964.1| hypothetical protein appser11_240 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260460|ref|ZP_07542155.1| hypothetical protein appser12_360 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|226709951|sp|B0BRG8|MRAZ_ACTPJ RecName: Full=Protein MraZ
 gi|165875568|gb|ABY68616.1| MraZ protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|302649261|gb|EFL79446.1| cell division protein MraZ [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302650476|gb|EFL80635.1| cell division protein MraZ [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306854255|gb|EFM86461.1| hypothetical protein appser1_240 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854420|gb|EFM86616.1| hypothetical protein appser2_20940 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858732|gb|EFM90791.1| hypothetical protein appser4_250 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860994|gb|EFM93000.1| hypothetical protein appser6_540 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306863248|gb|EFM95188.1| hypothetical protein appser9_240 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865452|gb|EFM97347.1| hypothetical protein appser10_360 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867681|gb|EFM99526.1| hypothetical protein appser11_240 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869863|gb|EFN01645.1| hypothetical protein appser12_360 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 152

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 63/132 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  ID+KGR+++P  +R  L ++    L C  D   P + +      E  EQK+
Sbjct: 1   MFRGVTSISIDNKGRIAIPTRYRAELREQHEGVLVCTVDIRQPCLLLYPLHEWETVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     ++  ++ G     +MD+ GRIL++  +R    +E ++  VG+ N F++W
Sbjct: 61  LALSNFDPMQRRIQRVMQGFATECEMDAAGRILLSPTLRQHAQLEQQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEES 134
             + ++    E 
Sbjct: 121 QDKQWQSQIAED 132


>gi|126649734|ref|ZP_01721970.1| hypothetical protein BB14905_16090 [Bacillus sp. B14905]
 gi|126593453|gb|EAZ87398.1| hypothetical protein BB14905_16090 [Bacillus sp. B14905]
          Length = 143

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L +  +             +     +     E+K+
Sbjct: 1   MFMGEYQHSVDAKGRLIVPAKFREALGEAFVVTRGL-----DNCLFGYPMNEWRKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +           +     G   +++D +GRI +   +     +  E   +G  N  ++W
Sbjct: 56  KDLPMTKKDTRAFARFFFSGATEVEIDKQGRINIPATLMQHAHLVKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
               +     ES   +  ++ +
Sbjct: 116 AKDAWEAYFSESEQSF-NEIAE 136


>gi|309809981|ref|ZP_07703829.1| protein MraZ [Lactobacillus iners SPIN 2503V10-D]
 gi|312871928|ref|ZP_07732010.1| protein MraZ [Lactobacillus iners LEAF 2062A-h1]
 gi|308169769|gb|EFO71814.1| protein MraZ [Lactobacillus iners SPIN 2503V10-D]
 gi|311092505|gb|EFQ50867.1| protein MraZ [Lactobacillus iners LEAF 2062A-h1]
          Length = 143

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  +          F       I        +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRDQIGDE-----IIFTRGMEGCIFGYPQSEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTQRSARKFTRLFYSGAMETEFDKQGRVNLTATLKEHADLIKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++K  +E+ + Y   + +
Sbjct: 116 SEDRWQKFADEADDNY-DDIAE 136


>gi|188532893|ref|YP_001906690.1| cell division protein MraZ [Erwinia tasmaniensis Et1/99]
 gi|226709980|sp|B2VDB1|MRAZ_ERWT9 RecName: Full=Protein MraZ
 gi|188027935|emb|CAO95792.1| Protein MraZ [Erwinia tasmaniensis Et1/99]
          Length = 152

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 3/143 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYREMLNEGSQGQMVCTIDLHQPCLLLYPLPEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD+ GRIL+ + +R    +  +V  VG+ N F+LW
Sbjct: 61  SRLSSMNPAERRVQRLLLGHASECQMDNAGRILLANTLRQQASLSKQVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+    ++ R +   +   K
Sbjct: 121 DEQTW---YQQVREDIDEERSSK 140


>gi|167630119|ref|YP_001680618.1| cell division mraz protein [Heliobacterium modesticaldum Ice1]
 gi|226709985|sp|B0TGB1|MRAZ_HELMI RecName: Full=Protein MraZ
 gi|167592859|gb|ABZ84607.1| cell division mraz protein [Heliobacterium modesticaldum Ice1]
          Length = 143

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P   R  L +  +             + V   +  +  E+K+
Sbjct: 1   MFMGEYQHAIDPKGRLFMPARLRESLGEAFVATKGL-----DGCLFVYPKEEWKRLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+   +R    +E +V  +G G   ++W
Sbjct: 56  KALPFTRADARAFQRFFFSGAGECEVDKQGRILVPAHLREHAALEKDVVIIGAGARVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + K  E++   Y  ++ +K
Sbjct: 116 SRERWSKYNEKAAPSY-EEVAEK 137


>gi|323480227|gb|ADX79666.1| MraZ family protein [Enterococcus faecalis 62]
          Length = 141

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 52/140 (37%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ VP  FR  L ++ +             +     +     E K+ E
Sbjct: 1   MGEYQHNIDAKGRLIVPSKFREELGEKFVVTRGM-----DGCLFGYPLNEWSQLEAKLQE 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A       +      ++D +GRI +   +R    +E     +G  N  ++W+ 
Sbjct: 56  MPLAKKDARTFVRFFYSAATECEIDKQGRINIPANLRTHASLEKGCVVIGVSNRIEIWSD 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
           + +    +E+   +  +L +
Sbjct: 116 ERWHAFSDEAEENF-DELAE 134


>gi|104773819|ref|YP_618799.1| cell division protein MraZ [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513826|ref|YP_812732.1| cell division protein MraZ [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300811356|ref|ZP_07091853.1| protein MraZ [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|122275404|sp|Q04B78|MRAZ_LACDB RecName: Full=Protein MraZ
 gi|122397264|sp|Q1GAU1|MRAZ_LACDA RecName: Full=Protein MraZ
 gi|103422900|emb|CAI97562.1| Cell division protein MraZ [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116093141|gb|ABJ58294.1| hypothetical protein, MraZ [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300497720|gb|EFK32745.1| protein MraZ [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|325125483|gb|ADY84813.1| Protein mraZ [Lactobacillus delbrueckii subsp. bulgaricus 2038]
          Length = 143

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P   R  +    +             I           E K+
Sbjct: 1   MFMGEYQHNLDAKGRLIIPAKLREQIGPAMVLTRGM-----EGCIFGYPLTEWAKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A   + + + G +  + D +GRI ++  ++   G+  E   VG  N  ++W
Sbjct: 56  AKLPLTKKNARSFTRMFYSGAMEGEFDKQGRINLSPTLKKHAGLVKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             + + +  +E+   Y  ++ +
Sbjct: 116 AKERWEEYSDEANESY-DEIAE 136


>gi|2624082|emb|CAA74238.1| yllB [Enterococcus hirae]
          Length = 148

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S F+      ID+KGR+ VP   R  L ++ +             +           E K
Sbjct: 5   SMFMGEFRHNIDTKGRMIVPSKLREELGEQFVLTRGL-----DGCLFGYPMKEWANLETK 59

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +       A       +      ++D +GRI +   +R +  +  E   +G  N  ++
Sbjct: 60  LNDMPLAKKDARTFVRFFYSAATECELDKQGRINIPSTLRNYAALTKECVVIGVSNRIEI 119

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   +++  E +   +  ++ +
Sbjct: 120 WDEARWQEFSEVAAENF-DEIAE 141


>gi|239996440|ref|ZP_04716964.1| cell division protein MraZ [Alteromonas macleodii ATCC 27126]
 gi|332142433|ref|YP_004428171.1| cell division protein MraZ [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552455|gb|AEA99173.1| cell division protein MraZ [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 152

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L   C   L C  D     + +      E  E K+
Sbjct: 1   MFRGANAINLDTKGRLAIPTKYRQSLLDDCQGQLVCTVDTQQSCLLLYPLPEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +       +L  L+ G     +MD  GRIL+   +R F  +  EV  VG+ N F++W
Sbjct: 61  SKLSSMIPAERRLQRLLLGYASEGEMDKSGRILVPTPLRSFAKLSKEVMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCR---QLLQK 145
           +   + +  E   +   +   +L ++
Sbjct: 121 DADIWAQQVEADIDTERKGEFELTER 146


>gi|291087790|ref|ZP_06347490.2| MraZ protein [Clostridium sp. M62/1]
 gi|291073920|gb|EFE11284.1| MraZ protein [Clostridium sp. M62/1]
          Length = 164

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  ID+KGR+ +P  FR  L    +             + V ++     FE+K+
Sbjct: 24  MFKGEYSHTIDAKGRLIMPSKFREQLGDEFVVTKGL-----DGCLFVYDNSEWTAFEEKL 78

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + +     G    ++D +GRIL+   +R F  +E EVT VG G+  ++W
Sbjct: 79  RALPLTNQNARKFTRFFLAGASDCEVDRQGRILIPAVLREFAHLEKEVTLVGVGSRIEIW 138

Query: 123 NPQTFRKLQE-ESRNEYCRQL 142
           N   + +    +   +    +
Sbjct: 139 NRALWEEKNVYDDMEDIAENM 159


>gi|302191139|ref|ZP_07267393.1| cell division protein MraZ [Lactobacillus iners AB-1]
 gi|309803091|ref|ZP_07697188.1| protein MraZ [Lactobacillus iners LactinV 11V1-d]
 gi|309804776|ref|ZP_07698840.1| protein MraZ [Lactobacillus iners LactinV 09V1-c]
 gi|309806302|ref|ZP_07700315.1| protein MraZ [Lactobacillus iners LactinV 03V1-b]
 gi|312871668|ref|ZP_07731760.1| protein MraZ [Lactobacillus iners LEAF 3008A-a]
 gi|312873206|ref|ZP_07733262.1| protein MraZ [Lactobacillus iners LEAF 2052A-d]
 gi|312874581|ref|ZP_07734605.1| protein MraZ [Lactobacillus iners LEAF 2053A-b]
 gi|325911734|ref|ZP_08174141.1| protein MraZ [Lactobacillus iners UPII 143-D]
 gi|325912965|ref|ZP_08175338.1| protein MraZ [Lactobacillus iners UPII 60-B]
 gi|329921138|ref|ZP_08277661.1| protein MraZ [Lactobacillus iners SPIN 1401G]
 gi|308164599|gb|EFO66849.1| protein MraZ [Lactobacillus iners LactinV 11V1-d]
 gi|308165886|gb|EFO68105.1| protein MraZ [Lactobacillus iners LactinV 09V1-c]
 gi|308167286|gb|EFO69452.1| protein MraZ [Lactobacillus iners LactinV 03V1-b]
 gi|311089811|gb|EFQ48231.1| protein MraZ [Lactobacillus iners LEAF 2053A-b]
 gi|311091217|gb|EFQ49605.1| protein MraZ [Lactobacillus iners LEAF 2052A-d]
 gi|311092893|gb|EFQ51245.1| protein MraZ [Lactobacillus iners LEAF 3008A-a]
 gi|325476500|gb|EGC79659.1| protein MraZ [Lactobacillus iners UPII 143-D]
 gi|325477645|gb|EGC80784.1| protein MraZ [Lactobacillus iners UPII 60-B]
 gi|328935045|gb|EGG31534.1| protein MraZ [Lactobacillus iners SPIN 1401G]
          Length = 143

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  +          F       I        +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRDQIGDE-----IIFTRGMEGCIFGYPQAEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTQRSARKFTRLFYSGAMETEFDKQGRVNLTATLKEHADLIKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++K  +E+ + Y   + +
Sbjct: 116 SEDRWQKFADEADDNY-DDIAE 136


>gi|238650665|ref|YP_002916518.1| cell division protein MraZ [Rickettsia peacockii str. Rustic]
 gi|259509663|sp|C4K1L9|MRAZ_RICPU RecName: Full=Protein MraZ
 gi|238624763|gb|ACR47469.1| cell division protein MraZ [Rickettsia peacockii str. Rustic]
          Length = 149

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 63/136 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I V     +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
                +P+S + +    ++ G  + L  D EGR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MTETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 121 IWQPQNFEKYLNAAQK 136


>gi|257413359|ref|ZP_04742796.2| MraZ protein [Roseburia intestinalis L1-82]
 gi|257203799|gb|EEV02084.1| MraZ protein [Roseburia intestinalis L1-82]
          Length = 144

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 56/144 (38%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR  L    +             + V   +     E+K 
Sbjct: 1   MFMGEYNHTVDPKGRLIIPAKFREQLGDEFVVTKGL-----DGCLFVYTKEEWHNIEEKF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  S  A + S     G   L++D +GRIL+   +R +  ++ +V  VG  +  ++W
Sbjct: 56  RGISMTSKDARKFSRFFFAGAAALELDKQGRILLPPVLREYADLQKDVVLVGVLSRVEIW 115

Query: 123 NPQTF--RKLQEESRNEYCRQLLQ 144
           +   +      E+  +     + +
Sbjct: 116 DKGRWLENTYDEDEMDGIAEHMAE 139


>gi|323341697|ref|ZP_08081930.1| cell division protein MraZ [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464122|gb|EFY09315.1| cell division protein MraZ [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 150

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 22/143 (15%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S F+      ID+KGR+ VP  FR  L +  I   +         +++   +  +   + 
Sbjct: 8   SMFIGEYQHNIDTKGRIIVPAKFREELGEAMIVTRWL-----DGCLALYTLEQWQQVYEN 62

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +      +    + ++        +DS+GRI +   +     +      VG  ++ ++
Sbjct: 63  LKKLPSTKREVRMYTHMIMSKAAECDLDSQGRIRIPAHLTQEAKLTKNCVVVGVSDHVEI 122

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   +    E +   +  ++ +
Sbjct: 123 WDQTRWTDYCEAASENF-EEIAE 144


>gi|154685932|ref|YP_001421093.1| cell division protein MraZ [Bacillus amyloliquefaciens FZB42]
 gi|167011860|sp|A7Z4D6|MRAZ_BACA2 RecName: Full=Protein MraZ
 gi|154351783|gb|ABS73862.1| YllB [Bacillus amyloliquefaciens FZB42]
          Length = 143

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ VP  FR  L ++ +             +     +  +  E+K+
Sbjct: 1   MFMGEYRHTVDAKGRMIVPAKFREGLGEQFVLTRGL-----DQCLFGYPMNEWKLIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E E   +G  N  +LW
Sbjct: 56  KALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +  EE  + +  
Sbjct: 116 SKVIWEQYTEEQEDSFAE 133


>gi|313123435|ref|YP_004033694.1| protein mraz [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gi|312279998|gb|ADQ60717.1| Protein mraZ [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gi|325684345|gb|EGD26514.1| cell division protein MraZ [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 143

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P   R  +    +             I           E K+
Sbjct: 1   MFMGEYQHNLDAKGRLIIPAKLREQIGPAMVLTRGM-----EGCIFGYPLTEWAKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A   + + + G +  + D +GRI ++  ++   G+  E   VG  N  ++W
Sbjct: 56  AKLPLTKKNARSFTRMFYSGAMEGEFDRQGRINLSPTLKKHAGLVKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             + + +  +E+   Y  ++ +
Sbjct: 116 AKERWEEYSDEANESY-DEIAE 136


>gi|327441163|dbj|BAK17528.1| uncharacterized protein [Solibacillus silvestris StLB046]
          Length = 143

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L +  +             I     D     E K+
Sbjct: 1   MFMGEYQHSIDAKGRMIVPAKFRESLGEHFVITRGL-----DQCIFGYPMDEWRKLEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A   +     G   +++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  KDLPMTKKDARAFARFFFSGATEVEVDKQGRINIPSTLIGYANLEKECVILGVSSKIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             +++++  E+S   +  ++ +
Sbjct: 116 AKESWQQYFEQSAESF-DEIAE 136


>gi|304404000|ref|ZP_07385662.1| MraZ protein [Paenibacillus curdlanolyticus YK9]
 gi|304346978|gb|EFM12810.1| MraZ protein [Paenibacillus curdlanolyticus YK9]
          Length = 145

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L           +      + V   +     EQK+
Sbjct: 1   MFMGEHQHSIDDKGRLIIPSKFRESLGD----TFIVTRGL-DNCLFVYPRNEWSVLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A  ++     G    ++D +GR+ +   +  +  ++ E   +G  +  ++W
Sbjct: 56  KALPLMKSDARAITRFFFSGATECELDKQGRVNLPKHLCEYAKLDKECVVLGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + +T+    E+S   +  ++ +K
Sbjct: 116 SKETWAGYYEQSEEAF-NEIAEK 137


>gi|309812643|ref|ZP_07706387.1| protein MraZ [Dermacoccus sp. Ellin185]
 gi|308433338|gb|EFP57226.1| protein MraZ [Dermacoccus sp. Ellin185]
          Length = 143

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 53/142 (37%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR   A      L   +      + V   +  E     +
Sbjct: 1   MFLGTHTPRLDDKGRMILPAKFREKFAA----GLVMTRG-QERCLYVFPMNEFERIAAAM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S        ++  G      D +GR+ +   +R + G+  E T +G GN  ++W
Sbjct: 56  NTTPVTSRAVRDYQRVLLSGASDEIPDKQGRVTIPPLLREYAGLSKECTVIGAGNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +      +   +  Q  +
Sbjct: 116 DTQAWNDYLAGAEQPFSEQAEE 137


>gi|313901511|ref|ZP_07834959.1| MraZ protein [Thermaerobacter subterraneus DSM 13965]
 gi|313468224|gb|EFR63690.1| MraZ protein [Thermaerobacter subterraneus DSM 13965]
          Length = 143

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D KGR+ VP   R  L +     L   +      + V         E K+
Sbjct: 1   MLIGEYRHTVDDKGRLFVPARLRDELGEP----LVMTRGL-DQCLFVFPPAEWRNLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A     ++  G      D +GRIL+   +R + GI+ E   +G GN  ++W
Sbjct: 56  RALPLAQSSARAFVRMLLSGACECVPDKQGRILLPQTLREYAGIDREAVLIGVGNRMEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + +  EE+   Y R + ++
Sbjct: 116 SAERWTRYVEEASEAYSR-IAEQ 137


>gi|308069890|ref|YP_003871495.1| protein mraZ [Paenibacillus polymyxa E681]
 gi|310642997|ref|YP_003947755.1| protein mraz [Paenibacillus polymyxa SC2]
 gi|305859169|gb|ADM70957.1| Protein mraZ [Paenibacillus polymyxa E681]
 gi|309247947|gb|ADO57514.1| Protein mraZ [Paenibacillus polymyxa SC2]
          Length = 145

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR++VP  FR +L    +             + V   D     E+K+
Sbjct: 1   MFMGEFQHSIDEKGRLTVPAKFRELLGASFVVTRGL-----DQCLFVYPMDEWAVMEKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +  E   +G     ++W
Sbjct: 56  KALPLMKADARAFTRFFFSGATECELDKQGRVNLPGNLCEYAKLTKECVVLGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +  T+ +   +S   +   + +K
Sbjct: 116 SKHTWEQYFNQSEEAFND-IAEK 137


>gi|300715299|ref|YP_003740102.1| protein MraZ [Erwinia billingiae Eb661]
 gi|299061135|emb|CAX58242.1| Protein MraZ [Erwinia billingiae Eb661]
          Length = 152

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 64/146 (43%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R  L       + C  D     + +      E  E+K+
Sbjct: 1   MFRGATLVNLDSKGRLAVPTRYRETLIGESQGQMVCTIDLHQACLLLYTLPEWEIIERKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +    ++  L+ G     +MD+ GR+L+   +R    +  EV  VG+ N F+LW
Sbjct: 61  ARLSSMNPAERRVQRLLLGHASECQMDNAGRLLVATTLRQHANLTKEVMLVGQFNKFELW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           + QT+ +   E   +       L ++
Sbjct: 121 DEQTWYQQVREDIDAEQSTQEPLSER 146


>gi|256825485|ref|YP_003149445.1| mraZ protein [Kytococcus sedentarius DSM 20547]
 gi|256688878|gb|ACV06680.1| mraZ protein [Kytococcus sedentarius DSM 20547]
          Length = 143

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 53/142 (37%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  +R  LA      L   +      + V      E     +
Sbjct: 1   MFLGTHTPRLDEKGRLFLPAKYRDKLAH----GLVITRG-QERCLYVFPMAEFERIAAAM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S        +   G      D +GRI++   +R + G+  E T +G GN  ++W
Sbjct: 56  QSTPVSSKAVRDFQRVFLSGASDEVPDKQGRIVIPPTLREYAGLSRECTVIGTGNRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +    E +   +  Q  +
Sbjct: 116 DSAAWESYLESTEQSFSEQSEE 137


>gi|147678205|ref|YP_001212420.1| hypothetical protein PTH_1870 [Pelotomaculum thermopropionicum SI]
 gi|189028626|sp|A5D114|MRAZ_PELTS RecName: Full=Protein MraZ
 gi|146274302|dbj|BAF60051.1| Uncharacterized protein conserved in bacteria [Pelotomaculum
           thermopropionicum SI]
          Length = 145

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L           +      +        E  EQK+
Sbjct: 1   MFMGEHQHSIDPKGRLFIPARFREGLG----NRFVLTKGL-DGCLFAYPLPEWEALEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G +  + D +GRIL+   +R +  +E E   +G  +  ++W
Sbjct: 56  KSLPFTRGDARAFVRFFFSGAVECEADKQGRILIPLNLREYARLEKEAVIIGVSSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
               +   + ++ + Y  ++ +K
Sbjct: 116 AKDQWEHYKGQAASSY-EEIAEK 137


>gi|220927928|ref|YP_002504837.1| cell division protein MraZ [Clostridium cellulolyticum H10]
 gi|254813273|sp|B8I6G5|MRAZ_CLOCE RecName: Full=Protein MraZ
 gi|219998256|gb|ACL74857.1| MraZ protein [Clostridium cellulolyticum H10]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 8/144 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID KGR  VP  FR  L ++ I             +   +S+     E K+
Sbjct: 1   MFYGEYQHTIDPKGRAIVPSKFREGLGEKFILTKGL-----DGCLFAYSSEEWTSLENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G    ++D +GRIL+   +R +  +E +   +G  +  ++W
Sbjct: 56  KSLPFTDKDVRAFIRFFFSGATECEVDKQGRILIPQNLREYAALEKDTYIIGVSSRVEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLL 143
           +   +     +   S ++   ++ 
Sbjct: 116 DKTAWEAYNSDENISADKIAEKMA 139


>gi|332799085|ref|YP_004460584.1| Protein mraZ [Tepidanaerobacter sp. Re1]
 gi|332696820|gb|AEE91277.1| Protein mraZ [Tepidanaerobacter sp. Re1]
          Length = 142

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR +L Q  +             + V  +      EQK+
Sbjct: 1   MFMGQFQHSLDQKGRLIIPSKFREMLGQSFVLTKGL-----DSCLFVYPNSEWIVLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G +  +MD +GRIL+   +R    I+ +V  +G  N  ++W
Sbjct: 56  KALPFTQKDARAFIRFFFAGAVEAEMDKQGRILIPVQLREHAHIDKDVVVLGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +     ++   Y   + +K
Sbjct: 116 SQEQWESYNAKAALSY-EDIAEK 137


>gi|15892781|ref|NP_360495.1| cell division protein MraZ [Rickettsia conorii str. Malish 7]
 gi|229586902|ref|YP_002845403.1| cell division protein MraZ [Rickettsia africae ESF-5]
 gi|20139036|sp|Q92HB3|MRAZ_RICCN RecName: Full=Protein MraZ
 gi|259509662|sp|C3PP00|MRAZ_RICAE RecName: Full=Protein MraZ
 gi|15619961|gb|AAL03396.1| unknown [Rickettsia conorii str. Malish 7]
 gi|228021952|gb|ACP53660.1| MraZ protein [Rickettsia africae ESF-5]
          Length = 149

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 64/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I V     +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 121 IWQPQNFEKYLNAAQK 136


>gi|120437111|ref|YP_862797.1| MraZ protein [Gramella forsetii KT0803]
 gi|167012244|sp|A0M535|MRAZ_GRAFK RecName: Full=Protein MraZ
 gi|117579261|emb|CAL67730.1| MraZ protein [Gramella forsetii KT0803]
          Length = 155

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M   +     K+D+KGR+ VP   +  LA          +  F   + +   +      +
Sbjct: 1   MINLIGTYECKVDAKGRLMVPSALKKQLAPMMQDGFVIKRAVFQNCLELYPMEEWNVLMK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++   N F  + N        G   +++D+ GR+L+   +  F GIE E+      N  +
Sbjct: 61  RMNGLNRFKKKNNDFIRRFTAGVKTVEVDTNGRLLIPKDLVGFAGIEKEIVLSSAINIVE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   + +  E+S +++   L ++
Sbjct: 121 IWDKDKYEQTLEDSSDDFAD-LAEE 144


>gi|291525277|emb|CBK90864.1| mraZ protein [Eubacterium rectale DSM 17629]
 gi|291529265|emb|CBK94851.1| mraZ protein [Eubacterium rectale M104/1]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L    +             + V +++     E+ +
Sbjct: 1   MFMGEYNHSIDAKGRMIVPAKFREQLGNEFVVTKGL-----DGCLFVYSNEEWHRIEENL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A +       G    ++D +GRIL+   +R + GI+ EV  VG  +  ++W
Sbjct: 56  RDKPLTSREARKFMRFFFAGAATCEVDKQGRILLPANLREYAGIDKEVVSVGVYSRVEIW 115

Query: 123 NPQTFRKLQE-ESRNEYCRQLLQ 144
           +   + +  + +  +E    + +
Sbjct: 116 SKDRYLENSDFDDMDEIADHMAE 138


>gi|87122636|ref|ZP_01078513.1| hypothetical protein MED121_20376 [Marinomonas sp. MED121]
 gi|86162094|gb|EAQ63382.1| hypothetical protein MED121_20376 [Marinomonas sp. MED121]
          Length = 153

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 59/133 (44%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +D+KGR+S+P   R  L Q     +    D     + +      E  + 
Sbjct: 1   MGVFRGIHQVSVDAKGRMSLPTRLRDELLQYEEPSVVVTIDPSARCLLMYPLPEWELIQA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ +   F  QA +L  L+ G    L++D  GRIL+   +R F  ++ +   +G+G   +
Sbjct: 61  KLDKLPSFQPQARRLQRLLVGHATDLEIDKAGRILLPAPLRDFAHLDKKAALLGQGKKIE 120

Query: 121 LWNPQTFRKLQEE 133
           +W+   +   ++E
Sbjct: 121 IWSQTEWEAQRDE 133


>gi|314933354|ref|ZP_07840719.1| MraZ protein [Staphylococcus caprae C87]
 gi|313653504|gb|EFS17261.1| MraZ protein [Staphylococcus caprae C87]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ VP  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIVPSKFRNDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|121535928|ref|ZP_01667724.1| MraZ protein [Thermosinus carboxydivorans Nor1]
 gi|121305499|gb|EAX46445.1| MraZ protein [Thermosinus carboxydivorans Nor1]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ +P  FR  L  R I             + V   +     E K+
Sbjct: 1   MLMGEYLHTIDAKGRLILPAKFRAELGDRLIATKGL-----DTCVFVYGLEEWAILENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A         G   L+ D +GRIL+ + +R +  ++ +V  +G  N  ++W
Sbjct: 56  KQLPLAKPEARAFVRFFFAGAAELECDKQGRILLPNNLREYAQLDKDVVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    ++       Q+ ++
Sbjct: 116 SKKIWDDYNDQLGPTVA-QMAEE 137


>gi|295425109|ref|ZP_06817814.1| cell division protein MraZ [Lactobacillus amylolyticus DSM 11664]
 gi|295065168|gb|EFG56071.1| cell division protein MraZ [Lactobacillus amylolyticus DSM 11664]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P   R  +  + +             I     D+    E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKLRNQIGDKMVFTRGM-----EGCIFGYTLDVWHEIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+             L + G +  + D +GR+ +T  ++   G+E E   VG  N  ++W
Sbjct: 56  AQLPLTKRNVRNFMRLFYSGAMESEFDKQGRVNLTKTLKQHAGLEKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    + +   Y   + +
Sbjct: 116 SKERWEDFSQSANENY-DDIAE 136


>gi|223984256|ref|ZP_03634402.1| hypothetical protein HOLDEFILI_01696 [Holdemania filiformis DSM
           12042]
 gi|223963787|gb|EEF68153.1| hypothetical protein HOLDEFILI_01696 [Holdemania filiformis DSM
           12042]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 56/145 (38%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L  R +             +        +   +++
Sbjct: 1   MFMGEYRHNIDAKGRMIIPARFRDELGNRFVVTRGL-----DGCLRTYTMAQWDAVFEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +      ++       ++DS+GRIL+   +   +GIE E   VG  ++ ++W
Sbjct: 56  KRLPSTKRETRMYIHMLTSKASECELDSQGRILLPAALITESGIEKECVVVGVADHVEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
             + +    +E+     +   QL +
Sbjct: 116 AKERWDNYYDEASASFEDVAEQLTE 140


>gi|53729127|ref|ZP_00134092.2| COG2001: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207497|ref|YP_001052722.1| cell division protein MraZ [Actinobacillus pleuropneumoniae L20]
 gi|190149278|ref|YP_001967803.1| hypothetical protein APP7_0009 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307262589|ref|ZP_07544220.1| hypothetical protein appser13_190 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|167011853|sp|A3MY81|MRAZ_ACTP2 RecName: Full=Protein MraZ
 gi|226709950|sp|B3GZJ9|MRAZ_ACTP7 RecName: Full=Protein MraZ
 gi|126096289|gb|ABN73117.1| hypothetical protein APL_0009 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189914409|gb|ACE60661.1| hypothetical protein APP7_0009 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306872087|gb|EFN03800.1| hypothetical protein appser13_190 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 152

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 63/132 (47%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  ID+KGR+++P  +R  L ++    L C  D   P + +      E  EQK+
Sbjct: 1   MFRGVTSISIDNKGRIAIPTRYRAELREQHEGVLVCTVDIRQPCLLLYPLHEWETVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     ++  ++ G     +MD+ GRIL++  +R    +E ++  VG+ N F++W
Sbjct: 61  LALSNFEPMQRRIQRVMQGFATECEMDAAGRILLSPTLRQHAQLEQQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEES 134
             + ++    E 
Sbjct: 121 QDKQWQSQIAED 132


>gi|258546143|ref|ZP_05706377.1| cell division protein MraZ [Cardiobacterium hominis ATCC 15826]
 gi|258518568|gb|EEV87427.1| cell division protein MraZ [Cardiobacterium hominis ATCC 15826]
          Length = 151

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 1/138 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP   R    +     L    +     + +      +  E+K+
Sbjct: 1   MFRGIYHISLDTKGRLSVPAKVRAQFEEESDGVLILTAELENQ-LLLYTLPEWQKVEEKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  Q  +L  L  G     ++DS GRIL+   +R   G++ +V   G GN F+LW
Sbjct: 60  VKLPSFDPQIRRLKRLYMGNAAECELDSTGRILIPPPLRQRAGLDKKVVMSGMGNKFELW 119

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +  +  E       
Sbjct: 120 SQEAWDAINAEDAEALRA 137


>gi|297571244|ref|YP_003697018.1| MraZ protein [Arcanobacterium haemolyticum DSM 20595]
 gi|296931591|gb|ADH92399.1| MraZ protein [Arcanobacterium haemolyticum DSM 20595]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 61/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D KGR+ +P  FR  LA      L   +      + V      E   +++
Sbjct: 1   MFLGTYEPRLDDKGRLILPAKFRDQLA----NGLVVTRG-QEHCLYVFPFAEFEKVLERL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A   + +   G      D +GRI +   +R + G++ E+  +G G++ ++W
Sbjct: 56  RQAPMTSKEARTYTRVFLSGANDQVPDKQGRITLPVALRSYAGLDRELAVIGSGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +      S +E+  +  +
Sbjct: 116 DAEAWNTFLTTSEDEFADREEE 137


>gi|16801214|ref|NP_471482.1| cell division protein MraZ [Listeria innocua Clip11262]
 gi|116873472|ref|YP_850253.1| cell division protein MraZ [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|20139024|sp|Q929X5|MRAZ_LISIN RecName: Full=Protein MraZ
 gi|123458601|sp|A0AKE2|MRAZ_LISW6 RecName: Full=Protein MraZ
 gi|16414662|emb|CAC97378.1| lin2148 [Listeria innocua Clip11262]
 gi|116742350|emb|CAK21474.1| MraZ protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|313617970|gb|EFR90132.1| MraZ protein [Listeria innocua FSL S4-378]
 gi|313622990|gb|EFR93286.1| MraZ protein [Listeria innocua FSL J1-023]
          Length = 143

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +  +  E+   +   L +
Sbjct: 116 SKSEWDNVFNEAEESFAD-LAE 136


>gi|226943444|ref|YP_002798517.1| cell division protein MraZ [Azotobacter vinelandii DJ]
 gi|259509646|sp|C1DQ90|MRAZ_AZOVD RecName: Full=Protein MraZ
 gi|226718371|gb|ACO77542.1| MraZ-family protein [Azotobacter vinelandii DJ]
          Length = 152

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 57/139 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  R    L    D   P + +      E  E K+
Sbjct: 1   MFRGANAVSLDAKGRISMPARYREELMARSAGQLIVTIDAMDPCLCIYPLPEWELIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      +  +L  L+ G  + L++D  GR L+   +R    ++     VG+ N FQLW
Sbjct: 61  RELPSLREETRRLQRLLIGNAVDLELDGSGRFLIPPRLREHASLDKHAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           N   +  +         +Q
Sbjct: 121 NEDAWIAIANADLAAIKQQ 139


>gi|157828718|ref|YP_001494960.1| cell division protein MraZ [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933444|ref|YP_001650233.1| cell division protein MraZ [Rickettsia rickettsii str. Iowa]
 gi|167012270|sp|A8GSS7|MRAZ_RICRS RecName: Full=Protein MraZ
 gi|189028630|sp|B0BYA1|MRAZ_RICRO RecName: Full=Protein MraZ
 gi|157801199|gb|ABV76452.1| hypothetical protein A1G_04760 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908531|gb|ABY72827.1| cell division protein [Rickettsia rickettsii str. Iowa]
          Length = 149

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 64/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I V     +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGRI++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLSFDGEGRIILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 121 IWQPQNFEKYLNAAQK 136


>gi|58038634|ref|YP_190598.1| cell division protein MraZ [Gluconobacter oxydans 621H]
 gi|68565672|sp|Q5FUK4|MRAZ_GLUOX RecName: Full=Protein MraZ
 gi|58001048|gb|AAW59942.1| MraZ protein [Gluconobacter oxydans 621H]
          Length = 164

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD---LYCFQDFFFPAISVGNSDLLEY 57
           MS FL     + D+KGRVS+P  FR  L  +       +        P I          
Sbjct: 1   MSMFLGTHQNRFDAKGRVSIPASFRAALKSQAQPGDPLVILRPSHLHPCIEGWTVGAFAS 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
               + EY+PFS     L+  ++     L  D EGRI++ + +R    + +EV+F+G G 
Sbjct: 61  LATPLDEYDPFSEDHEDLAASLYADAYPLDSDKEGRIILPENLRTHAALTDEVSFMGLGR 120

Query: 118 YFQLWNPQ 125
            FQ+WNP+
Sbjct: 121 TFQIWNPE 128


>gi|289435383|ref|YP_003465255.1| MraZ protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289171627|emb|CBH28173.1| MraZ protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313632483|gb|EFR99499.1| MraZ protein [Listeria seeligeri FSL N1-067]
 gi|313637017|gb|EFS02590.1| MraZ protein [Listeria seeligeri FSL S4-171]
          Length = 143

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +  +  E+   +   L +
Sbjct: 116 SKSEWEDVFNEAEETFAD-LAE 136


>gi|153207194|ref|ZP_01945973.1| mraZ protein [Coxiella burnetii 'MSU Goat Q177']
 gi|161831113|ref|YP_001596083.1| cell division protein MraZ [Coxiella burnetii RSA 331]
 gi|165918405|ref|ZP_02218491.1| mraZ protein [Coxiella burnetii RSA 334]
 gi|51316410|sp|Q83F36|MRAZ_COXBU RecName: Full=Protein MraZ
 gi|189028616|sp|A9KET3|MRAZ_COXBN RecName: Full=Protein MraZ
 gi|189028617|sp|A9NA24|MRAZ_COXBR RecName: Full=Protein MraZ
 gi|120576855|gb|EAX33479.1| mraZ protein [Coxiella burnetii 'MSU Goat Q177']
 gi|161762980|gb|ABX78622.1| mraZ protein [Coxiella burnetii RSA 331]
 gi|165917911|gb|EDR36515.1| mraZ protein [Coxiella burnetii RSA 334]
          Length = 152

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 4/143 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  +       L    D     + +      E  EQK+
Sbjct: 1   MFRGLNPIAVDAKGRIAIPARYREPIESEADGILVVTIDTEERCLLIYTHPQWEQIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                +   + ++  L+ G    +++D  GRIL+   +R + G+ + V  VG+G  F+LW
Sbjct: 61  ENLPSYHPASRRIQRLLIGHATEVELDRSGRILIPPVLREYAGLGSMVMLVGQGKKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
               +      +R ++  + L K
Sbjct: 121 GKSQWET----AREDWLAEELPK 139


>gi|157803593|ref|YP_001492142.1| cell division protein MraZ [Rickettsia canadensis str. McKiel]
 gi|167012269|sp|A8EYC4|MRAZ_RICCK RecName: Full=Protein MraZ
 gi|157784856|gb|ABV73357.1| hypothetical protein A1E_02060 [Rickettsia canadensis str. McKiel]
          Length = 149

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/143 (28%), Positives = 66/143 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L Q     +  +       I       +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGQELFNGVIAYPSIRNKCIEACGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  DSEGR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETIIFGEALQLSFDSEGRVMLPQSLMQHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W PQ F K    ++     + L
Sbjct: 121 IWQPQNFEKYLNSAQKIAYEKRL 143


>gi|299821550|ref|ZP_07053438.1| cell division protein MraZ [Listeria grayi DSM 20601]
 gi|299817215|gb|EFI84451.1| cell division protein MraZ [Listeria grayi DSM 20601]
          Length = 143

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 47/138 (34%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L +  +             +        +  E K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRESLGESFVITRGL-----DKCLFAYPQAEWDKLENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  N  ++W
Sbjct: 56  QNLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     E+   +  
Sbjct: 116 SKPEWETTFSEAEESFAD 133


>gi|52425731|ref|YP_088868.1| cell division protein MraZ [Mannheimia succiniciproducens MBEL55E]
 gi|90103493|sp|Q65RX7|MRAZ_MANSM RecName: Full=Protein MraZ
 gi|52307783|gb|AAU38283.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 152

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 58/134 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       L C  D   P + +      E  EQK+
Sbjct: 1   MFRGAQAINLDTKGRIAIPTRYRPELLAENQGQLICTVDIRQPCLLLYPLKEWEIIEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F      +  ++ G     ++DS GRIL++  +R    +E  +  VG+ N F++W
Sbjct: 61  CQLANFDPAQRSVQRVMSGYATECELDSAGRILLSAPLRQRAKLEKTIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   ++   E    
Sbjct: 121 SETEWQAQIERDLE 134


>gi|332991931|gb|AEF01986.1| cell division protein MraZ [Alteromonas sp. SN2]
          Length = 152

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L   C   L C  D     + +      E  E K+
Sbjct: 1   MFRGANAINLDTKGRLAIPTKYRQSLLDDCNGQLVCTVDTQQSCLLLYPLPEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +++       ++  L+ G     +MD  GRIL+   +R+   +  EV  VG+ N F++W
Sbjct: 61  IKFSSMIPAERRMQRLLLGHATEGEMDKSGRILLPTPLRIHAHLSKEVMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCR---QLLQK 145
           + + + +  E   +   +   +L ++
Sbjct: 121 DAEVWAEQVELDMDTERKGEFELTER 146


>gi|322513874|ref|ZP_08066953.1| cell division protein MraZ [Actinobacillus ureae ATCC 25976]
 gi|322120273|gb|EFX92220.1| cell division protein MraZ [Actinobacillus ureae ATCC 25976]
          Length = 157

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 63/133 (47%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F    +  IDSKGR+++P  +R  L ++    L C  D   P + +      E  EQK
Sbjct: 5   KMFRGAASISIDSKGRIAIPTRYRAELREKHEGILVCTVDIRQPCLLLYPLHEWEVVEQK 64

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +   + F     ++  ++ G     +MD+ GRIL++  +R    +E ++  VG+ N F++
Sbjct: 65  LLALSNFDPMQRRIQRVMQGFATECEMDASGRILLSPTLRQHVQLEQQIMLVGQLNKFEI 124

Query: 122 WNPQTFRKLQEES 134
           W  + ++    E 
Sbjct: 125 WQEKQWQSQIAED 137


>gi|220931743|ref|YP_002508651.1| MraZ protein [Halothermothrix orenii H 168]
 gi|254813282|sp|B8CWI7|MRAZ_HALOH RecName: Full=Protein MraZ
 gi|219993053|gb|ACL69656.1| MraZ protein [Halothermothrix orenii H 168]
          Length = 143

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR+ L  + +             + V         E+K+
Sbjct: 1   MFMGEYKHNMDSKGRIIIPAKFRSELGDKFVATRGL-----DHCLFVYPMHEWSKLEKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S  A         G    + D +GRI +   +R +  ++ EV  +G  N  +LW
Sbjct: 56  TSLPITSKNARTFVRFFFSGATECEFDKQGRISIPSNLREYAELQKEVVIIGLANRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +    + +   Y  
Sbjct: 116 SSKRWGGYLDSAEESYEE 133


>gi|315304097|ref|ZP_07874498.1| MraZ protein [Listeria ivanovii FSL F6-596]
 gi|313627538|gb|EFR96270.1| MraZ protein [Listeria ivanovii FSL F6-596]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPTNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +  +  E+   +   L +
Sbjct: 116 SKSEWEDVFNEAEETFAD-LAE 136


>gi|78484903|ref|YP_390828.1| hypothetical protein Tcr_0558 [Thiomicrospira crunogena XCL-2]
 gi|78363189|gb|ABB41154.1| Protein of unknown function UPF0040 [Thiomicrospira crunogena
           XCL-2]
          Length = 176

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 65/139 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F    +  +D+KGR+++P  +R  +A+     L    D   P + +   D  E  E+
Sbjct: 25  MLFFRGINSINMDAKGRLAIPKRYRESIAEASENQLVATIDLHSPCLLIYTMDEWEVIER 84

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+        QA  +  L+ G    ++MD +GR+L+   +R    +E E   +G+GN F+
Sbjct: 85  KLMSLPNMDPQARLVQRLLLGHASEMEMDGQGRVLLPSLLREHAKLEKEAILLGQGNKFE 144

Query: 121 LWNPQTFRKLQEESRNEYC 139
           LW+ + +   + E  +   
Sbjct: 145 LWSQEAWDASRPEMLDSAS 163


>gi|210608683|ref|ZP_03287960.1| hypothetical protein CLONEX_00139 [Clostridium nexile DSM 1787]
 gi|210152940|gb|EEA83946.1| hypothetical protein CLONEX_00139 [Clostridium nexile DSM 1787]
          Length = 156

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S         ID+KGR+ +P  FR IL +  +             + +  ++  + FE+K
Sbjct: 11  SLLTGEFNHSIDAKGRLIIPSKFRDILGEDFVITKGL-----DGCLFLYPNNEWKIFEEK 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A   +    G  +   +D +GR+L++  +R F G+E EV  VG  +  ++
Sbjct: 66  LRTLPLTNKNARTFTRFFLGSAVDGGLDKQGRVLISSALRTFAGLEKEVVLVGVLDRVEI 125

Query: 122 WNPQTFRK---LQEESRNEYCRQLLQ 144
           W+   + +   + EE  +E   Q+ +
Sbjct: 126 WDKAKWDENNAVVEEDMDEIASQMEE 151


>gi|127514390|ref|YP_001095587.1| cell division protein MraZ [Shewanella loihica PV-4]
 gi|167012277|sp|A3QIN0|MRAZ_SHELP RecName: Full=Protein MraZ
 gi|126639685|gb|ABO25328.1| MraZ protein [Shewanella loihica PV-4]
          Length = 152

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 59/134 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L     + L    DF    + +   +  +  E K+
Sbjct: 1   MFRGASAINLDAKGRIAIPKRYRERLHVDFNSQLVITVDFDAACLLIYPLEAWKAIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  L+ G     ++DS GR+L+   +R +  ++     VG+ N F+LW
Sbjct: 61  LLLSDTQGPERAMKRLLLGYAHECELDSNGRLLLPPPLRQYANLDKHAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +++  E SR 
Sbjct: 121 DEAAWQQQIELSRE 134


>gi|297539601|ref|YP_003675370.1| MraZ protein [Methylotenera sp. 301]
 gi|297258948|gb|ADI30793.1| MraZ protein [Methylotenera sp. 301]
          Length = 148

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 1/135 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR++VP   R  L  +C  DL          + +      E  + K+
Sbjct: 1   MFRGATSLSLDAKGRLAVPTKHREALQLQCAGDLVLT-AHPHRCLLLYPQPAWEPIQAKM 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F  Q++ L  L+ G    + MDS GR+L++  +R F G++ EV  VG+G++F+LW
Sbjct: 60  MALSSFDKQSSALQRLLVGFAEDVSMDSAGRMLVSPVLRDFAGLDKEVMLVGQGSHFELW 119

Query: 123 NPQTFRKLQEESRNE 137
           N + +R    +   +
Sbjct: 120 NMEAWRAQLAQVMQD 134


>gi|254500149|ref|ZP_05112300.1| conserved domain protein [Labrenzia alexandrii DFL-11]
 gi|222436220|gb|EEE42899.1| conserved domain protein [Labrenzia alexandrii DFL-11]
          Length = 155

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/143 (30%), Positives = 77/143 (53%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+S+ T ++D+KGRVS+P  FR +LA+     LYC       A+  G + L+   + 
Sbjct: 1   MAGFVSHFTNRLDAKGRVSIPAPFRAVLARDGFEGLYCISSAHCRAVDAGGNQLVAEIQN 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +  ++   +   + L+  + G    +K+D +GR+ ++D IR   G+ + VTFVG    FQ
Sbjct: 61  RAQQFAKLTPDHDMLAAALFGASEIIKIDGDGRMTLSDMIRDHAGLSDTVTFVGMDYKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W P+ FR  + E++      L 
Sbjct: 121 IWEPEQFRGYRAEAQKRALAMLS 143


>gi|239947594|ref|ZP_04699347.1| protein MraZ [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921870|gb|EER21894.1| protein MraZ [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 149

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 63/136 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I       +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEACGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 121 IWQPQNFEKYLNSAQK 136


>gi|212635033|ref|YP_002311558.1| cell division protein MraZ [Shewanella piezotolerans WP3]
 gi|226710013|sp|B8CM47|MRAZ_SHEPW RecName: Full=Protein MraZ
 gi|212556517|gb|ACJ28971.1| Protein mraZ [Shewanella piezotolerans WP3]
          Length = 152

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P   R  L     + L    D   P + +      +    K+
Sbjct: 1   MFSGASAINLDAKGRIAMPKRHREPLHAHHNSQLVITVDIQSPCLLLYPVQEWQQIAVKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +        +  ++ G     ++D  GRIL+   +R +  +E     VG+ N F+LW
Sbjct: 61  SQLSDTQPAERAIKRMLLGYAHECELDGNGRILLPTPLRQYANLEKRAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   +++  EESR     +
Sbjct: 121 DEAAWQQQIEESRIAILNE 139


>gi|16804081|ref|NP_465566.1| cell division protein MraZ [Listeria monocytogenes EGD-e]
 gi|46908278|ref|YP_014667.1| cell division protein MraZ [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47097274|ref|ZP_00234833.1| mraZ protein [Listeria monocytogenes str. 1/2a F6854]
 gi|217963811|ref|YP_002349489.1| MraZ protein [Listeria monocytogenes HCC23]
 gi|224498508|ref|ZP_03666857.1| cell division protein MraZ [Listeria monocytogenes Finland 1988]
 gi|224501158|ref|ZP_03669465.1| cell division protein MraZ [Listeria monocytogenes FSL R2-561]
 gi|226224648|ref|YP_002758755.1| hypothetical protein Lm4b_02063 [Listeria monocytogenes Clip81459]
 gi|254826202|ref|ZP_05231203.1| protein mraZ [Listeria monocytogenes FSL J1-194]
 gi|254827070|ref|ZP_05231757.1| protein mraZ [Listeria monocytogenes FSL N3-165]
 gi|254831716|ref|ZP_05236371.1| cell division protein MraZ [Listeria monocytogenes 10403S]
 gi|254854021|ref|ZP_05243369.1| protein mraZ [Listeria monocytogenes FSL R2-503]
 gi|254899260|ref|ZP_05259184.1| cell division protein MraZ [Listeria monocytogenes J0161]
 gi|254912600|ref|ZP_05262612.1| protein mraZ [Listeria monocytogenes J2818]
 gi|254933470|ref|ZP_05266829.1| protein mraZ [Listeria monocytogenes HPB2262]
 gi|254936927|ref|ZP_05268624.1| protein mraZ [Listeria monocytogenes F6900]
 gi|255520500|ref|ZP_05387737.1| cell division protein MraZ [Listeria monocytogenes FSL J1-175]
 gi|284802489|ref|YP_003414354.1| cell division protein MraZ [Listeria monocytogenes 08-5578]
 gi|284995631|ref|YP_003417399.1| cell division protein MraZ [Listeria monocytogenes 08-5923]
 gi|290892189|ref|ZP_06555185.1| mraZ [Listeria monocytogenes FSL J2-071]
 gi|300765477|ref|ZP_07075458.1| hypothetical protein LMHG_12346 [Listeria monocytogenes FSL N1-017]
 gi|315283084|ref|ZP_07871352.1| MraZ protein [Listeria marthii FSL S4-120]
 gi|20138987|sp|Q8Y5L6|MRAZ_LISMO RecName: Full=Protein MraZ
 gi|51316262|sp|Q71XX1|MRAZ_LISMF RecName: Full=Protein MraZ
 gi|254813283|sp|B8DH87|MRAZ_LISMH RecName: Full=Protein MraZ
 gi|259509657|sp|C1KWZ5|MRAZ_LISMC RecName: Full=Protein MraZ
 gi|16411512|emb|CAD00120.1| lmo2042 [Listeria monocytogenes EGD-e]
 gi|46881549|gb|AAT04844.1| mraZ protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47014347|gb|EAL05321.1| mraZ protein [Listeria monocytogenes str. 1/2a F6854]
 gi|217333081|gb|ACK38875.1| MraZ protein [Listeria monocytogenes HCC23]
 gi|225877110|emb|CAS05822.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258599453|gb|EEW12778.1| protein mraZ [Listeria monocytogenes FSL N3-165]
 gi|258607413|gb|EEW20021.1| protein mraZ [Listeria monocytogenes FSL R2-503]
 gi|258609527|gb|EEW22135.1| protein mraZ [Listeria monocytogenes F6900]
 gi|284058051|gb|ADB68992.1| cell division protein MraZ [Listeria monocytogenes 08-5578]
 gi|284061098|gb|ADB72037.1| cell division protein MraZ [Listeria monocytogenes 08-5923]
 gi|290558312|gb|EFD91830.1| mraZ [Listeria monocytogenes FSL J2-071]
 gi|293585032|gb|EFF97064.1| protein mraZ [Listeria monocytogenes HPB2262]
 gi|293590592|gb|EFF98926.1| protein mraZ [Listeria monocytogenes J2818]
 gi|293595443|gb|EFG03204.1| protein mraZ [Listeria monocytogenes FSL J1-194]
 gi|300513788|gb|EFK40854.1| hypothetical protein LMHG_12346 [Listeria monocytogenes FSL N1-017]
 gi|307571616|emb|CAR84795.1| MraZ protein [Listeria monocytogenes L99]
 gi|313607743|gb|EFR83964.1| MraZ protein [Listeria monocytogenes FSL F2-208]
 gi|313613271|gb|EFR87147.1| MraZ protein [Listeria marthii FSL S4-120]
 gi|328466076|gb|EGF37249.1| cell division protein MraZ [Listeria monocytogenes 1816]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +  +  E+   +   L +
Sbjct: 116 SKSEWDDVFNEAEESFAD-LAE 136


>gi|293376041|ref|ZP_06622294.1| protein MraZ [Turicibacter sanguinis PC909]
 gi|325844618|ref|ZP_08168261.1| protein MraZ [Turicibacter sp. HGF1]
 gi|292645342|gb|EFF63399.1| protein MraZ [Turicibacter sanguinis PC909]
 gi|325489043|gb|EGC91430.1| protein MraZ [Turicibacter sp. HGF1]
          Length = 142

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L + C+             + +   +  +   +K+
Sbjct: 1   MFIGEFHHSIDAKGRLIMPAKFREQLNECCVITRGI-----DQCLFIYPIEEWKILLEKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A Q S     G    + D +GRI ++  +  + G+  +   +G  N  ++W
Sbjct: 56  NGLPVNRKDARQFSRFFLSGACECEFDKQGRINLSTPLMNYAGLSKDCVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
             + + +  + S +    
Sbjct: 116 EKEKWTQYFDFSVDSILD 133


>gi|325001097|ref|ZP_08122209.1| MraZ protein [Pseudonocardia sp. P1]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 59/142 (41%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + K+D KGR+++P  FR  L   C+             + V   D      +K+
Sbjct: 1   MFLGTYSPKLDDKGRLTLPAKFRDELRGGCMITK-----GQDHCLYVFTRDAFTEMARKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +  A      +  G      D +GRI +T  +R + G+  +   +G     ++W
Sbjct: 56  AAAPLTNESARVFQRNLFSGTDEQNPDGQGRIAITSELRRYAGLSKDCVVIGAFTRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +++ QE   +E+ +   +
Sbjct: 116 DAQAWQEYQERHEDEFAKAQDE 137


>gi|295696472|ref|YP_003589710.1| MraZ protein [Bacillus tusciae DSM 2912]
 gi|295412074|gb|ADG06566.1| MraZ protein [Bacillus tusciae DSM 2912]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 53/145 (36%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D KGR+++P  FR  L           +      +        E  E K+
Sbjct: 1   MFIGEFSHTVDDKGRLTMPAKFREGLG----PGFILTRGL-DRCLFAYPRKEWESVEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A         G    + D +GRIL+   +R +  +E +   +G  +  ++W
Sbjct: 56  KSLPVARPEARAFMRFFFSGATECEFDRQGRILIPGSLREYASLEKDCVIIGVSSRVEVW 115

Query: 123 NPQTFRKLQEESRNEY---CRQLLQ 144
             + +    ++++  +      L +
Sbjct: 116 AKEAWDAYFDKAQESFSGIAESLAE 140


>gi|209364228|ref|YP_001425302.2| cell division protein MraZ [Coxiella burnetii Dugway 5J108-111]
 gi|212213354|ref|YP_002304290.1| cell division protein MraZ [Coxiella burnetii CbuG_Q212]
 gi|212219402|ref|YP_002306189.1| cell division protein MraZ [Coxiella burnetii CbuK_Q154]
 gi|215918895|ref|NP_819165.2| cell division protein MraZ [Coxiella burnetii RSA 493]
 gi|206583780|gb|AAO89679.2| cell division protein [Coxiella burnetii RSA 493]
 gi|207082161|gb|ABS78242.2| cell division protein [Coxiella burnetii Dugway 5J108-111]
 gi|212011764|gb|ACJ19145.1| cell division protein [Coxiella burnetii CbuG_Q212]
 gi|212013664|gb|ACJ21044.1| cell division protein [Coxiella burnetii CbuK_Q154]
          Length = 160

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 4/143 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  +       L    D     + +      E  EQK+
Sbjct: 9   MFRGLNPIAVDAKGRIAIPARYREPIESEADGILVVTIDTEERCLLIYTHPQWEQIEQKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                +   + ++  L+ G    +++D  GRIL+   +R + G+ + V  VG+G  F+LW
Sbjct: 69  ENLPSYHPASRRIQRLLIGHATEVELDRSGRILIPPVLREYAGLGSMVMLVGQGKKFELW 128

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
               +      +R ++  + L K
Sbjct: 129 GKSQWET----AREDWLAEELPK 147


>gi|150390648|ref|YP_001320697.1| MraZ protein [Alkaliphilus metalliredigens QYMF]
 gi|167011854|sp|A6TS70|MRAZ_ALKMQ RecName: Full=Protein MraZ
 gi|149950510|gb|ABR49038.1| MraZ protein [Alkaliphilus metalliredigens QYMF]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      IDSKGR+SVP  FR  L  R I             + V + D  +  E K+
Sbjct: 1   MFIGEYNHSIDSKGRLSVPSRFREELGDRFILTKGL-----DNCLFVYSMDEWKVLEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G    ++D++GRI + + +R    +E EV  +G     ++W
Sbjct: 56  KKLPLTNRDARAFVRFFFSGATECELDNQGRIRIPNNLRSHAYLEKEVIVIGVATRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   + +  ++S    +E   ++ +
Sbjct: 116 SSDQWGQYNDDSNLSYDEIANRMEE 140


>gi|325980946|ref|YP_004293348.1| MraZ protein [Nitrosomonas sp. AL212]
 gi|325530465|gb|ADZ25186.1| MraZ protein [Nitrosomonas sp. AL212]
          Length = 148

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 1/134 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L   C   L    D     + +      E  EQK+
Sbjct: 1   MFRGVTQLSLDAKGRLAIPARYRNELMSTCSGHLIVTVDPS-KCLLIYPQPAWEPIEQKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F      L  L+ G    + MD+ GRIL++  +R F G+  +V  VG+G   +LW
Sbjct: 60  NNLSSFDTVTRNLQRLLVGNACDVDMDAAGRILVSPPLRQFAGLSKDVVLVGQGTKLELW 119

Query: 123 NPQTFRKLQEESRN 136
           +   +    E + +
Sbjct: 120 DETQWNLQIEIAMS 133


>gi|296116427|ref|ZP_06835041.1| cell division protein MraZ [Gluconacetobacter hansenii ATCC 23769]
 gi|295977020|gb|EFG83784.1| cell division protein MraZ [Gluconacetobacter hansenii ATCC 23769]
          Length = 159

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 3/143 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFR---TILAQRCITDLYCFQDFFFPAISVGNSDLLEY 57
           MS FL     ++D+KGRVS+P  FR     L++     +        P +    S     
Sbjct: 1   MSVFLGTHQNRLDAKGRVSIPSAFRATLRTLSRAGEPLVIMRPSHLHPCLEAWPSASFSA 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
             + + E + FS   + L+  ++     +  D EGRIL+ + +R    +  +VTF+G G 
Sbjct: 61  LARPLDEVDIFSEDHDDLATALYADAYPIDADKEGRILLPETLRAHANLTEQVTFMGLGR 120

Query: 118 YFQLWNPQTFRKLQEESRNEYCR 140
            FQ+W+P    + ++E+R     
Sbjct: 121 IFQVWDPDAAAQRRDEARTRARA 143


>gi|291300154|ref|YP_003511432.1| MraZ protein [Stackebrandtia nassauensis DSM 44728]
 gi|290569374|gb|ADD42339.1| MraZ protein [Stackebrandtia nassauensis DSM 44728]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      L   +      + V      +    ++
Sbjct: 1   MFLGTHTPRLDDKGRLILPAKFRDELA----GGLVITKG-QERCLYVFPMPEFQRIADEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A   + +          D +GR+ +   +R + G++ E+  +G  +  ++W
Sbjct: 56  HKAPMTNKAARAYNRVFFASAHDEIPDKQGRVTIPAHLREYAGLDRELVVIGASSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + ++    +S   +  
Sbjct: 116 DAEAWQTYLSDSEEAFAD 133


>gi|153933352|ref|YP_001383804.1| cell division protein MraZ [Clostridium botulinum A str. ATCC
           19397]
 gi|153934766|ref|YP_001387354.1| cell division protein MraZ [Clostridium botulinum A str. Hall]
 gi|152929396|gb|ABS34896.1| mraZ protein [Clostridium botulinum A str. ATCC 19397]
 gi|152930680|gb|ABS36179.1| mraZ protein [Clostridium botulinum A str. Hall]
 gi|322805770|emb|CBZ03335.1| cell division protein MraZ [Clostridium botulinum H04402 065]
          Length = 156

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D+K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 14  DMFIGEYNHGLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 68

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 69  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 128

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 129 WSKEKWEEYNNSNIDYDSIAEQMSE 153


>gi|328542957|ref|YP_004303066.1| MraZ protein [polymorphum gilvum SL003B-26A1]
 gi|326412703|gb|ADZ69766.1| MraZ protein [Polymorphum gilvum SL003B-26A1]
          Length = 156

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 85/143 (59%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+S+ T ++D+KGRVS+P  FR +LA+     LYC      PA+  G ++L++  + 
Sbjct: 1   MAGFVSHFTNRLDAKGRVSIPAPFRAVLARDGYEGLYCIASPHAPAVDAGGNELVDEIQA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++  +   S   + L++ + G     K+D++GRI+++D IR  TG+ ++VTFVG G  FQ
Sbjct: 61  RLNAFAKLSPDHDALAVALFGASETPKIDADGRIVISDMIREATGVSDQVTFVGLGYKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W P+ FR+ + E+       L 
Sbjct: 121 IWEPERFREHRAEATRRALAMLS 143


>gi|297205804|ref|ZP_06923199.1| cell division protein MraZ [Lactobacillus jensenii JV-V16]
 gi|297148930|gb|EFH29228.1| cell division protein MraZ [Lactobacillus jensenii JV-V16]
          Length = 158

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 59/142 (41%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR       + D   F       I   + +  +  E K+
Sbjct: 16  MFMGEYHHNLDAKGRLIIPAKFRNQ-----MGDKIIFTRGMEGCIFGYSEEEWQKIEAKL 70

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         + + L + G +  + D +GR+ +T  ++    +E E   VG  N  ++W
Sbjct: 71  AKLPLTKRNVRKFTRLFYSGAMESEFDKQGRVNLTATLKEHAELEKECVIVGVSNRIEIW 130

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    +++   Y   + +
Sbjct: 131 SQKRWDDFTDDADENY-DDIAE 151


>gi|242373464|ref|ZP_04819038.1| cell division protein MraZ [Staphylococcus epidermidis M23864:W1]
 gi|242348827|gb|EES40429.1| cell division protein MraZ [Staphylococcus epidermidis M23864:W1]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|67459297|ref|YP_246921.1| cell division protein MraZ [Rickettsia felis URRWXCal2]
 gi|75536273|sp|Q4UL17|MRAZ_RICFE RecName: Full=Protein MraZ
 gi|67004830|gb|AAY61756.1| MraZ protein [Rickettsia felis URRWXCal2]
          Length = 149

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 64/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I V     +E   Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNDCIEVCGISHIEKLRQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++ 
Sbjct: 121 IWQPQNFEKYLNSAQK 136


>gi|269978135|ref|ZP_06185085.1| protein MraZ [Mobiluncus mulieris 28-1]
 gi|307700821|ref|ZP_07637846.1| protein MraZ [Mobiluncus mulieris FB024-16]
 gi|269933644|gb|EEZ90228.1| protein MraZ [Mobiluncus mulieris 28-1]
 gi|307613816|gb|EFN93060.1| protein MraZ [Mobiluncus mulieris FB024-16]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  L+                 I    +   E    ++
Sbjct: 1   MFLGTYEPKLDDKGRLILPSRFRDQLSAG-----VVLTPGQERCIYAFPTSEFETIYDEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A + S ++  G      D +GRI +   +R + G+   +  +G G   ++W
Sbjct: 56  RQAPLTHKEARKFSRVMLSGATDQIPDKQGRINIPANLRQYAGLNKNLKVIGAGARAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +  T+     ES + +  ++ ++
Sbjct: 116 DADTWDTYLSESEDAFA-EIAEE 137


>gi|110639132|ref|YP_679341.1| mraZ-like [Cytophaga hutchinsonii ATCC 33406]
 gi|123163333|sp|Q11RG5|MRAZ_CYTH3 RecName: Full=Protein MraZ
 gi|110281813|gb|ABG59999.1| conserved hypothetical protein, mraZ-like protein [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 151

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +D+KGR+ +P   ++ L      ++   + F    I + +    +    
Sbjct: 1   MGFFSGEYDCTVDAKGRMVLPARIKSNLPDIDAGNVVLTRGF-ESCIVLYSQTEFKKIYS 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K++  N FS +          G   +++DS GR+L+   +     +E ++T VG GN  +
Sbjct: 60  KVSGLNEFSEEYRVFQRNFFRGINEVELDSNGRLLIPKMLMAHAQLEKDITVVGMGNRVE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+P  ++K   +  +E+  QL +K
Sbjct: 120 IWSPDLYQKFLIQDSSEFA-QLAEK 143


>gi|326693784|ref|ZP_08230789.1| cell division protein MraZ [Leuconostoc argentinum KCTC 3773]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 64/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+KGR+ +P  FR  L  + +   +        A+      + E  E ++
Sbjct: 1   MFMGEYSHTLDAKGRLIIPAKFRHQLGDKFVVTRWM-----EHALRAMPMPIWEKLETQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      +A Q    V  G +  ++D +GRI++   +R + G+E +V   G G+ F++W
Sbjct: 56  NELPLGKKEARQFKRFVLAGAMEAEIDKQGRIIVPANLREYAGLEKDVIVTGSGDSFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
               ++     + + +  ++ +
Sbjct: 116 QAARWQAYTSATADNF-DEIAE 136


>gi|304413634|ref|ZP_07395078.1| cell division protein [Candidatus Regiella insecticola LSR1]
 gi|304283725|gb|EFL92119.1| cell division protein [Candidatus Regiella insecticola LSR1]
          Length = 163

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR++VP  +R +L +     + C  D     + +      E  E K+
Sbjct: 1   MFRGATLINLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQACLLLYPLTEWEIIEHKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    ++  L+ G     +MD  GR+L+   +R  + +  E+  VG+ N F+LW
Sbjct: 61  SRLSSINPFERRIQRLLLGHASECQMDGAGRLLIASTLRQHSKLTKEIILVGQFNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           N Q +   Q+   +    Q  Q+
Sbjct: 121 NEQLW--YQQVKNDIAAEQSAQE 141


>gi|91207107|sp|Q31I69|MRAZ_THICR RecName: Full=Protein MraZ
          Length = 152

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 65/139 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F    +  +D+KGR+++P  +R  +A+     L    D   P + +   D  E  E+
Sbjct: 1   MLFFRGINSINMDAKGRLAIPKRYRESIAEASENQLVATIDLHSPCLLIYTMDEWEVIER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+        QA  +  L+ G    ++MD +GR+L+   +R    +E E   +G+GN F+
Sbjct: 61  KLMSLPNMDPQARLVQRLLLGHASEMEMDGQGRVLLPSLLREHAKLEKEAILLGQGNKFE 120

Query: 121 LWNPQTFRKLQEESRNEYC 139
           LW+ + +   + E  +   
Sbjct: 121 LWSQEAWDASRPEMLDSAS 139


>gi|289551039|ref|YP_003471943.1| Cell division protein MraZ [Staphylococcus lugdunensis HKU09-01]
 gi|289180571|gb|ADC87816.1| Cell division protein MraZ [Staphylococcus lugdunensis HKU09-01]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     D  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLDEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAIEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|83858923|ref|ZP_00952445.1| hypothetical protein OA2633_05451 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853746|gb|EAP91598.1| hypothetical protein OA2633_05451 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 154

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 64/132 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+S  T  ID+KGRVSVP  FR  ++ +    +Y ++ F  P +  G   LLE +   I
Sbjct: 1   MFVSTTTNGIDAKGRVSVPADFRATVSGQGFPGIYVWRSFNGPFLEGGGQRLLEDYSDAI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +P+         ++ GG   L  DS GR+ +        G++ +  F+G G  F++W
Sbjct: 61  EDLDPYDPARTAFERVIFGGAKALSFDSTGRVSLPKEFLDHAGLDKQAVFIGMGKRFEIW 120

Query: 123 NPQTFRKLQEES 134
           +P    + Q + 
Sbjct: 121 DPTAHAEQQVDD 132


>gi|168182382|ref|ZP_02617046.1| mraZ protein [Clostridium botulinum Bf]
 gi|226948789|ref|YP_002803880.1| cell division protein MraZ [Clostridium botulinum A2 str. Kyoto]
 gi|237794791|ref|YP_002862343.1| cell division protein MraZ [Clostridium botulinum Ba4 str. 657]
 gi|182674405|gb|EDT86366.1| mraZ protein [Clostridium botulinum Bf]
 gi|226844376|gb|ACO87042.1| mraZ protein [Clostridium botulinum A2 str. Kyoto]
 gi|229262072|gb|ACQ53105.1| mraZ protein [Clostridium botulinum Ba4 str. 657]
          Length = 156

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D+K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 14  DMFIGEYNHGLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 68

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 69  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 128

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 129 WSKEKWEEYNNSNIDYDSIAEQMSE 153


>gi|6648035|sp|O34913|MRAZ_ENTHR RecName: Full=Protein MraZ
          Length = 143

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP   R  L ++ +             +           E K+
Sbjct: 1   MFMGEFRHNIDTKGRMIVPSKLREELGEQFVLTRGL-----DGCLFGYPMKEWANLETKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A       +      ++D +GRI +   +R +  +  E   +G  N  ++W
Sbjct: 56  NDMPLAKKDARTFVRFFYSAATECELDKQGRINIPSTLRNYAALTKECVVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +++  E +   +  ++ +
Sbjct: 116 DEARWQEFSEVAAENF-DEIAE 136


>gi|24375713|ref|NP_719756.1| cell division protein MraZ [Shewanella oneidensis MR-1]
 gi|51316465|sp|Q8E9N9|MRAZ_SHEON RecName: Full=Protein MraZ
 gi|24350647|gb|AAN57200.1|AE015855_11 conserved hypothetical protein TIGR00242 [Shewanella oneidensis
           MR-1]
          Length = 152

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 60/142 (42%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPARYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  ++ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRMLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYC-RQLL 143
           + Q + +  +E +      +L 
Sbjct: 121 DEQAWLQQIDECQETIRGEELA 142


>gi|316940266|gb|ADU74300.1| MraZ protein [Clostridium thermocellum DSM 1313]
          Length = 144

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGRV +P  FR  L ++ I             +   + +     E K+
Sbjct: 2   LFYGEYQHSVDAKGRVIIPSKFREGLGEKFILTKGL-----DNCLFAYSLEEWSNLEAKL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G   +++D +GRIL+   +R + G+E +V  +G     ++W
Sbjct: 57  RSLPFTDKDVRAFVRFFFAGAAEVEVDKQGRILIPQNLREYAGLEKDVYIIGVSTRVEVW 116

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +     +  N     + +K
Sbjct: 117 DKSKWESYSGD-ENMSAESIAEK 138


>gi|239636345|ref|ZP_04677347.1| MraZ protein [Staphylococcus warneri L37603]
 gi|239597700|gb|EEQ80195.1| MraZ protein [Staphylococcus warneri L37603]
 gi|330686328|gb|EGG97933.1| protein MraZ [Staphylococcus epidermidis VCU121]
          Length = 143

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLNKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|223043799|ref|ZP_03613842.1| MraZ protein [Staphylococcus capitis SK14]
 gi|222442896|gb|EEE48998.1| MraZ protein [Staphylococcus capitis SK14]
          Length = 143

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ VP  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIVPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|153939556|ref|YP_001390801.1| cell division protein MraZ [Clostridium botulinum F str. Langeland]
 gi|152935452|gb|ABS40950.1| mraZ protein [Clostridium botulinum F str. Langeland]
 gi|295318871|gb|ADF99248.1| mraZ protein [Clostridium botulinum F str. 230613]
          Length = 156

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D+K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 14  DMFIGEYNHGLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 68

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 69  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 128

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 129 WSKEKWEEYNNSNIDYDSIAEQMSE 153


>gi|90580219|ref|ZP_01236026.1| hypothetical protein VAS14_19846 [Vibrio angustum S14]
 gi|90438521|gb|EAS63705.1| hypothetical protein VAS14_19846 [Vibrio angustum S14]
          Length = 152

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 60/130 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGR+++P  +R  +   C     C  D  F  + +   +   + E K+
Sbjct: 1   MLRGATVISLDNKGRIAIPKRYRAEVTNHCDGLFVCTIDHQFSCLLLYPINEWVHIETKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +       ++  L+ G      MD +GRIL+   +R +  +++++  VG+ N F++W
Sbjct: 61  ATLSSLHPAERRIQRLLLGHASECDMDGQGRILLPATLRQYAHLQDKIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQE 132
           +   +++  E
Sbjct: 121 SESLWQQQIE 130


>gi|225175506|ref|ZP_03729500.1| MraZ protein [Dethiobacter alkaliphilus AHT 1]
 gi|225168835|gb|EEG77635.1| MraZ protein [Dethiobacter alkaliphilus AHT 1]
          Length = 143

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR  L +R +             + V   +     E+K+
Sbjct: 1   MFMGEYQHSVDGKGRLIMPAKFREALGERFVVTRGL-----DNCLFVYPMEEWTILEKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GR+L+ + +R    +  +   +G  N  ++W
Sbjct: 56  KALPFTRSDARAFMRFFFSGAAECELDKQGRVLVPNNLRDHAKLLKDAVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    EE+   +   + +K
Sbjct: 116 SQEVWDSYSEETGLSF-ENIAEK 137


>gi|304317211|ref|YP_003852356.1| MraZ protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778713|gb|ADL69272.1| MraZ protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 146

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 52/143 (36%), Gaps = 8/143 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID KGRV +P  FR  L  + +             + V +       E K+
Sbjct: 4   MLMGQYEHTIDQKGRVIIPAKFRDELGDKFVLTRGL-----DNCLFVYSLAEWSNIETKL 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+L+ + +R    I+ EV  +G  +  ++W
Sbjct: 59  KTLPLNRKDARAFTRFFLAGATECEIDKQGRVLIPNILREHAKIDKEVIIIGVSSRVEIW 118

Query: 123 NPQTFRKLQEE---SRNEYCRQL 142
           + + + +       S  +    L
Sbjct: 119 SKEVWLEYSNNVDVSFEDVAEHL 141


>gi|170756667|ref|YP_001781091.1| cell division protein MraZ [Clostridium botulinum B1 str. Okra]
 gi|169121879|gb|ACA45715.1| mraZ protein [Clostridium botulinum B1 str. Okra]
          Length = 156

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D+K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 14  DMFIGEYNHGLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 68

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 69  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 128

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 129 WSKKKWEEYNNSNIDYDSIAEQMSE 153


>gi|227550452|ref|ZP_03980501.1| cell division protein MraZ [Enterococcus faecium TX1330]
 gi|257888480|ref|ZP_05668133.1| MraZ family protein [Enterococcus faecium 1,141,733]
 gi|257897145|ref|ZP_05676798.1| MraZ family protein [Enterococcus faecium Com12]
 gi|257899143|ref|ZP_05678796.1| MraZ family protein [Enterococcus faecium Com15]
 gi|293377369|ref|ZP_06623573.1| protein MraZ [Enterococcus faecium PC4.1]
 gi|293571738|ref|ZP_06682757.1| MraZ protein [Enterococcus faecium E980]
 gi|227180353|gb|EEI61325.1| cell division protein MraZ [Enterococcus faecium TX1330]
 gi|257824534|gb|EEV51466.1| MraZ family protein [Enterococcus faecium 1,141,733]
 gi|257833710|gb|EEV60131.1| MraZ family protein [Enterococcus faecium Com12]
 gi|257837055|gb|EEV62129.1| MraZ family protein [Enterococcus faecium Com15]
 gi|291608195|gb|EFF37498.1| MraZ protein [Enterococcus faecium E980]
 gi|292644061|gb|EFF62167.1| protein MraZ [Enterococcus faecium PC4.1]
          Length = 143

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 49/142 (34%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP   R  L ++ +             +        E  E K+
Sbjct: 1   MLMGEFQHNIDAKGRLIVPSKLREELGEKFVLTRGL-----DGCLFGYPMSEWENLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R +  +      +G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECELDKQGRINIPSTLRNYAALTKGCVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     E+   +  ++ +
Sbjct: 116 DETRWEDFSAEAEENF-DEIAE 136


>gi|70726738|ref|YP_253652.1| cell division protein MraZ [Staphylococcus haemolyticus JCSC1435]
 gi|91207217|sp|Q4L5M9|MRAZ_STAHJ RecName: Full=Protein MraZ
 gi|68447462|dbj|BAE05046.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 143

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 61/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYEHQLDAKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAIEVELDKQGRINIPQNLRKYASLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    +ES   +   + +
Sbjct: 116 DRETWNDFYDESEESF-EDIAE 136


>gi|315658535|ref|ZP_07911407.1| cell division protein MraZ [Staphylococcus lugdunensis M23590]
 gi|315496864|gb|EFU85187.1| cell division protein MraZ [Staphylococcus lugdunensis M23590]
          Length = 143

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAIEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    EES + +   + +
Sbjct: 116 DRETWNDFYEESEDSF-EDIAE 136


>gi|282857250|ref|ZP_06266490.1| MraZ protein [Pyramidobacter piscolens W5455]
 gi|282584900|gb|EFB90228.1| MraZ protein [Pyramidobacter piscolens W5455]
          Length = 145

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 60/144 (41%), Gaps = 6/144 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+ +   +ID+KGR+ +P  FR  +                  ++V   D    + Q
Sbjct: 1   MDMFMGSYDHRIDNKGRLVMPAKFRAQIGD-----TVVCTVGLDNCLAVYPMDAWSVYLQ 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+        QA Q    + G    L +D +GRIL++  +R +  + + V   G  ++ +
Sbjct: 56  KLQSLPFTKGQARQFMRTLLGAAEELPVDGQGRILLSVKLRKYALLSDAVVVNGVNDHLE 115

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +WN + +    +E    +   L +
Sbjct: 116 IWNSEKWAASNDEMLENFTS-LAE 138


>gi|218281030|ref|ZP_03487609.1| hypothetical protein EUBIFOR_00168 [Eubacterium biforme DSM 3989]
 gi|218217711|gb|EEC91249.1| hypothetical protein EUBIFOR_00168 [Eubacterium biforme DSM 3989]
          Length = 143

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 58/145 (40%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L +                + V   +  +   QK+
Sbjct: 1   MFMGEYAHNIDRKGRLIMPAKFREELGE-----HVVVNRGLDGCLYVYTVEQWQQVYQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     +  A     ++       +MDS+GRIL+   +     +E E   +G  N+ ++W
Sbjct: 56  STLPSTNKDARMYQRMMLSKAAECEMDSQGRILIPSSLIALASLEKECLIIGVANHLEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           + Q +  L+EE   S  E    L +
Sbjct: 116 SKQRWEALEEEQSASFEEAAEHLSE 140


>gi|187779895|ref|ZP_02996368.1| hypothetical protein CLOSPO_03491 [Clostridium sporogenes ATCC
           15579]
 gi|187773520|gb|EDU37322.1| hypothetical protein CLOSPO_03491 [Clostridium sporogenes ATCC
           15579]
          Length = 151

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D+K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 9   DMFIGEYNHSLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 63

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 64  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 123

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 124 WSREKWEEYNNSNIDYDSIAEQMSE 148


>gi|260437307|ref|ZP_05791123.1| MraZ protein [Butyrivibrio crossotus DSM 2876]
 gi|292810219|gb|EFF69424.1| MraZ protein [Butyrivibrio crossotus DSM 2876]
          Length = 145

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 60/141 (42%), Gaps = 6/141 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGRV VP  FR  L +  +             +    +D  + FE K+
Sbjct: 1   MFKGEYNHSIDSKGRVIVPAKFREQLGESFVVTKGL-----DGCLFGFPNDSWQEFENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  ++++ +L      G    ++D +GR L+   +R F G++ +V  +G     + W
Sbjct: 56  SSLSTSNMESRKLVRFFTAGAADCEIDKQGRALIPGVLRDFAGLDKDVVIIGVAKRIEFW 115

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           +   +  L +E  +    ++ 
Sbjct: 116 SKDKWNNLTDECDSN-MDEIA 135


>gi|329770447|ref|ZP_08261829.1| mraZ protein [Gemella sanguinis M325]
 gi|328836570|gb|EGF86230.1| mraZ protein [Gemella sanguinis M325]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 54/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGR+S+P  FR  L ++ I             +   +    +  E KI
Sbjct: 1   MFIGQYNNKMDAKGRLSIPIKFRDDLGEKFIITRGL-----DSCLFGYSLQEWQKVESKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G   +++D +GRI + + +     +E E    G  N  ++W
Sbjct: 56  KSLPITKKNARTFQRFFFSGATEVEIDKQGRINIPNSLIEHASLEKECVVNGLSNRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   +  L  ES     E   +L  
Sbjct: 116 DKDRWEDLLVESEASVEEIAEELED 140


>gi|269838023|ref|YP_003320251.1| MraZ protein [Sphaerobacter thermophilus DSM 20745]
 gi|269787286|gb|ACZ39429.1| MraZ protein [Sphaerobacter thermophilus DSM 20745]
          Length = 142

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   +  +D+KGR+++P  FR  L    +             +S+      +   +K+
Sbjct: 1   MFLGRYSHNLDAKGRLAIPARFREALGSDVVITRGI-----DRCLSLYPMAAWQPLAEKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +        A     +V       + D +GRIL+   +R + G++ E   VG   Y ++W
Sbjct: 56  SALPISDPDARTFRRMVFAEAATAEFDRQGRILIPPDLRRYAGLDREAIVVGMHTYIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +P+ +   Q E  +     + Q+
Sbjct: 116 SPEQWEA-QAEMMDSEGSSIAQR 137


>gi|2811052|sp|O07319|MRAZ_STAAU RecName: Full=Protein MraZ
 gi|2149890|gb|AAC45621.1| unknown [Staphylococcus aureus]
          Length = 144

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     D  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLDEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    E +  +    + +
Sbjct: 116 DRETWNDFYERNLKKSFEDIAE 137


>gi|81428356|ref|YP_395356.1| cell division protein MraZ [Lactobacillus sakei subsp. sakei 23K]
 gi|91207195|sp|Q38XN4|MRAZ_LACSS RecName: Full=Protein MraZ
 gi|78609998|emb|CAI55046.1| Hypothetical protein LCA_0742 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+K R+ VP  FR  L    +             I        E  E+K+
Sbjct: 1   MFMGEFHHTIDTKNRLIVPAKFREALGTEFVLTRGM-----DNCIFGYPLSEWEQLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A       +   +    D +GRI++   +     +E E   +G  N  ++W
Sbjct: 56  KQLPLAKKDARAFVRFFYSAAVQCTPDKQGRIMIPQALSTHASLEKECVLIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    EE+   +   + +
Sbjct: 116 SQEKWASFSEEAEENF-DDIAE 136


>gi|238924612|ref|YP_002938128.1| uncharacterized conserved protein, YllB-like protein [Eubacterium
           rectale ATCC 33656]
 gi|238876287|gb|ACR75994.1| uncharacterized conserved protein, YllB-like protein [Eubacterium
           rectale ATCC 33656]
          Length = 151

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 6/144 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F+      ID+KGR+ VP  FR  L    +             + V ++D     E+ 
Sbjct: 8   AMFMGEYNHSIDAKGRMIVPAKFREQLGNEFVVTKGL-----DGCLFVYSNDEWHRIEEN 62

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +    S +A +       G    ++D +GRIL+   +R + GI+ EV  VG  +  ++
Sbjct: 63  LRDKPLTSREARKFMRFFFAGAATCEVDKQGRILLPANLREYAGIDKEVVSVGVYSRVEI 122

Query: 122 WNPQTFRKLQE-ESRNEYCRQLLQ 144
           W+   + +  + +  +E    + +
Sbjct: 123 WSKDRYLENSDFDDMDEIADHMAE 146


>gi|28378806|ref|NP_785698.1| cell division protein MraZ [Lactobacillus plantarum WCFS1]
 gi|254557011|ref|YP_003063428.1| cell division protein MraZ [Lactobacillus plantarum JDM1]
 gi|308181003|ref|YP_003925131.1| cell division protein MraZ [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|38258034|sp|Q88V75|MRAZ_LACPL RecName: Full=Protein MraZ
 gi|28271643|emb|CAD64549.1| cell division protein MraZ (putative) [Lactobacillus plantarum
           WCFS1]
 gi|254045938|gb|ACT62731.1| cell division protein MraZ [Lactobacillus plantarum JDM1]
 gi|308046494|gb|ADN99037.1| cell division protein MraZ [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 141

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 56/142 (39%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+ +P  FR +L    +             I    ++     + ++
Sbjct: 1   MFFGEFEHALDAKGRLIIPAKFRELLGTSFVITRGM-----DGCIFGYPAERWATLQAQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A       +      ++D +GR+++   +R +  +E +   VG  + F++W
Sbjct: 56  DDLPLTRKDARAFVRFFYAAAAECELDKQGRVMIPATLRQYAKLEKQCVIVGVSDRFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             + +++ + E+   +   L +
Sbjct: 116 GAEHWQQFETETAANF-DDLAE 136


>gi|227535246|ref|ZP_03965295.1| cell division protein MraZ [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|227187130|gb|EEI67197.1| cell division protein MraZ [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 21/136 (15%), Positives = 48/136 (35%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +    + ID+KGR+ +P  FR  L    +             +        +  + K+
Sbjct: 1   MLMGEFERSIDAKGRLIIPAKFRDQLGASFVLTRGM-----DGCLFGYPIAEWDKLQTKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A   +  +        +D +GRI +   +    G++ +   VG     ++W
Sbjct: 56  ATLPLTKKDARTFTRFLFSAATECDIDKQGRINIPKPLFKHAGLQKDCVLVGVNTRIEVW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + + +  E +   +
Sbjct: 116 DAERWEQFAETAEENF 131


>gi|30248985|ref|NP_841055.1| cell division protein MraZ [Nitrosomonas europaea ATCC 19718]
 gi|51316404|sp|Q82VT2|MRAZ_NITEU RecName: Full=Protein MraZ
 gi|30138602|emb|CAD84893.1| Domain of unknown function UPF0040 [Nitrosomonas europaea ATCC
           19718]
          Length = 148

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 1/132 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +DSKGR+++P  +R  L   C  ++    D     + +    + E  E+K+
Sbjct: 1   MFRGSTQLSLDSKGRLAIPAKYRDELFASCGGNIVVTADP-SRCLLIYPQPVWEPIEKKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +   S Q   L  L+ G    ++MDS GRIL++  +R F G++ EV   G+G  F+LW
Sbjct: 60  NSFPSLSPQIRSLQRLIIGNASDVEMDSSGRILISAPLRQFAGLQKEVVLAGQGEKFELW 119

Query: 123 NPQTFRKLQEES 134
           +   +    + +
Sbjct: 120 DMAKWDLEIDTA 131


>gi|322384130|ref|ZP_08057848.1| MraZ-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151210|gb|EFX44519.1| MraZ-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 159

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 52/143 (36%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L    +             + V         EQK+
Sbjct: 15  MFMGEYQHSIDEKGRLIIPAKFRESLGASFVITRGL-----DNCLFVYPKSEWAVLEQKL 69

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E +   +G  N  ++W
Sbjct: 70  KSLPLMKADARAFTRFFFSGATESELDKQGRVNIAKNLAQYAKLEKDCVVIGVSNRVEIW 129

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    + S   +  ++ +K
Sbjct: 130 SREIWENYFQTSEQSF-NEIAEK 151


>gi|313888512|ref|ZP_07822179.1| protein MraZ [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845541|gb|EFR32935.1| protein MraZ [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 142

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 60/143 (41%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D KGRV++P  FR  L+          +      + +  SD  E  E K+
Sbjct: 1   MLIGEFRHNLDPKGRVTIPSKFREDLSS-----FVMTKGLDD-CLFLYPSDQWEKIENKL 54

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +            G +  ++D +GR+L+ + +R +  + ++   +G  N  ++W
Sbjct: 55  KELPMTNKAVRSFVRTFFSGAVDCELDKQGRVLIGEHLREYADLIDKCVIIGLSNRAEIW 114

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + K  EE    Y  +L +K
Sbjct: 115 SEENWNKYNEEEALSY-EELAEK 136


>gi|310828122|ref|YP_003960479.1| MraZ protein [Eubacterium limosum KIST612]
 gi|308739856|gb|ADO37516.1| MraZ protein [Eubacterium limosum KIST612]
          Length = 140

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 52/142 (36%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID KGR+ +P  FR  L +  +             + V +++  E F  K+
Sbjct: 1   MFFGEYEHNIDDKGRLIIPSKFREALGKDFVITKGL-----DCCLFVFSTEEWEIFVNKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G     +D +GRI +   +R    +E E   +G  N  ++W
Sbjct: 56  RTLPISDKDARDFTRFFFSGASECALDKQGRISIPAPLRKHARLEKETKIIGVSNRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N + +        ++   ++ +
Sbjct: 116 NTENWDNYNNMDVSDIADKMAE 137


>gi|224476280|ref|YP_002633886.1| cell division protein MraZ [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254813292|sp|B9DPQ8|MRAZ_STACT RecName: Full=Protein MraZ
 gi|222420887|emb|CAL27701.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 61/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ VP  FR  L +R +             +     +  +  E+K+
Sbjct: 1   MFMGEYEHQLDAKGRMIVPSKFRYELNERFVITRGL-----DKCLFGYTLEEWQNIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KSLPMTKRDARKFMRMFFSGAVEVELDKQGRINIPKNLREYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +  ++    +ES + +   + +
Sbjct: 116 DRASWNGFYDESEDSF-EDIAE 136


>gi|205373086|ref|ZP_03225891.1| cell division protein MraZ [Bacillus coahuilensis m4-4]
 gi|205373088|ref|ZP_03225893.1| cell division protein MraZ [Bacillus coahuilensis m4-4]
          Length = 143

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 47/138 (34%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR  L +  +             +     +     E K+
Sbjct: 1   MFMGEYQHNIDQKGRLIVPSKFRDNLGESFVITRGL-----DQCLFGYPMNEWRILEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  N  ++W
Sbjct: 56  KTLPLTKKDARAFTRFFFSGASECEIDKQGRINLPTSLVSYASLEKECVVLGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +      S + +  
Sbjct: 116 SKPVWEDYFTNSEDSFAE 133


>gi|167622386|ref|YP_001672680.1| cell division protein MraZ [Shewanella halifaxensis HAW-EB4]
 gi|189028637|sp|B0TQM8|MRAZ_SHEHH RecName: Full=Protein MraZ
 gi|167352408|gb|ABZ75021.1| MraZ protein [Shewanella halifaxensis HAW-EB4]
          Length = 152

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 58/139 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L     + L    D     + +      E    K+
Sbjct: 1   MFSGASAINLDTKGRIAIPKRYREPLHACHNSQLVITVDIQSSCLLLYPIQEWEKVAAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +        +  ++ G     ++D  GR+L+   +R +  ++     VG+ N F+LW
Sbjct: 61  ALLSDTQPTERAIKRMLLGYAHECELDGNGRMLLPTPLRQYANLDKRAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   +++  E+SR     +
Sbjct: 121 DEAAWQQQIEQSRLAILNE 139


>gi|157825942|ref|YP_001493662.1| cell division protein MraZ [Rickettsia akari str. Hartford]
 gi|167012267|sp|A8GP29|MRAZ_RICAH RecName: Full=Protein MraZ
 gi|157799900|gb|ABV75154.1| hypothetical protein A1C_04410 [Rickettsia akari str. Hartford]
          Length = 149

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 66/143 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RVSVP  +R +L +     +  +       I       +E  +Q
Sbjct: 1   MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEACGISHIEKLKQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D +GR+++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLSFDGDGRVILPQSLMKHAGIEEQACFVGKGVIFE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W PQ F K  + ++     Q  
Sbjct: 121 IWQPQNFEKHLKSAQKIAHEQRF 143


>gi|332518990|ref|ZP_08395457.1| MraZ protein [Lacinutrix algicola 5H-3-7-4]
 gi|332044838|gb|EGI81031.1| MraZ protein [Lacinutrix algicola 5H-3-7-4]
          Length = 156

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+  +     K D+KGR+ +P   +  L+          +  F   + +      E   Q
Sbjct: 1   MNSLIGTYECKADAKGRLMLPAALKKQLSPVLQNGFVIKRGVFQQCLELYPMAEWEALMQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ + N F  + N        G   +++D+ GR+L+   + VF GI   V      N  +
Sbjct: 61  KVNKLNRFKKKNNDFIRRFTAGVKIVEVDASGRLLVPKDLTVFAGIVKNVVVSSAVNIVE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   + +  +++  ++   L ++
Sbjct: 121 IWDKDKYEQAIDDAALDFAD-LAEE 144


>gi|300768849|ref|ZP_07078743.1| cell division protein MraZ [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300493582|gb|EFK28756.1| cell division protein MraZ [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 145

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 22/143 (15%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F       +D+KGR+ +P  FR +L    +             I    ++     + +
Sbjct: 4   KMFFGEFEHALDAKGRLIIPAKFRELLGTSFVITRGM-----DGCIFGYPAERWATLQAQ 58

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +       A       +      ++D +GR+++   +R +  +E +   VG  + F++
Sbjct: 59  LDDLPLTRKDARAFVRFFYAAAAECELDKQGRVMIPATLRQYAKLEKQCVIVGVSDRFEI 118

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W  + +++ + E+   +   L +
Sbjct: 119 WGAEHWQQFETETAANF-DDLAE 140


>gi|15601998|ref|NP_245070.1| cell division protein MraZ [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|20139144|sp|Q9CPB5|MRAZ_PASMU RecName: Full=Protein MraZ
 gi|12720348|gb|AAK02217.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 152

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 62/133 (46%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R  + ++    + C  D   P + +      E  EQK+
Sbjct: 1   MFRGASAINLDSKGRIAIPTRYRAEIIEQNAGQMVCTVDIRQPCLLLYPLKEWELVEQKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +    F +    L  ++ G     ++DS GRIL++  +R+   +E  +  VG+ N F++W
Sbjct: 61  SALANFDLTHRSLQRVMLGYATECELDSAGRILISGPLRLHAKLEKSLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESR 135
           +   +    E+  
Sbjct: 121 SDAEWHAQIEQDM 133


>gi|114045887|ref|YP_736437.1| cell division protein MraZ [Shewanella sp. MR-7]
 gi|123030980|sp|Q0HZS5|MRAZ_SHESR RecName: Full=Protein MraZ
 gi|113887329|gb|ABI41380.1| MraZ protein [Shewanella sp. MR-7]
          Length = 152

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPLHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  ++ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRMLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q + +  +E +     +
Sbjct: 121 DEQAWLQQIDECQETIRSE 139


>gi|192361565|ref|YP_001983394.1| cell division protein MraZ [Cellvibrio japonicus Ueda107]
 gi|226709959|sp|B3PCM9|MRAZ_CELJU RecName: Full=Protein MraZ
 gi|190687730|gb|ACE85408.1| mraZ protein [Cellvibrio japonicus Ueda107]
          Length = 146

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 63/142 (44%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            +  + +  +D KGR+++P   R  L + C   L          + V           +I
Sbjct: 1   MYTGSHSISMDPKGRMAIPTRIRDALVESCGGRLVVTAHTEDRCLLVYPEHEWLALLPQI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  + ++  ++ G    L++D  GR+L+   +R +  ++ ++  VG+G   +LW
Sbjct: 61  EALPSFNKVSQRVKRILIGYATPLEIDGNGRVLVPPTLRDYANLDKKIMLVGQGKKLELW 120

Query: 123 NPQTFRKLQEE-SRNEYCRQLL 143
           + +++  L    + +E   ++L
Sbjct: 121 SEESWLALLNAPAEDEIPGEML 142


>gi|120597212|ref|YP_961786.1| cell division protein MraZ [Shewanella sp. W3-18-1]
 gi|146291585|ref|YP_001182009.1| cell division protein MraZ [Shewanella putrefaciens CN-32]
 gi|167012278|sp|A4Y2M7|MRAZ_SHEPC RecName: Full=Protein MraZ
 gi|167012280|sp|A1REY7|MRAZ_SHESW RecName: Full=Protein MraZ
 gi|120557305|gb|ABM23232.1| MraZ protein [Shewanella sp. W3-18-1]
 gi|145563275|gb|ABP74210.1| MraZ protein [Shewanella putrefaciens CN-32]
 gi|319424759|gb|ADV52833.1| cell division locus protein, MraZ [Shewanella putrefaciens 200]
          Length = 152

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  L+ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q + +  +E +     +
Sbjct: 121 DEQAWLQQIDECQETIRSE 139


>gi|262364610|gb|ACY61167.1| hypothetical protein YPD8_0477 [Yersinia pestis D182038]
          Length = 146

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 3/138 (2%)

Query: 11  KIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSI 70
            +DSKGR++VP  +R  L +     + C  D   P + +      E  EQK++  +  + 
Sbjct: 3   NLDSKGRLAVPTRYRESLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKLSRLSSMNP 62

Query: 71  QANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKL 130
              ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW+ QT+ + 
Sbjct: 63  AERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELWDEQTWYQQ 122

Query: 131 QE---ESRNEYCRQLLQK 145
            +   ++       L ++
Sbjct: 123 VKDDIDAEQSTQEPLSER 140


>gi|148828288|ref|YP_001293041.1| cell division protein MraZ [Haemophilus influenzae PittGG]
 gi|167012246|sp|A5UIQ2|MRAZ_HAEIG RecName: Full=Protein MraZ
 gi|148719530|gb|ABR00658.1| hypothetical protein CGSHiGG_09300 [Haemophilus influenzae PittGG]
          Length = 151

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 59/134 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGRV++P  +R  + ++    + C  D   P + +      +   +K+
Sbjct: 1   MFRGATAVNLDSKGRVAIPTRYRAEILEKNQGKMVCTVDIRQPCLLLYPLMNGKKSNKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F     +L  ++ G     +MD++GRIL +  +R    +E  +  VG+ N F++W
Sbjct: 61  LALSNFDPTQRRLQRVMLGHATECEMDAQGRILFSGPLRQHAKLEKGLMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   +     E   
Sbjct: 121 SDVEWHTQIAEDIE 134


>gi|326333503|ref|ZP_08199744.1| MraZ protein [Nocardioidaceae bacterium Broad-1]
 gi|325948703|gb|EGD40802.1| MraZ protein [Nocardioidaceae bacterium Broad-1]
          Length = 140

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 57/137 (41%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F+   T K+D KGR+ +P  FR  LA+                + V   D+     Q+  
Sbjct: 3   FMGTYTPKLDEKGRIFLPAKFRDRLAEG-----VVVTQGQENCLVVWPEDVFMQEAQRAQ 57

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +    S  A   + ++  G      D +GRI +   +R + GI  +V  +G  +  ++W+
Sbjct: 58  QTPLTSRDARDYARVLFAGAEQTTPDKQGRIGIPPLLRDYAGIVKDVVVIGVMDRIEIWD 117

Query: 124 PQTFRKLQEESRNEYCR 140
           P  + +    ++ ++  
Sbjct: 118 PAKWAEYSAGAQAKFAD 134


>gi|323340610|ref|ZP_08080862.1| cell division protein MraZ [Lactobacillus ruminis ATCC 25644]
 gi|323091733|gb|EFZ34353.1| cell division protein MraZ [Lactobacillus ruminis ATCC 25644]
          Length = 148

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 53/143 (37%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F       +D+KGR+ VP  FR  L ++               + V   +     ++K
Sbjct: 5   DVFFGEYRHNLDAKGRIIVPAKFREGLGEKFYVTRGM-----DGCLFVYAENEWNLLQEK 59

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +      +A       +       +D +GRI +   +  +  +     F+G  N  ++
Sbjct: 60  LQKLPLARKEARAFVRFFYSAATECILDKQGRINLPKTLCDYAELVKPCVFIGVSNRIEI 119

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+ Q + K  E++   +   + +
Sbjct: 120 WSEQRWEKASEQAAESF-DDMAE 141


>gi|66047338|ref|YP_237179.1| cell division protein MraZ [Pseudomonas syringae pv. syringae
           B728a]
 gi|75500765|sp|Q4ZNY1|MRAZ_PSEU2 RecName: Full=Protein MraZ
 gi|63258045|gb|AAY39141.1| Protein of unknown function UPF0040 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330973398|gb|EGH73464.1| cell division protein MraZ [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 151

 Score =  133 bits (334), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDAKGRLAMPSRYRDELDSRSAGQLIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|256850924|ref|ZP_05556313.1| MraZ [Lactobacillus jensenii 27-2-CHN]
 gi|260661138|ref|ZP_05862052.1| mraZ [Lactobacillus jensenii 115-3-CHN]
 gi|282934163|ref|ZP_06339441.1| protein MraZ [Lactobacillus jensenii 208-1]
 gi|256615986|gb|EEU21174.1| MraZ [Lactobacillus jensenii 27-2-CHN]
 gi|260548075|gb|EEX24051.1| mraZ [Lactobacillus jensenii 115-3-CHN]
 gi|281301777|gb|EFA94043.1| protein MraZ [Lactobacillus jensenii 208-1]
          Length = 143

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 57/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR       + D   F       I   + +  +  E K+
Sbjct: 1   MFMGEYHHNLDAKGRLIIPAKFRNQ-----MGDKIIFTRGMEGCIFGYSEEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         + + L + G +  + D +GR+ +T  ++    +E E   VG  N  ++W
Sbjct: 56  AKLPLTKRNVRKFTRLFYSGAMESEFDKQGRVNLTATLKEHAELEKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    +++   Y
Sbjct: 116 SQKRWDDFTDDADENY 131


>gi|114330282|ref|YP_746504.1| cell division protein MraZ [Nitrosomonas eutropha C91]
 gi|122314670|sp|Q0AJD2|MRAZ_NITEC RecName: Full=Protein MraZ
 gi|114307296|gb|ABI58539.1| MraZ protein [Nitrosomonas eutropha C91]
          Length = 148

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 1/132 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +DSKGR+++P  +R  L   C  ++    D     + +    + E  E+K+
Sbjct: 1   MFRGSTQLNLDSKGRLAIPAKYRNELFANCGGNIVVTADP-SRCLLIYPQPVWEPIEKKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           + ++ F+ Q   L  L+ G    ++MD  GRIL++  +R F G++ EV   G+G  F+LW
Sbjct: 60  SGFSSFNPQIRSLQRLIIGNACDVEMDGSGRILISAPLRQFAGLQKEVVLAGQGEKFELW 119

Query: 123 NPQTFRKLQEES 134
           +   +    + +
Sbjct: 120 DMAKWDLEIDTA 131


>gi|159038987|ref|YP_001538240.1| cell division protein MraZ [Salinispora arenicola CNS-205]
 gi|189028632|sp|A8LX89|MRAZ_SALAI RecName: Full=Protein MraZ
 gi|157917822|gb|ABV99249.1| MraZ protein [Salinispora arenicola CNS-205]
          Length = 142

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      +   +      + V  +   +    ++
Sbjct: 1   MFLGTHTPRLDDKGRLILPAKFRDELA----GGVVITKG-QERCLYVFPAPEFQRIADQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   S +          D +GR+ +   +R +  ++ ++  +G     ++W
Sbjct: 56  RAQPMTHKAARAYSRVFFASAHDEVPDKQGRVTIPGHLRDYAALDRDLVVIGAHTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES +++  
Sbjct: 116 DRVAWESYLAESEDDFAD 133


>gi|261206513|ref|ZP_05921213.1| marZ family protein [Enterococcus faecium TC 6]
 gi|289565423|ref|ZP_06445872.1| mraZ protein [Enterococcus faecium D344SRF]
 gi|294614716|ref|ZP_06694618.1| MraZ protein [Enterococcus faecium E1636]
 gi|294618986|ref|ZP_06698481.1| MraZ protein [Enterococcus faecium E1679]
 gi|260079223|gb|EEW66914.1| marZ family protein [Enterococcus faecium TC 6]
 gi|289162752|gb|EFD10603.1| mraZ protein [Enterococcus faecium D344SRF]
 gi|291592454|gb|EFF24061.1| MraZ protein [Enterococcus faecium E1636]
 gi|291594647|gb|EFF26029.1| MraZ protein [Enterococcus faecium E1679]
          Length = 143

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP   R  L ++ +             +        E  E K+
Sbjct: 1   MLMGEFQHNIDAKGRLIVPSKLREELGEKFVLTRGL-----DGCLFGYPMSEWENLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R +  +      +G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECELDKQGRINIPGTLRNYAALTKGCVVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++     + + +  ++ +
Sbjct: 116 DETRWQDFSAAAEDNF-DEIAE 136


>gi|206602141|gb|EDZ38623.1| Conserved protein of unknown function [Leptospirillum sp. Group II
           '5-way CG']
          Length = 148

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 56/137 (40%), Gaps = 3/137 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTIL--AQRCITDLYCFQDFFFPAISVGNSDLLEYF 58
           M+ F       +D KGRV++P  FR  L   ++    L    +     + V         
Sbjct: 1   MNIFRGRYQHSLDDKGRVAIPQKFRESLDGPEKGGGSLVITVEP-DECLVVYPESAWREL 59

Query: 59  EQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
           E+K+      +           G    ++ D +GRIL+   +R F  +E +V FVG  N 
Sbjct: 60  EEKVGALPQMNEDLKTYLRFTIGWATDVQPDRQGRILIPQPLRDFAHLERDVWFVGLLNK 119

Query: 119 FQLWNPQTFRKLQEESR 135
           F++WN     +L  + R
Sbjct: 120 FEIWNGDRLAQLTGKER 136


>gi|253998163|ref|YP_003050226.1| cell division protein MraZ [Methylovorus sp. SIP3-4]
 gi|313200233|ref|YP_004038891.1| mraz protein [Methylovorus sp. MP688]
 gi|253984842|gb|ACT49699.1| MraZ protein [Methylovorus sp. SIP3-4]
 gi|312439549|gb|ADQ83655.1| MraZ protein [Methylovorus sp. MP688]
          Length = 148

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 3/140 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR++VP   R  L  +C   L          + +      E  + K+
Sbjct: 1   MFRGATSLNLDAKGRLAVPAKHRDALLSQCAGHLVLT-AHPHRCLLLYPQPAWEPIQAKM 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F  Q++ L  L+ G    + MDS GR+L++  +R F G+E +   VG+G++F+LW
Sbjct: 60  MALSSFDRQSSSLQRLLVGFAEDIDMDSAGRLLVSPVLREFAGLEKQAMLVGQGSHFELW 119

Query: 123 NPQTFRKLQEESRNEYCRQL 142
           N   +R   ++       ++
Sbjct: 120 NMDAWRAQLDQVM--AADEM 137


>gi|116494757|ref|YP_806491.1| hypothetical protein LSEI_1266 [Lactobacillus casei ATCC 334]
 gi|191638269|ref|YP_001987435.1| cell division protein MraZ [Lactobacillus casei BL23]
 gi|239631646|ref|ZP_04674677.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301066318|ref|YP_003788341.1| hypothetical protein LCAZH_1257 [Lactobacillus casei str. Zhang]
 gi|116104907|gb|ABJ70049.1| hypothetical protein, MraZ [Lactobacillus casei ATCC 334]
 gi|190712571|emb|CAQ66577.1| Protein mraZ [Lactobacillus casei BL23]
 gi|239526111|gb|EEQ65112.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438725|gb|ADK18491.1| conserved hypothetical protein [Lactobacillus casei str. Zhang]
 gi|327382301|gb|AEA53777.1| MraZ protein [Lactobacillus casei LC2W]
 gi|327385496|gb|AEA56970.1| MraZ protein [Lactobacillus casei BD-II]
          Length = 143

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 21/136 (15%), Positives = 48/136 (35%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +    + ID+KGR+ +P  FR  L    +             +        +  + K+
Sbjct: 1   MLMGEFERSIDAKGRLIIPAKFRDQLGASFVLTRGM-----DGCLFGYPIAEWDKLQTKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A   +  +        +D +GRI +   +    G++ +   VG     ++W
Sbjct: 56  ATLPLAKKDARTFTRFLFSAATECDIDKQGRINIPKPLFKHAGLQKDCVLVGVNTRIEVW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + + +  E +   +
Sbjct: 116 DAERWEQFAETAEENF 131


>gi|304411652|ref|ZP_07393264.1| MraZ protein [Shewanella baltica OS183]
 gi|307306296|ref|ZP_07586041.1| MraZ protein [Shewanella baltica BA175]
 gi|304349840|gb|EFM14246.1| MraZ protein [Shewanella baltica OS183]
 gi|306911169|gb|EFN41596.1| MraZ protein [Shewanella baltica BA175]
          Length = 152

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        L  L+ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LTLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q++ +  +E +     +
Sbjct: 121 DEQSWLQQIDECQETIRSE 139


>gi|167461085|ref|ZP_02326174.1| conserved protein MraZ [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 145

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 52/143 (36%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L    +             + V         EQK+
Sbjct: 1   MFMGEYQHSIDEKGRLIIPAKFRESLGASFVITRGL-----DNCLFVYPKSEWAVLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GR+ +   +  +  +E +   +G  N  ++W
Sbjct: 56  KSLPLMKADARAFTRFFFSGATESELDKQGRVNIAKNLAQYAKLEKDCVVIGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    + S   +  ++ +K
Sbjct: 116 SREIWENYFQTSEQSF-NEIAEK 137


>gi|116492953|ref|YP_804688.1| hypothetical protein PEPE_1192 [Pediococcus pentosaceus ATCC 25745]
 gi|122265583|sp|Q03EX6|MRAZ_PEDPA RecName: Full=Protein MraZ
 gi|116103103|gb|ABJ68246.1| hypothetical protein, MraZ [Pediococcus pentosaceus ATCC 25745]
          Length = 143

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 53/142 (37%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  L    +             + V         E+K+
Sbjct: 1   MFMGEFEHSLDSKGRLIIPSKFRDQLDSNFVVTRGL-----DGCLFVYPLSEWRLVEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++              +    +    D +GRI++   +R+   ++ E   VG  N  ++W
Sbjct: 56  SQLPSNKKNNRAFVRFMFADAVQCDFDKQGRIIIPKKLRLHAELQKECVLVGVSNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   + +  EE+   +   + +
Sbjct: 116 NKARWEETIEETEENF-DDIAE 136


>gi|297616972|ref|YP_003702131.1| MraZ protein [Syntrophothermus lipocalidus DSM 12680]
 gi|297144809|gb|ADI01566.1| MraZ protein [Syntrophothermus lipocalidus DSM 12680]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 49/138 (35%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      +D+KGR++VP  FR  L        +         + +         EQK+
Sbjct: 1   MFLGEYQHFLDTKGRMTVPAKFREGLGD-----TFVATKGLDNCLFLYPWPEWRTLEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G    ++D +GR ++   +R +  IE E+  VG G   ++W
Sbjct: 56  RSLPFTRKDVRAFVRFFFSGAAECEVDKQGRTVLPVPLREYARIEKEIVIVGVGTRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
             + +    + +   Y  
Sbjct: 116 ARELWENYLQTAGESYVE 133


>gi|225568666|ref|ZP_03777691.1| hypothetical protein CLOHYLEM_04744 [Clostridium hylemonae DSM
           15053]
 gi|225162594|gb|EEG75213.1| hypothetical protein CLOHYLEM_04744 [Clostridium hylemonae DSM
           15053]
          Length = 146

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 53/146 (36%), Gaps = 9/146 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  ID KGR+ +P  FR  L +  +             + V   D    FE K+
Sbjct: 1   MLKGEYSHNIDPKGRLIIPAKFRDDLGENFVITKGM-----ENCLYVYPEDEWNAFEDKL 55

Query: 63  AEYNPF-SIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
                    +A   +    G      +D +GR L+   +R +  +E EV F+G G   ++
Sbjct: 56  NALPTTTDKKARAFAYFFQGSATDGDLDKQGRTLIPSVLRTYAHLEKEVVFIGMGKRAEI 115

Query: 122 WNPQTFRKLQEESR---NEYCRQLLQ 144
           W+   + +   E      +    + +
Sbjct: 116 WDKARWDEKNAEVELNIEDIASDMEE 141


>gi|256379774|ref|YP_003103434.1| MraZ protein [Actinosynnema mirum DSM 43827]
 gi|255924077|gb|ACU39588.1| MraZ protein [Actinosynnema mirum DSM 43827]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D KGR+++P  FR  LA   +             + V      E   +K+
Sbjct: 1   MFLGTHHPRLDDKGRLTLPAKFRDALAGGLMVTK-----GQDHCLYVFPRAEFEQMARKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +         +  G    + D +GR+L+   +R + G+  E   +G  +  ++W
Sbjct: 56  AEAPFTNEAVRAYQRYLFAGTDEQRPDGQGRVLIAPELRRYAGLTKECVVIGAISRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +++  EE  + Y     +
Sbjct: 116 DAQAWQRYLEEHEDRYAEAREE 137


>gi|291615183|ref|YP_003525340.1| MraZ protein [Sideroxydans lithotrophicus ES-1]
 gi|291585295|gb|ADE12953.1| MraZ protein [Sideroxydans lithotrophicus ES-1]
          Length = 148

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 1/131 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  +R +L   C   L    D     + +      +   +K+
Sbjct: 1   MFQGATQLNLDSKGRLAIPARYRDMLLAHCAGQLVLTAD-ADGCLLIYPQPEWQPIREKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + + F+ +   L   + G      MD+ GR+L++  +R F  ++     VG+GN F+LW
Sbjct: 60  MQLSAFNPRIRALQRFLVGHAEDTVMDAAGRVLVSPTLRNFAVLDKRAMLVGQGNKFELW 119

Query: 123 NPQTFRKLQEE 133
           +   ++   E+
Sbjct: 120 DEARWQAQNEK 130


>gi|124515897|gb|EAY57406.1| MraZ family protein [Leptospirillum rubarum]
          Length = 148

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 56/137 (40%), Gaps = 3/137 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTIL--AQRCITDLYCFQDFFFPAISVGNSDLLEYF 58
           M+ F       +D KGRV++P  FR  L   ++    L    +     + V         
Sbjct: 1   MNIFRGRYQHSLDDKGRVAIPQRFRESLDGPEKGGGSLVITVEP-DECLVVYPESAWREL 59

Query: 59  EQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
           E+K+      +           G    ++ D +GRIL+   +R F  +E +V FVG  N 
Sbjct: 60  EEKVGALPQMNEDLKTYLRFTIGWATDVQPDRQGRILIPQPLRDFAHLERDVWFVGLLNK 119

Query: 119 FQLWNPQTFRKLQEESR 135
           F++WN     +L  + R
Sbjct: 120 FEIWNGDRLAQLTGKER 136


>gi|152998943|ref|YP_001364624.1| cell division protein MraZ [Shewanella baltica OS185]
 gi|217971624|ref|YP_002356375.1| cell division protein MraZ [Shewanella baltica OS223]
 gi|167012276|sp|A6WIC2|MRAZ_SHEB8 RecName: Full=Protein MraZ
 gi|254813291|sp|B8E4L1|MRAZ_SHEB2 RecName: Full=Protein MraZ
 gi|151363561|gb|ABS06561.1| MraZ protein [Shewanella baltica OS185]
 gi|217496759|gb|ACK44952.1| MraZ protein [Shewanella baltica OS223]
          Length = 152

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 60/139 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  L+ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q++ +  +E +     +
Sbjct: 121 DEQSWLQQIDECQETIRSE 139


>gi|238784577|ref|ZP_04628584.1| hypothetical protein yberc0001_11080 [Yersinia bercovieri ATCC
           43970]
 gi|238714543|gb|EEQ06548.1| hypothetical protein yberc0001_11080 [Yersinia bercovieri ATCC
           43970]
          Length = 146

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 3/138 (2%)

Query: 11  KIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSI 70
            +DSKGR++VP  +R +L +     + C  D   P + +      E  EQK++  +  + 
Sbjct: 3   NLDSKGRLAVPTRYRDLLNEESQGQMVCTIDLHQPCLLLYPLPEWEIIEQKLSRLSSMNP 62

Query: 71  QANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKL 130
              ++  L+ G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW+ QT+ + 
Sbjct: 63  AERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGLNKEVMLVGQFNKFELWDEQTWYQQ 122

Query: 131 QE---ESRNEYCRQLLQK 145
            +   ++       L ++
Sbjct: 123 VKDDIDAEQSTQEPLSER 140


>gi|156741092|ref|YP_001431221.1| MraZ protein [Roseiflexus castenholzii DSM 13941]
 gi|189028631|sp|A7NIA3|MRAZ_ROSCS RecName: Full=Protein MraZ
 gi|156232420|gb|ABU57203.1| MraZ protein [Roseiflexus castenholzii DSM 13941]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      ID KGR+++P  FR  L++     +   + F    +      + E   +++
Sbjct: 1   MFLGEYEHTIDDKGRLAIPARFRDALSE----GVVITRGF-DRCLMGFPRGVWEELARQV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     S +  QL  ++  G   + +D +GRIL+   +R F  + ++    G   +F++W
Sbjct: 56  SSLPIGSEETRQLQRMLFSGAADMSLDRQGRILIPQNLREFAELGDQAVIAGLNRHFEIW 115

Query: 123 NPQTFRKLQEESRNE---YCRQLLQ 144
           +P+ ++ +          + ++L +
Sbjct: 116 SPRRWQNVLSAMDANASLFAQKLAE 140


>gi|113971907|ref|YP_735700.1| cell division protein MraZ [Shewanella sp. MR-4]
 gi|117922184|ref|YP_871376.1| cell division protein MraZ [Shewanella sp. ANA-3]
 gi|123029268|sp|Q0HE74|MRAZ_SHESM RecName: Full=Protein MraZ
 gi|167012279|sp|A0L1Q1|MRAZ_SHESA RecName: Full=Protein MraZ
 gi|113886591|gb|ABI40643.1| MraZ protein [Shewanella sp. MR-4]
 gi|117614516|gb|ABK49970.1| MraZ protein [Shewanella sp. ANA-3]
          Length = 152

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  ++ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRMLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q + +  +E +     +
Sbjct: 121 DEQAWLQQIDECQETIRSE 139


>gi|89891775|ref|ZP_01203277.1| putative cell division protein, mraZ [Flavobacteria bacterium
           BBFL7]
 gi|89515930|gb|EAS18595.1| putative cell division protein, mraZ [Flavobacteria bacterium
           BBFL7]
          Length = 155

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     KID+KGR  +P   +  LA          +  F P + +           
Sbjct: 1   MINFIGTYECKIDAKGRFMMPVSLKKQLAPVLQEGFVLKRSVFQPCLELYPMKEWNEMMV 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++ + N F+ + N        G   +++D+ GR+L+   +     I   +T     N  +
Sbjct: 61  RMNKLNRFNKKNNDFIRRFTAGVKTVEIDANGRLLIPKDLIQIASITKNLTVSSAINIIE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+ +++ +  +E+  ++   L ++
Sbjct: 121 IWDKESYEQAIDEAAVDFAD-LAEE 144


>gi|254464023|ref|ZP_05077434.1| protein MraZ [Rhodobacterales bacterium Y4I]
 gi|206684931|gb|EDZ45413.1| protein MraZ [Rhodobacterales bacterium Y4I]
          Length = 208

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 66/151 (43%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCIT--------DLYCFQDFFFPAISVGNSD 53
            RF      K+DSKGRVS+P  FR +L               +  + D     +     +
Sbjct: 44  RRFRGESHHKVDSKGRVSIPASFRRVLEASDPNCDPGGNPELVIVYGDHRRQFLECYTME 103

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            +E  + KIA     S     L  + +G  +   +D  GR+++   +R   G+E E  F+
Sbjct: 104 AIEEVDAKIAALPRGSKGRKILERMFNGQSLPTTVDETGRLVLPAKLRQKIGLEGEAFFI 163

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+W P+T+ +++     +   +L +
Sbjct: 164 ASGDTFQIWKPETYEEVEMAEAEKLMEELPE 194


>gi|73662902|ref|YP_301683.1| cell division protein MraZ [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|91207105|sp|Q49WW0|MRAZ_STAS1 RecName: Full=Protein MraZ
 gi|72495417|dbj|BAE18738.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 61/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ VP  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYEHQLDTKGRMIVPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQVIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRQYANLSKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    +ES   +   + +
Sbjct: 116 DRETWSSFYDESEESF-EDIAE 136


>gi|23098916|ref|NP_692382.1| cell division protein MraZ [Oceanobacillus iheyensis HTE831]
 gi|51316468|sp|Q8ER54|MRAZ_OCEIH RecName: Full=Protein MraZ
 gi|22777143|dbj|BAC13417.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L    +             +     D  +  E+K+
Sbjct: 1   MFMGEFLHSIDTKGRIIVPSKFRDNLGSSFVVTRGL-----DKCLFAYPMDEWKILEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A   +     G I  ++D +GRI +   +R + G+E +   +G  N  + W
Sbjct: 56  KQLPLTKKDARAFTRFFFSGAIECEVDKQGRINIPANLRNYAGLEKDCNVIGVSNRVEFW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
               +     ES + +  
Sbjct: 116 ANDAWEDYVTESEDSFAE 133


>gi|69244719|ref|ZP_00602983.1| Protein of unknown function UPF0040 [Enterococcus faecium DO]
 gi|257879361|ref|ZP_05659014.1| mraZ family protein [Enterococcus faecium 1,230,933]
 gi|257881773|ref|ZP_05661426.1| MraZ family protein [Enterococcus faecium 1,231,502]
 gi|257890187|ref|ZP_05669840.1| MraZ family protein [Enterococcus faecium 1,231,410]
 gi|257893515|ref|ZP_05673168.1| MraZ family protein [Enterococcus faecium 1,231,408]
 gi|258615769|ref|ZP_05713539.1| cell division protein MraZ [Enterococcus faecium DO]
 gi|260558803|ref|ZP_05830992.1| marZ family protein [Enterococcus faecium C68]
 gi|293553180|ref|ZP_06673817.1| MraZ protein [Enterococcus faecium E1039]
 gi|293560479|ref|ZP_06676971.1| MraZ protein [Enterococcus faecium E1162]
 gi|293568305|ref|ZP_06679629.1| MraZ protein [Enterococcus faecium E1071]
 gi|294621598|ref|ZP_06700763.1| MraZ protein [Enterococcus faecium U0317]
 gi|314937876|ref|ZP_07845192.1| protein MraZ [Enterococcus faecium TX0133a04]
 gi|314941367|ref|ZP_07848260.1| protein MraZ [Enterococcus faecium TX0133C]
 gi|314950126|ref|ZP_07853412.1| protein MraZ [Enterococcus faecium TX0082]
 gi|314951333|ref|ZP_07854387.1| protein MraZ [Enterococcus faecium TX0133A]
 gi|314992836|ref|ZP_07858237.1| protein MraZ [Enterococcus faecium TX0133B]
 gi|314997996|ref|ZP_07862891.1| protein MraZ [Enterococcus faecium TX0133a01]
 gi|68196310|gb|EAN10739.1| Protein of unknown function UPF0040 [Enterococcus faecium DO]
 gi|257813589|gb|EEV42347.1| mraZ family protein [Enterococcus faecium 1,230,933]
 gi|257817431|gb|EEV44759.1| MraZ family protein [Enterococcus faecium 1,231,502]
 gi|257826547|gb|EEV53173.1| MraZ family protein [Enterococcus faecium 1,231,410]
 gi|257829894|gb|EEV56501.1| MraZ family protein [Enterococcus faecium 1,231,408]
 gi|260075262|gb|EEW63575.1| marZ family protein [Enterococcus faecium C68]
 gi|291589017|gb|EFF20841.1| MraZ protein [Enterococcus faecium E1071]
 gi|291598763|gb|EFF29815.1| MraZ protein [Enterococcus faecium U0317]
 gi|291602590|gb|EFF32805.1| MraZ protein [Enterococcus faecium E1039]
 gi|291605627|gb|EFF35069.1| MraZ protein [Enterococcus faecium E1162]
 gi|313588008|gb|EFR66853.1| protein MraZ [Enterococcus faecium TX0133a01]
 gi|313592640|gb|EFR71485.1| protein MraZ [Enterococcus faecium TX0133B]
 gi|313596550|gb|EFR75395.1| protein MraZ [Enterococcus faecium TX0133A]
 gi|313599790|gb|EFR78633.1| protein MraZ [Enterococcus faecium TX0133C]
 gi|313642734|gb|EFS07314.1| protein MraZ [Enterococcus faecium TX0133a04]
 gi|313643567|gb|EFS08147.1| protein MraZ [Enterococcus faecium TX0082]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 49/142 (34%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP   R  L ++ +             +        E  E K+
Sbjct: 1   MLMGEFQHNIDAKGRLIVPSKLREELGEKFVLTRGL-----DGCLFGYPMSEWENLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R +  +      +G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECELDKQGRINIPSTLRNYAALTKGCVVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++     +   +  ++ +
Sbjct: 116 DETRWQDFSAAAEENF-DEIAE 136


>gi|307944903|ref|ZP_07660240.1| protein MraZ [Roseibium sp. TrichSKD4]
 gi|307771827|gb|EFO31051.1| protein MraZ [Roseibium sp. TrichSKD4]
          Length = 156

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/143 (32%), Positives = 83/143 (58%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+++ T ++D+KGRVS+P  FRT+LA+     LY        AI  G + LL   + 
Sbjct: 1   MAGFVAHFTNRLDAKGRVSIPAPFRTVLAKDGFEGLYLIASSHCTAIDAGGNALLNEIQT 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++  ++  S   + L++ + G     K+DS+GR++++D +R  TG++++VTF G G  FQ
Sbjct: 61  RLDAFSKLSPDHDALAMALFGASETPKIDSDGRMVISDMVREHTGLKDQVTFAGMGYKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLL 143
           +W P+ FR+   E++      L 
Sbjct: 121 IWEPEKFREHSAEAKKRALAMLS 143


>gi|315038043|ref|YP_004031611.1| cell division protein MraZ [Lactobacillus amylovorus GRL 1112]
 gi|325956495|ref|YP_004291907.1| cell division protein MraZ [Lactobacillus acidophilus 30SC]
 gi|312276176|gb|ADQ58816.1| cell division protein MraZ [Lactobacillus amylovorus GRL 1112]
 gi|325333060|gb|ADZ06968.1| cell division protein MraZ [Lactobacillus acidophilus 30SC]
 gi|327183323|gb|AEA31770.1| cell division protein MraZ [Lactobacillus amylovorus GRL 1118]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P   R  +  + +             I   + D     E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKLREQIGDKMVFTRGM-----EGCIFGYSMDEWSKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A +   L + G +  + D +GR+ +T  ++    +  E   +G  N  ++W
Sbjct: 56  AKLPLTKRNARKFMRLFYSGAMECEFDKQGRVNLTATLKDHAKLIKECVIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +   +EE+  +Y
Sbjct: 116 SKERWDSFEEEANEDY 131


>gi|148379425|ref|YP_001253966.1| cell division protein MraZ [Clostridium botulinum A str. ATCC 3502]
 gi|182701728|ref|ZP_02614775.2| mraZ protein [Clostridium botulinum NCTC 2916]
 gi|148288909|emb|CAL82996.1| putatice cell division protein [Clostridium botulinum A str. ATCC
           3502]
 gi|182669144|gb|EDT81120.1| mraZ protein [Clostridium botulinum NCTC 2916]
          Length = 142

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 55/144 (38%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ +P  FR  L +  +             + V      E  ++K+
Sbjct: 1   MFIGEYNHGLDTKNRIIIPAKFREELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++W
Sbjct: 56  ETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESR--NEYCRQLLQ 144
           + + + +    +   +    Q+ +
Sbjct: 116 SKEKWEEYNNSNIDYDSIAEQMSE 139


>gi|222086452|ref|YP_002544987.1| MraZ protein [Agrobacterium radiobacter K84]
 gi|254813267|sp|B9JH60|MRAZ_AGRRK RecName: Full=Protein MraZ
 gi|221723900|gb|ACM27056.1| MraZ protein [Agrobacterium radiobacter K84]
          Length = 146

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 87/137 (63%), Positives = 114/137 (83%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLSN T +ID+KGRVSVP  FR++L +R I +LYCFQDF FPAISVG  DLL+ FE+
Sbjct: 1   MNRFLSNATNRIDAKGRVSVPAAFRSVLTERNIQELYCFQDFVFPAISVGGLDLLDRFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  ANQ+SLL+HGGG+F+++D+EGR+++TDFIR FTGI NEVTFVGR ++FQ
Sbjct: 61  QIAADDPFSPAANQMSLLIHGGGVFVRLDAEGRLMVTDFIRDFTGITNEVTFVGRADHFQ 120

Query: 121 LWNPQTFRKLQEESRNE 137
           LW P+ F+ LQ ++R E
Sbjct: 121 LWQPEAFQALQAQAREE 137


>gi|27467771|ref|NP_764408.1| cell division protein MraZ [Staphylococcus epidermidis ATCC 12228]
 gi|57866677|ref|YP_188326.1| cell division protein MraZ [Staphylococcus epidermidis RP62A]
 gi|282876391|ref|ZP_06285258.1| protein MraZ [Staphylococcus epidermidis SK135]
 gi|38258107|sp|Q8CSX8|MRAZ_STAES RecName: Full=Protein MraZ
 gi|68565679|sp|Q5HQ14|MRAZ_STAEQ RecName: Full=Protein MraZ
 gi|27315315|gb|AAO04450.1|AE016746_240 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57637335|gb|AAW54123.1| mraZ protein [Staphylococcus epidermidis RP62A]
 gi|281295416|gb|EFA87943.1| protein MraZ [Staphylococcus epidermidis SK135]
 gi|319401528|gb|EFV89738.1| mraZ family protein [Staphylococcus epidermidis FRI909]
 gi|329730027|gb|EGG66418.1| protein MraZ [Staphylococcus epidermidis VCU144]
 gi|329734458|gb|EGG70771.1| protein MraZ [Staphylococcus epidermidis VCU045]
 gi|329736282|gb|EGG72554.1| protein MraZ [Staphylococcus epidermidis VCU028]
          Length = 143

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 61/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEFDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLSKECTVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    +ES   +   + +
Sbjct: 116 DRETWNDFYDESEESF-EDIAE 136


>gi|291559196|emb|CBL37996.1| mraZ protein [butyrate-producing bacterium SSC/2]
          Length = 145

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 6/145 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS F+      ID+KGR+ +P  FR  L Q  +             + V   +  E F+ 
Sbjct: 1   MSMFMGEFNHTIDAKGRLIIPSRFREELGQEFVMTKGL-----DGCLFVFPQNEWESFQG 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+      +  A + S     G    +MD +GR L+   +R F  ++ EV   G  ++ +
Sbjct: 56  KLKTLPLINKDARKFSRFFMAGAAPCEMDKQGRTLIPATLREFAQMKKEVVLTGMADHIE 115

Query: 121 LWNPQTF-RKLQEESRNEYCRQLLQ 144
           +W+ + +      E  ++    + +
Sbjct: 116 IWSKEKWIENNSYEDMDDIAASMQE 140


>gi|302877569|ref|YP_003846133.1| MraZ protein [Gallionella capsiferriformans ES-2]
 gi|302580358|gb|ADL54369.1| MraZ protein [Gallionella capsiferriformans ES-2]
          Length = 148

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR+++P  +R  L   C  +L    D     + V           K+
Sbjct: 1   MFQGAAQLNLDGKGRLAIPARYRDRLLSNCAGNLVLTAD-ADGCLLVYPEPEWVTIRDKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F+ +A  L  L+ G    ++MD+ GR+L++  +R + G++  V  +G+GN F+LW
Sbjct: 60  NKLPSFNPRARALQRLIVGHAEDVQMDNAGRVLVSPVLRSYAGLDKSVMLIGQGNKFELW 119

Query: 123 NPQTF 127
           +   +
Sbjct: 120 DEVKW 124


>gi|326382551|ref|ZP_08204242.1| cell division protein MraZ [Gordonia neofelifaecis NRRL B-59395]
 gi|326198670|gb|EGD55853.1| cell division protein MraZ [Gordonia neofelifaecis NRRL B-59395]
          Length = 145

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 5/140 (3%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RF+   T K+D KGR+++P  FR  LA      +   +     ++SV  ++  +    
Sbjct: 1   MARFVGTYTPKLDDKGRLTLPAKFREALA----GGVMVTRS-QDRSLSVYRAEEFDAIAD 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K    +    +A         G    ++D +GR+ ++   R + G+  E   +G  ++ +
Sbjct: 56  KAVSASRNDPEARAFLRYFFAGADEQRLDGQGRVNLSAEHREYAGLSKECVVIGSYDHLE 115

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+ Q++R  Q++    +  
Sbjct: 116 IWDAQSWRDYQDQHEEAFSS 135


>gi|170761128|ref|YP_001786876.1| cell division protein MraZ [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169408117|gb|ACA56528.1| mraZ protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 156

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 54/145 (37%), Gaps = 7/145 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D K R+ +P  FR  L +  +             + V      E  ++K
Sbjct: 14  DMFIGEYNHGLDIKNRIIIPAKFRAELGKNFVLTKGL-----DGCLYVYPKSQWEVLQKK 68

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      +  A         G   L++D +GR L+   +  +  I+ E+  +G  N  ++
Sbjct: 69  LETLPLTNKNARAFVRFFFSGAHELELDKQGRTLIPQNLLEYGQIQKEIVSIGVSNRIEI 128

Query: 122 WNPQTFRKLQEESR--NEYCRQLLQ 144
           W+ + + +    +   +    Q+ +
Sbjct: 129 WSKEKWEEYNNSNIDYDSIAEQMSE 153


>gi|300361451|ref|ZP_07057628.1| cell division protein MraZ [Lactobacillus gasseri JV-V03]
 gi|300354070|gb|EFJ69941.1| cell division protein MraZ [Lactobacillus gasseri JV-V03]
          Length = 143

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 57/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  + ++ +             I     +  +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRDEIGEKMVFTRGM-----EGCIFGYPIEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTKRSARKFTRLFYSGAMESEFDKQGRVNLTMTLKEHAALTKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    EE+   Y
Sbjct: 116 SAERWNDFSEEANENY 131


>gi|330957979|gb|EGH58239.1| cell division protein MraZ [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 151

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    +    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDAKGRLAMPSRYRDELDSRSAGQMIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|317484854|ref|ZP_07943746.1| mraZ protein [Bilophila wadsworthia 3_1_6]
 gi|316923900|gb|EFV45094.1| mraZ protein [Bilophila wadsworthia 3_1_6]
          Length = 149

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F     + +D+KGR+ +P  FR  L        +     +   +    + L    E++ 
Sbjct: 2   LFRGQSYRSLDAKGRLMLPPEFRDALTAASADGTFVLT-TYDGCLVGYPAPLWNELEERF 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S +      LV GG      D++GRI ++     + G+E++   VG+G+ F++W
Sbjct: 61  GRLRNSSRKIRDFRRLVLGGAEDQSFDAQGRIRLSRAHVEYAGLEHDAVVVGQGDKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   F+ L  +  ++   +L +
Sbjct: 121 DQARFKALLSQDFDDVADELAE 142


>gi|238019058|ref|ZP_04599484.1| hypothetical protein VEIDISOL_00920 [Veillonella dispar ATCC 17748]
 gi|237864313|gb|EEP65603.1| hypothetical protein VEIDISOL_00920 [Veillonella dispar ATCC 17748]
          Length = 141

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 58/140 (41%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ +P   R  L + CI             +++   +  +     +  
Sbjct: 1   MGEYNHTIDTKGRMIIPAKIREQLGEVCIVTKGL-----DNCLAIYTEEAWKKISAALQS 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
            +        L   V G    L+ D +GR+L+   +R +  ++ +   VG G++ ++W+ 
Sbjct: 56  QSSTKASVRALKRFVFGSAAELEYDKQGRVLIPVPLREYASLDKQAVIVGAGDHVEIWSR 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
           + +    ++   E   +L++
Sbjct: 116 EKYD-YYDDQVAESMEELVE 134


>gi|89074179|ref|ZP_01160678.1| hypothetical protein SKA34_22467 [Photobacterium sp. SKA34]
 gi|89050115|gb|EAR55641.1| hypothetical protein SKA34_22467 [Photobacterium sp. SKA34]
          Length = 152

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 63/143 (44%), Gaps = 5/143 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGR ++P  +R  +   C     C  D  F  + +   +   + E K+
Sbjct: 1   MLRGATVVSLDNKGRFAIPKRYRAEILNHCDGLFVCTIDHQFSCLLLYPMNEWVHIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +       ++  L+ G      MD +GRIL+   +R +  +++++  VG+ N F++W
Sbjct: 61  ATLSSLHPAERRIQRLLLGHASECDMDGQGRILLPATLREYAYLQDKIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQE-----ESRNEYCR 140
           +   +++  E     ++ +   +
Sbjct: 121 SESLWQQQIEHDINLQAEDAIAQ 143


>gi|327479634|gb|AEA82944.1| cell division protein MraZ [Pseudomonas stutzeri DSM 4166]
          Length = 151

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 58/132 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D     + +      E  E K+
Sbjct: 1   MFRGANAISLDAKGRLAMPSRYRDELNSRGDGQLIITIDAVDRCLCIYPLPEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      +A +L  L+ G  + L+MD  GR+++   +R +  ++     VG+ N FQLW
Sbjct: 61  RELPSLREEARRLQRLLIGNAVDLEMDGSGRVVVPPRLREYARLDKRAMLVGQLNKFQLW 120

Query: 123 NPQTFRKLQEES 134
           N   +  + +  
Sbjct: 121 NEDDWNAISDAD 132


>gi|145595736|ref|YP_001160033.1| cell division protein MraZ [Salinispora tropica CNB-440]
 gi|189028635|sp|A4X9S4|MRAZ_SALTO RecName: Full=Protein MraZ
 gi|145305073|gb|ABP55655.1| MraZ protein [Salinispora tropica CNB-440]
          Length = 142

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  LA      +   +      + V  +   ++   ++
Sbjct: 1   MFLGTHTPRLDDKGRLILPAKFRDELA----GGVVITKG-QERCLYVFPTPEFQHIADQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   S +          D +GR+ +   +R +  ++ ++  +G     ++W
Sbjct: 56  RAQPMTHKAARAYSRVFFASAHDEVPDKQGRVTIPGHLREYAALDRDLVVIGAHTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     ES +E+  
Sbjct: 116 DRVAWESYLAESEDEFAD 133


>gi|255536598|ref|YP_003096969.1| Cell division protein mraZ [Flavobacteriaceae bacterium 3519-10]
 gi|255342794|gb|ACU08907.1| Cell division protein mraZ [Flavobacteriaceae bacterium 3519-10]
          Length = 159

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 54/145 (37%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     KID KGR+ +P      +           +  F   + V      E   +
Sbjct: 4   MKNFIGTYECKIDDKGRLKLPSSLVKQMENFGGDAFVVKRSVFQSCLEVYPMAGWEKLME 63

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI   N F  +          G   ++ D+ GR+ +   +  F  ++ EV     G  F+
Sbjct: 64  KINGLNRFQKKNADFIRQFTAGLKTVEPDNVGRLQIPKDLVGFAKLKKEVVITSAGGLFE 123

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   +  +   S  ++ + L ++
Sbjct: 124 IWDKDAYESVIATSEEDFAK-LAEE 147


>gi|330877142|gb|EGH11291.1| cell division protein MraZ [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330964048|gb|EGH64308.1| cell division protein MraZ [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 151

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    +    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDAKGRLAMPSRYRDELDSRSAGQMIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|325288821|ref|YP_004265002.1| Protein mraZ [Syntrophobotulus glycolicus DSM 8271]
 gi|324964222|gb|ADY55001.1| Protein mraZ [Syntrophobotulus glycolicus DSM 8271]
          Length = 144

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ VP  FR  L    I             + +      + FE+K+
Sbjct: 2   MFMGEYLHTIDNKGRLIVPVKFRESLGDHFIATKGL-----DNCLFIFPLKEWKSFEEKL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A         G    ++D +GRIL+   +R +  ++ +V   G  N  ++W
Sbjct: 57  KQLPISRPNARSFVRFFFSGAAECELDKQGRILLPANLREYASLDKDVILAGVMNRIEIW 116

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   ++     + + Y  
Sbjct: 117 DNSRWKDYSSNAEDHYAE 134


>gi|227893330|ref|ZP_04011135.1| cell division protein MraZ [Lactobacillus ultunensis DSM 16047]
 gi|227864745|gb|EEJ72166.1| cell division protein MraZ [Lactobacillus ultunensis DSM 16047]
          Length = 143

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P   R  +  + +             +   + +     E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKLRDQIGNKMVFTRGM-----EGCVFGYSMEEWSKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         +   L + G +  + D +GR+ +T  ++   G+  E   +G  +  ++W
Sbjct: 56  AKLPLTKRNTRKFMRLFYSGAMESEFDKQGRVNLTATLKAHAGLTKECVIIGVSDRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           +   +   +EE+ ++Y
Sbjct: 116 SQDRWDSFEEEANDDY 131


>gi|332292525|ref|YP_004431134.1| MraZ protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170611|gb|AEE19866.1| MraZ protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 156

 Score =  132 bits (332), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M   +     KID+KGR+ +P  F+  LA          +  F   + +           
Sbjct: 1   MINLIGTYECKIDAKGRLMLPQAFKKQLAPILQDGFVLKRAVFQKCLELYPIAEWNTLSA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ + N F+ + ++     + G   +++D  GR+L++  +  F  +E  +      N  +
Sbjct: 61  KVNKLNRFNKKNDEFIRRFNAGVKPVEVDGTGRVLVSKDLGNFAKLEKSIVVNAAFNILE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   + K  +E+  ++   L ++
Sbjct: 121 IWDKDLYEKAIDEAAVDFAD-LAEE 144


>gi|331090605|ref|ZP_08339456.1| mraZ protein [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330401045|gb|EGG80640.1| mraZ protein [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 145

 Score =  132 bits (332), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    ID+KGR+ +P  FR  L +  +             + +   +  + FE+K+
Sbjct: 1   MLTGEFNHSIDAKGRLIIPSKFRENLGENFVITKGL-----DGCLFLYPDNEWKTFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A   +    G  +   +D +GR+L++  +R F  +E EV  VG  +  ++W
Sbjct: 56  RTLPLTNKDARIFTRFFLGSAVDGGLDKQGRVLISSALRNFARLEKEVVLVGVLDRVEIW 115

Query: 123 NPQTFRK---LQEESRNEYCRQLLQ 144
           +   + +   + E++ ++    + +
Sbjct: 116 DKAKWEENNTVIEDNMDDIASHMEE 140


>gi|153814617|ref|ZP_01967285.1| hypothetical protein RUMTOR_00831 [Ruminococcus torques ATCC 27756]
 gi|317501223|ref|ZP_07959428.1| MraZ protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331090031|ref|ZP_08338920.1| mraZ protein [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848111|gb|EDK25029.1| hypothetical protein RUMTOR_00831 [Ruminococcus torques ATCC 27756]
 gi|316897399|gb|EFV19465.1| MraZ protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330402493|gb|EGG82062.1| mraZ protein [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 145

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 52/143 (36%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID KGR+ +P   R  L        +   +     + V + +    F  ++
Sbjct: 1   MLLGEFNHSIDEKGRLIIPAKLRDDLGDS-----FVICNGLEGCLFVYSQEEWNKFVAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S  A        G       D +GR+L+   +R   G+E +V  VG  +  ++W
Sbjct: 56  ETLPRMSKDARIFKRYFFGSASEGSFDKQGRVLVPPSLRKAAGLEKDVVLVGVQDRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +  + S  +    + ++
Sbjct: 116 DKALWEERSQISEEDL-DAIAER 137


>gi|15965938|ref|NP_386291.1| cell division protein MraZ [Sinorhizobium meliloti 1021]
 gi|307308248|ref|ZP_07587957.1| cell division protein MraZ [Sinorhizobium meliloti BL225C]
 gi|307319715|ref|ZP_07599140.1| protein MraZ [Sinorhizobium meliloti AK83]
 gi|20139050|sp|Q92NL3|MRAZ_RHIME RecName: Full=Protein MraZ
 gi|15075207|emb|CAC46764.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306894646|gb|EFN25407.1| protein MraZ [Sinorhizobium meliloti AK83]
 gi|306901246|gb|EFN31852.1| cell division protein MraZ [Sinorhizobium meliloti BL225C]
          Length = 146

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 84/136 (61%), Positives = 113/136 (83%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLS+VT +ID+KGRVSVP VFR +L +  + +LYCFQDF FPAISVG  +LL+ FE+
Sbjct: 1   MNRFLSHVTNRIDAKGRVSVPSVFRAVLLEAGVRELYCFQDFVFPAISVGGPELLDRFEK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++A  +PFS  AN++SLLVHGGG+++K+D EGR+++TDFIR FTGI N+VTFVGRG++FQ
Sbjct: 61  QMAAEDPFSDAANEMSLLVHGGGVYVKLDPEGRLMVTDFIRDFTGISNDVTFVGRGDHFQ 120

Query: 121 LWNPQTFRKLQEESRN 136
           LW+PQ F + Q E+R 
Sbjct: 121 LWDPQAFARAQAEARE 136


>gi|331696612|ref|YP_004332851.1| protein mraZ [Pseudonocardia dioxanivorans CB1190]
 gi|326951301|gb|AEA24998.1| Protein mraZ [Pseudonocardia dioxanivorans CB1190]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  L    +             + V   +       KI
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDDLRGGLMITK-----GQDHCLYVFTREAFGEMAAKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +  A      +  G      D++GRI +T  +R + G+  +   +G     ++W
Sbjct: 56  ASAPLTNEAARAFQRNLFAGTDEQNPDAQGRIAITPELRRYAGLTKDCVVIGAFTRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +   Q+   ++Y +   +
Sbjct: 116 DAQAWADYQQRHEDDYAKAQEE 137


>gi|326204084|ref|ZP_08193945.1| MraZ protein [Clostridium papyrosolvens DSM 2782]
 gi|325985851|gb|EGD46686.1| MraZ protein [Clostridium papyrosolvens DSM 2782]
          Length = 146

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 8/144 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID KGR  VP  FR  L ++ I             +   +S+     E K+
Sbjct: 4   LFYGEYQHTIDPKGRAIVPSKFREGLGEKFILTKGL-----DGCLFAYSSEEWTSLENKL 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                              G    ++D +GRIL+   +R +  +E ++  +G  +  ++W
Sbjct: 59  KSLPFTDKDVRAFIRFFFSGATECEVDKQGRILIPQNLREYAALEKDIYIIGVSSRVEIW 118

Query: 123 NPQTFRKLQEE---SRNEYCRQLL 143
               +     +   S ++   ++ 
Sbjct: 119 KKAAWEAYNSDDNISADKIAEKMA 142


>gi|298346699|ref|YP_003719386.1| cell division protein MraZ [Mobiluncus curtisii ATCC 43063]
 gi|304389592|ref|ZP_07371554.1| cell division protein MraZ [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|315655244|ref|ZP_07908145.1| cell division protein MraZ [Mobiluncus curtisii ATCC 51333]
 gi|315656835|ref|ZP_07909722.1| cell division protein MraZ [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|298236760|gb|ADI67892.1| cell division protein MraZ [Mobiluncus curtisii ATCC 43063]
 gi|304327145|gb|EFL94381.1| cell division protein MraZ [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|315490499|gb|EFU80123.1| cell division protein MraZ [Mobiluncus curtisii ATCC 51333]
 gi|315492790|gb|EFU82394.1| cell division protein MraZ [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 167

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 57/137 (41%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL     K+D KGR+ +P  FR  LA      +   +      +    +   +    ++ 
Sbjct: 26  FLGTYEPKLDDKGRLILPARFREQLA----GGVVLTKG-QDHCVYAFETGEFQALYAELR 80

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +      QA   S ++  G      D +GRI +   +R + G++ ++   G G+  ++W+
Sbjct: 81  QAPLTHKQARNFSRVLLSGASDQIPDKQGRINIPPALREYAGLDRDLAVFGAGSRVEIWD 140

Query: 124 PQTFRKLQEESRNEYCR 140
            +T+ +    +  ++  
Sbjct: 141 LKTWNEFLAAAEEDFSE 157


>gi|46580917|ref|YP_011725.1| cell division protein MraZ [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601782|ref|YP_966182.1| cell division protein MraZ [Desulfovibrio vulgaris DP4]
 gi|51316271|sp|Q728T9|MRAZ_DESVH RecName: Full=Protein MraZ
 gi|167012239|sp|A1VBD9|MRAZ_DESVV RecName: Full=Protein MraZ
 gi|46450337|gb|AAS96985.1| mraZ protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562011|gb|ABM27755.1| MraZ protein [Desulfovibrio vulgaris DP4]
 gi|311234608|gb|ADP87462.1| MraZ protein [Desulfovibrio vulgaris RCH1]
          Length = 149

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F     + +D KGR+ +P  FR IL  R          F    +          FE K 
Sbjct: 2   LFRGRSHRSLDPKGRLMLPPEFRDILLSRSEEGKLVLTSF-DGCVVGYPYPDWVEFEDKF 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S +      LV GG   +  D +GR+ ++     + G+  +V  VG+G+ F++W
Sbjct: 61  NRLKNPSRKMRDFRRLVIGGAEEMTADPQGRVRVSRSHMDYAGLTKDVVLVGQGSRFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   F  +  +  ++   +L +
Sbjct: 121 DQSKFDAIVAQDFDDVTEELAE 142


>gi|299143949|ref|ZP_07037029.1| MraZ protein [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518434|gb|EFI42173.1| MraZ protein [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 53/145 (36%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D+KGRV +P   R  L    +             + V  ++  +  E K+
Sbjct: 1   MLIGEYRHSLDNKGRVMIPSKLREDLGDNFVITKGL-----DKCLFVYPNEEWKRIENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +  A     +   G     +D +GR L+   +R    I  +V  +G     ++W
Sbjct: 56  KELPMTNKAARSFIRIFFSGATNEDLDKQGRALIPQNLREHAEILKDVVIIGASTRAEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           + + +    ++   S  E   ++ +
Sbjct: 116 SSENWDSYNDDEGLSYEEVAEKMAE 140


>gi|227903686|ref|ZP_04021491.1| cell division protein MraZ [Lactobacillus acidophilus ATCC 4796]
 gi|227868573|gb|EEJ75994.1| cell division protein MraZ [Lactobacillus acidophilus ATCC 4796]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 55/136 (40%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P   R  +  + +             I     +  +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKLREQIGDKMVLTRGM-----EGCIFGYPMEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         +   + + G +  + D +GR+ +T  +++   +      +G  +  ++W
Sbjct: 56  AKLPLTKRNTRKFMRMFYSGAMECEFDKQGRVNLTPTLKLHAKLIKNCVIIGVSDRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +   +EE+  +Y
Sbjct: 116 SKERWESFEEEANEDY 131


>gi|108763594|ref|YP_633753.1| cell division protein MraZ [Myxococcus xanthus DK 1622]
 gi|123074069|sp|Q1D0S0|MRAZ_MYXXD RecName: Full=Protein MraZ
 gi|108467474|gb|ABF92659.1| mraZ protein [Myxococcus xanthus DK 1622]
          Length = 150

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 54/138 (39%), Gaps = 1/138 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F      +ID+KGR S+P   R  L       L          +        E  E  +
Sbjct: 1   MFRGVYEHQIDAKGRTSLPAKLRDTLVGAYDERLILTTAL-DRCLHAYPVREWEALELSL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ NP       L  L         +D  GR+L+   +R + G+E EV + G     +LW
Sbjct: 60  AKRNPMEPGVKTLMRLYVASAQECPLDKLGRLLIPPTLRSYAGLEKEVVWAGMVKVIELW 119

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + K QEE+R E   
Sbjct: 120 SREGWAKAQEEARQEATS 137


>gi|114570637|ref|YP_757317.1| hypothetical protein Mmar10_2087 [Maricaulis maris MCS10]
 gi|114341099|gb|ABI66379.1| protein of unknown function UPF0040 [Maricaulis maris MCS10]
          Length = 165

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 65/133 (48%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FLS     +D+KGRVSVP  FR ++       +  +  F  P +  G   LLE ++  I 
Sbjct: 15  FLSTTINGVDAKGRVSVPADFRAVVRGGPFDGIIVWPSFDGPYLEGGGQALLERYQALIE 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E +P+          + G    L  D+ GR+ +        G++ + TFVG G+ F++W+
Sbjct: 75  EMDPYDDARIAFERAIFGAARPLAFDANGRVTLPKEFAEHAGLDAKATFVGLGSRFEIWS 134

Query: 124 PQTFRKLQEESRN 136
           P+ F + +  +++
Sbjct: 135 PERFEEHKSNAQS 147


>gi|329766777|ref|ZP_08258307.1| mraZ protein [Gemella haemolysans M341]
 gi|328839288|gb|EGF88870.1| mraZ protein [Gemella haemolysans M341]
          Length = 143

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 54/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGR+S+P  FR  L ++ I             +   +    +  E KI
Sbjct: 1   MFIGQYNNKMDAKGRLSIPIKFRDELGEKFIITRGL-----DSCLFGYSLQEWQKVESKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G   +++D +GRI + + +     ++ +    G  N  ++W
Sbjct: 56  KSLPITKKNARTFQRFFFSGATEVEIDKQGRINIPNALIEHAFLDKDCVVNGLSNRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   +  L  ES     E   +L  
Sbjct: 116 DKNRWEDLLVESEASVEEIAEELED 140


>gi|227875246|ref|ZP_03993388.1| cell division protein MraZ [Mobiluncus mulieris ATCC 35243]
 gi|306818508|ref|ZP_07452231.1| cell division protein MraZ [Mobiluncus mulieris ATCC 35239]
 gi|227844151|gb|EEJ54318.1| cell division protein MraZ [Mobiluncus mulieris ATCC 35243]
 gi|304648681|gb|EFM45983.1| cell division protein MraZ [Mobiluncus mulieris ATCC 35239]
          Length = 154

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 58/144 (40%), Gaps = 6/144 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + FL     K+D KGR+ +P  FR  L+                 I    +   E    +
Sbjct: 11  NVFLGTYEPKLDDKGRLILPSRFRDQLSAG-----VVLTPGQERCIYAFPTSEFETIYDE 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +      +A + S ++  G      D +GRI +   +R + G+   +  +G G   ++
Sbjct: 66  LRQAPLTHKEARKFSRVMLSGATDQIPDKQGRINIPANLRQYAGLNKNLKVIGAGARAEI 125

Query: 122 WNPQTFRKLQEESRNEYCRQLLQK 145
           W+  T+     ES + +  ++ ++
Sbjct: 126 WDADTWDTYLSESEDAFA-EIAEE 148


>gi|296269377|ref|YP_003652009.1| MraZ protein [Thermobispora bispora DSM 43833]
 gi|296092164|gb|ADG88116.1| MraZ protein [Thermobispora bispora DSM 43833]
          Length = 143

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 55/143 (38%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D KGR+ +P  +R  LA+     L   +      + V   +      + +
Sbjct: 1   MFLGTHHPRLDDKGRLFLPAKYREELAE----GLVITKG-QERCLYVFPVEEFRRITEAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +        K D +GRI +   +R + G+E +   +G     ++W
Sbjct: 56  RAAPLTAKAVRDYSRVFFASASDEKPDKQGRITIPQSLREYAGLERDCVVIGANTRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      ++ +   +L ++
Sbjct: 116 DAKAWETYLA-AQEQAFSELSEE 137


>gi|56696071|ref|YP_166425.1| cell division protein MraZ [Ruegeria pomeroyi DSS-3]
 gi|68565689|sp|Q5LU80|MRAZ_SILPO RecName: Full=Protein MraZ
 gi|56677808|gb|AAV94474.1| MraZ, putative [Ruegeria pomeroyi DSS-3]
          Length = 167

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
            RF      K+DSKGRVS+P  FR +L               +  + D     +     +
Sbjct: 3   RRFRGESNHKVDSKGRVSIPASFRRVLEAGDPNWQSGGNPELVIVYGDHRRKFLECYTME 62

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            ++  + KI      S++   L  + HG      +D  GR+++   +R    +E+E  F+
Sbjct: 63  AIDEVDAKIDALPRGSMERKMLQRMFHGQSFPTSVDETGRLVLPAKLRTKIALEDEAFFI 122

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+WNP T+ + +  +  E+  +L +
Sbjct: 123 AAGDTFQIWNPATYDQEELAAAEEWLDELPE 153


>gi|126172645|ref|YP_001048794.1| cell division protein MraZ [Shewanella baltica OS155]
 gi|167012275|sp|A3CZL2|MRAZ_SHEB5 RecName: Full=Protein MraZ
 gi|125995850|gb|ABN59925.1| MraZ protein [Shewanella baltica OS155]
          Length = 152

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 59/139 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +        L  L+ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q++ +  +E       +
Sbjct: 121 DEQSWLQQIDECLETIRSE 139


>gi|119469205|ref|ZP_01612189.1| hypothetical protein ATW7_18955 [Alteromonadales bacterium TW-7]
 gi|119447457|gb|EAW28725.1| hypothetical protein ATW7_18955 [Alteromonadales bacterium TW-7]
          Length = 152

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 57/134 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR +VP  +R  L       + C      P + +      +  E ++
Sbjct: 1   MFRGASSLSLDDKGRFAVPTKYRESLLSEDQGTVICTVALNEPCLWLYPLAEWQEIESRL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +  + +A ++  ++ G     ++D  GRIL+   +R    +  ++  VG  N F++W
Sbjct: 61  AKISNMNPRARRMQRMLLGNATEYQLDKNGRILLAPSLRAHADLGKKIMLVGLMNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   + +   +   
Sbjct: 121 DEARWNEQMRQDTE 134


>gi|300741255|ref|ZP_07071276.1| MraZ protein [Rothia dentocariosa M567]
 gi|311113331|ref|YP_003984553.1| cell division protein MraZ [Rothia dentocariosa ATCC 17931]
 gi|300380440|gb|EFJ77002.1| MraZ protein [Rothia dentocariosa M567]
 gi|310944825|gb|ADP41119.1| cell division protein MraZ [Rothia dentocariosa ATCC 17931]
          Length = 143

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D+KGR+ +P  FR  L+      L   +      + V      E   + +
Sbjct: 1   MFLGTYTPRLDTKGRIILPAKFRDELSA----GLVLTRG-QERCLYVFPVAEFERIHETM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   QA     +   G      D +GR+ +   +R + G+  E+T +G G+  ++W
Sbjct: 56  RSSPLPGRQARDFMRMFLSGASDEVPDKQGRVTIPPVLREYAGLSQELTVIGSGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +   ++  E+  
Sbjct: 116 DSKAWEEYMAQTEAEFAS 133


>gi|260893421|ref|YP_003239518.1| MraZ protein [Ammonifex degensii KC4]
 gi|260865562|gb|ACX52668.1| MraZ protein [Ammonifex degensii KC4]
          Length = 149

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 62/145 (42%), Gaps = 6/145 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+      +D+KGR+ +P   R  L +R +             +   ++      E+
Sbjct: 1   MPVFIGTYVHTLDNKGRLFIPARLREGLGERFVVTKGL-----EGCLFGFSASEWTQLEE 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ +      +    + L   G   L++D +GR+L+  ++R +  ++ EV  +G  N  +
Sbjct: 56  KLLKLPFTQPEVRAFARLFFAGAAELEVDRQGRVLIPPYLREYAQLQREVVILGVANRVE 115

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
            W  + + + Q E++     +L  K
Sbjct: 116 FWAQELWERYQAETQA-VYEELAAK 139


>gi|308235563|ref|ZP_07666300.1| protein mraZ [Gardnerella vaginalis ATCC 14018]
 gi|311114348|ref|YP_003985569.1| cell division protein MraZ [Gardnerella vaginalis ATCC 14019]
 gi|310945842|gb|ADP38546.1| cell division protein MraZ [Gardnerella vaginalis ATCC 14019]
          Length = 257

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 54/137 (39%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L     KID KGRV++P  FR+ L           +      + V      +    +I 
Sbjct: 115 LLGTYAPKIDGKGRVALPAKFRSQLG----NGFVMARG-QERCVYVLPMQEFQRITTQIQ 169

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
             +  +  A     +   G +  + D +GRI++   +R +  + +E+  +G G   ++WN
Sbjct: 170 RTSMSNKSARDYLRVFLSGAVDQEPDKQGRIVVPPMLRDYANLGDEIVVIGVGTRAEIWN 229

Query: 124 PQTFRKLQEESRNEYCR 140
              + +   +   +Y  
Sbjct: 230 KSAWNEYLADREQDYAD 246


>gi|241888442|ref|ZP_04775753.1| MraZ protein [Gemella haemolysans ATCC 10379]
 gi|241864884|gb|EER69255.1| MraZ protein [Gemella haemolysans ATCC 10379]
          Length = 143

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 54/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGR+S+P  FR  L ++ I             +   +    +  E KI
Sbjct: 1   MFIGQYNNKMDAKGRLSIPIKFRDELGEKFIITRGL-----DSCLFGYSLQEWQKVESKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G   +++D +GRI + + +     ++ E    G  N  ++W
Sbjct: 56  KSLPITKKNARTFQRFFFSGATEVEIDKQGRINIPNALIEHAFLDKECVVNGLSNRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   +  L  ES     E   +L  
Sbjct: 116 DKTRWEDLLVESEASVEEIAEELED 140


>gi|166031197|ref|ZP_02234026.1| hypothetical protein DORFOR_00883 [Dorea formicigenerans ATCC
           27755]
 gi|166029044|gb|EDR47801.1| hypothetical protein DORFOR_00883 [Dorea formicigenerans ATCC
           27755]
          Length = 166

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 53/134 (39%), Gaps = 6/134 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  ID+KGR+ +P  FR  L +  +             + V   D    FE+K+
Sbjct: 21  MLKGEYSHNIDAKGRLIIPAKFRDDLGENFVITKGM-----ENCLYVYPEDEWNDFEKKL 75

Query: 63  AEYNPF-SIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
                    +A   +    G     ++D +GR L+   +R +  ++ EV FVG G   ++
Sbjct: 76  NALPTTTDKKARAFAYFFQGSAADGELDKQGRTLIPSVLRTYAKLDKEVVFVGMGKRAEI 135

Query: 122 WNPQTFRKLQEESR 135
           W+   + +   E  
Sbjct: 136 WDKARWDEKNAEVE 149


>gi|71737166|ref|YP_276239.1| cell division protein MraZ [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257483457|ref|ZP_05637498.1| cell division protein MraZ [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289624973|ref|ZP_06457927.1| cell division protein MraZ [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647031|ref|ZP_06478374.1| cell division protein MraZ [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289677688|ref|ZP_06498578.1| cell division protein MraZ [Pseudomonas syringae pv. syringae FF5]
 gi|298488526|ref|ZP_07006556.1| Cell division protein mraZ [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|302185278|ref|ZP_07261951.1| cell division protein MraZ [Pseudomonas syringae pv. syringae 642]
 gi|91207206|sp|Q48EE9|MRAZ_PSE14 RecName: Full=Protein MraZ
 gi|71557719|gb|AAZ36930.1| mraZ protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156867|gb|EFH97957.1| Cell division protein mraZ [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322459|gb|EFW78552.1| cell division protein MraZ [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320330072|gb|EFW86059.1| cell division protein MraZ [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330868706|gb|EGH03415.1| cell division protein MraZ [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330875018|gb|EGH09167.1| cell division protein MraZ [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330895238|gb|EGH27576.1| cell division protein MraZ [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330938025|gb|EGH41805.1| cell division protein MraZ [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330950235|gb|EGH50495.1| cell division protein MraZ [Pseudomonas syringae Cit 7]
 gi|330987125|gb|EGH85228.1| cell division protein MraZ [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331011569|gb|EGH91625.1| cell division protein MraZ [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 151

 Score =  131 bits (330), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    L    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDAKGRLAMPSRYRDELDSRSAGQLIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYARLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|114564963|ref|YP_752477.1| cell division protein MraZ [Shewanella frigidimarina NCIMB 400]
 gi|122298406|sp|Q07WH6|MRAZ_SHEFN RecName: Full=Protein MraZ
 gi|114336256|gb|ABI73638.1| MraZ protein [Shewanella frigidimarina NCIMB 400]
          Length = 152

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 52/131 (39%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINMDAKGRIAIPARYRDALRVEHAGTVIMTVDIDAACLLIYPLHEWEQIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +            + G     ++DS GRI++   +R F  +E +   VG  N F+LW
Sbjct: 61  KLLSDTDPLERSFKRKLLGHAQDCELDSHGRIVIPPALRSFASLEKKTMLVGLLNKFELW 120

Query: 123 NPQTFRKLQEE 133
               +++  ++
Sbjct: 121 EESAWQQQMDD 131


>gi|332638185|ref|ZP_08417048.1| cell division protein MraZ [Weissella cibaria KACC 11862]
          Length = 144

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 62/137 (45%), Gaps = 6/137 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ +P  FR  L    +   +        ++        + F  KI
Sbjct: 1   MFMGTYQHTLDTKNRLIIPAKFRNQLGDAFVITRWM-----DHSLRAYTMSGWQDFSAKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRG-NYFQL 121
                 + +A Q    V GG + ++ D +GR+ ++  +R +  I+ +VT  G G + F+L
Sbjct: 56  NALPETNAKARQFKRFVFGGALEVEFDKQGRVNLSQTLREYANIDKDVTVFGLGDDTFEL 115

Query: 122 WNPQTFRKLQEESRNEY 138
           W+ + ++  +EE+   +
Sbjct: 116 WSAEKWQAYEEETAENF 132


>gi|302528478|ref|ZP_07280820.1| mraZ protein [Streptomyces sp. AA4]
 gi|302437373|gb|EFL09189.1| mraZ protein [Streptomyces sp. AA4]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +             + V      E   +K+
Sbjct: 1   MFLGTHTPKLDDKGRLTLPAKFREALAGGLMVTK-----GQDHCLFVFPRAEFEQMARKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +         +  G    + D +GR+ +   +R + G+  E   +G     ++W
Sbjct: 56  AEAPFTNEAVRAYQRYLFAGTDEQRPDGQGRVAIAPELRRYAGLNKECVVIGAITRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q ++   +E  + Y +   +
Sbjct: 116 DAQAWQGYLDEHEDSYAQAREE 137


>gi|167758762|ref|ZP_02430889.1| hypothetical protein CLOSCI_01104 [Clostridium scindens ATCC 35704]
 gi|167663502|gb|EDS07632.1| hypothetical protein CLOSCI_01104 [Clostridium scindens ATCC 35704]
          Length = 146

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 55/144 (38%), Gaps = 9/144 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  ID+KGR+ +P  FR  L +  +             + V   D    FE+K+
Sbjct: 1   MLKGEYSHNIDAKGRLIIPAKFRDDLGEHFVITKGM-----ENCLYVYPEDEWNTFEEKL 55

Query: 63  AEYNPF-SIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
                    +A  L+    G      +D +GR L+   +R F  ++ EV F+G G   ++
Sbjct: 56  NALPTTTDKKARALAYFFIGSATDGDLDKQGRTLVPSVLRDFAKLDKEVVFIGMGKRAEI 115

Query: 122 WNPQTFRKLQEESR---NEYCRQL 142
           W+   + +   E      +    +
Sbjct: 116 WDKARWDEKNAEVELNIEDIASDM 139


>gi|116491169|ref|YP_810713.1| hypothetical protein OEOE_1152 [Oenococcus oeni PSU-1]
 gi|290890685|ref|ZP_06553755.1| hypothetical protein AWRIB429_1145 [Oenococcus oeni AWRIB429]
 gi|122276649|sp|Q04ES4|MRAZ_OENOB RecName: Full=Protein MraZ
 gi|116091894|gb|ABJ57048.1| hypothetical protein, MraZ [Oenococcus oeni PSU-1]
 gi|290479660|gb|EFD88314.1| hypothetical protein AWRIB429_1145 [Oenococcus oeni AWRIB429]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D K R+ +P  FR  L    +   +        ++     D  + FE+K+
Sbjct: 1   MFMGEYQHTLDDKSRLIIPAKFRNQLGDTFVVTRWM-----EHSLFAFPKDEWDKFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A      V  G I    D +GRI++   ++    +   V   G GN F++W
Sbjct: 56  NKLPFGAKDARAFRRFVLAGAIESDFDKQGRIIIPTVLKEHAQLNKNVVITGSGNGFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +    +   +  Q+ ++
Sbjct: 116 SKDNWEEYTAGTAENF-DQIAEE 137


>gi|160871740|ref|ZP_02061872.1| MraZ protein [Rickettsiella grylli]
 gi|159120539|gb|EDP45877.1| MraZ protein [Rickettsiella grylli]
          Length = 151

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 59/135 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+ +P  +R  L            D   P + +      E  E+K+
Sbjct: 1   MFRGINLVVLDSKGRIKLPARYRQRLPLDKEPQFVLTIDTESPCLLLYLLPEWENIEEKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  A ++  L+ G    L+ D++GRIL+   +R +  +E E+  VG+G   +LW
Sbjct: 61  QTLPSFNPAARRIQRLLIGHATDLESDNKGRILLPVLLRDYAQLEKEIMVVGQGRKIELW 120

Query: 123 NPQTFRKLQEESRNE 137
              T+   + +   E
Sbjct: 121 AASTWEDYRTQWVEE 135


>gi|291547134|emb|CBL20242.1| mraZ protein [Ruminococcus sp. SR1/5]
          Length = 141

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 58/139 (41%), Gaps = 6/139 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ +P  FR +L +  +             +S+   D    FE+K+  
Sbjct: 1   MGEYNHTIDAKGRLIIPSRFRELLGEEFVLTRGL-----DGCLSIYPMDEWVAFEEKLRA 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
               +  A   S     G    ++D +GRIL+   +R F G++ +V   G  N  ++W+ 
Sbjct: 56  LPLTNKDARTFSRFFVAGATTCQLDKQGRILVPQTLRQFAGLDKDVVLTGNLNRIEVWSK 115

Query: 125 QTFRKLQE-ESRNEYCRQL 142
           + + +    +  +     +
Sbjct: 116 EKWSENCNYDDMDSIAESM 134


>gi|169824307|ref|YP_001691918.1| hypothetical protein FMG_0610 [Finegoldia magna ATCC 29328]
 gi|226709982|sp|B0S0Y8|MRAZ_FINM2 RecName: Full=Protein MraZ
 gi|167831112|dbj|BAG08028.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F++     IDSKGRV +P  FR  + +                + V          +K+
Sbjct: 1   MFINEYFHNIDSKGRVIMPSKFRDEIGEEFYITKGM-----DECLFVYPVSAFIQMTEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +    QA   S +   G    ++D +GR L+   +R +  I+ EV  +G  N  ++W
Sbjct: 56  NKLSLTRRQARAFSRVFFSGASNQEIDKQGRFLIPQSLRSYADIKKEVAIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + + +   +S   Y
Sbjct: 116 DKEKWEQYSNDSSLNY 131


>gi|331083034|ref|ZP_08332153.1| mraZ [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330399771|gb|EGG79432.1| mraZ [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  ID+KGR+ +P  FR  L +  +             +S+  ++  + FE+K+
Sbjct: 1   MFMGEYSHTIDAKGRMIIPAKFREELGEEFVLTKGL-----DGCLSIYPNNEWKAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A              ++D +GRIL+   +R F G+  +V   G     ++W
Sbjct: 56  KALPLNDKNARAFLRFFVASATMCELDKQGRILVPGTLREFAGLNKDVVLTGNLTRIEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +       +   + +Q
Sbjct: 116 SKEKWLENSNYEDMDAIAEGMQ 137


>gi|153854701|ref|ZP_01995951.1| hypothetical protein DORLON_01949 [Dorea longicatena DSM 13814]
 gi|149752805|gb|EDM62736.1| hypothetical protein DORLON_01949 [Dorea longicatena DSM 13814]
          Length = 146

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 54/146 (36%), Gaps = 9/146 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  ID+KGR+ +P  FR  L +  +             + V        FE+K+
Sbjct: 1   MLKGEYSHNIDAKGRLIIPAKFRDDLGEHFVITKGM-----ENCLYVYPEAEWTAFEEKL 55

Query: 63  AEYNPF-SIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
                    +A   +    G      +D +GR L+   +R F  ++ EV F+G G   ++
Sbjct: 56  NALPTTTDKKARAFAYFFQGSAADGDLDKQGRTLIPSVLRTFAHLDKEVVFIGMGKRAEI 115

Query: 122 WNPQTFRKLQEESR---NEYCRQLLQ 144
           W+   + +   E      +    + +
Sbjct: 116 WDKARWDEKNAEVELNIEDIASDMEE 141


>gi|160873529|ref|YP_001552845.1| cell division protein MraZ [Shewanella baltica OS195]
 gi|189028636|sp|A9KY20|MRAZ_SHEB9 RecName: Full=Protein MraZ
 gi|160859051|gb|ABX47585.1| MraZ protein [Shewanella baltica OS195]
 gi|315265759|gb|ADT92612.1| MraZ protein [Shewanella baltica OS678]
          Length = 152

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 61/139 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       +    D     + +      E  E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +++        L  L+ G    +++D  GRIL+   +R +  ++  +  VG+ N F+LW
Sbjct: 61  LKFSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + Q++ +  +E +     +
Sbjct: 121 DEQSWLQQIDECQETIRSE 139


>gi|99081854|ref|YP_614008.1| cell division protein MraZ [Ruegeria sp. TM1040]
 gi|122397752|sp|Q1GF20|MRAZ_SILST RecName: Full=Protein MraZ
 gi|99038134|gb|ABF64746.1| protein of unknown function UPF0040 [Ruegeria sp. TM1040]
          Length = 167

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
            RF      K+DSKGRVS+P  FR +L               +  + D     +     +
Sbjct: 3   RRFRGESHHKVDSKGRVSIPASFRRVLEASDPNWQPGDAPELVIVYGDHRRQYLECYTME 62

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            +E  + KIA     S     L  + +G  +   +D  GR+++   +R    ++ E  F+
Sbjct: 63  AIEEVDAKIAALPRGSKGRKILERIFNGQSLPTTVDETGRLVLPAKLRQKIDLDKEAFFI 122

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+W P+T+ +++     +   +L  
Sbjct: 123 ASGDTFQIWKPETYEEVEMAEAEKLMDELPD 153


>gi|309388984|gb|ADO76864.1| MraZ protein [Halanaerobium praevalens DSM 2228]
          Length = 143

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T K+D KGR+ +P   R  L+++ +             + +   +     E+K+
Sbjct: 1   MFMGEYTHKLDKKGRLIIPSKLREDLSEKFVITRGL-----DNCLFIYPINEWGKLEKKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  +         G    ++D++GRI +   +R F   ++++  +G GN  +LW
Sbjct: 56  RSLPMTNKNSRNFVRFFFSGANECQLDNQGRISLPINLREFADFKDQIVIIGLGNRIELW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
               +    E   + Y  
Sbjct: 116 AKNKWTNYMEAVEDSYQD 133


>gi|227509374|ref|ZP_03939423.1| cell division protein MraZ [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227191086|gb|EEI71153.1| cell division protein MraZ [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 151

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID+KGR+ +P  FR  L  + +             +        +  E KI
Sbjct: 11  MLLGEFQHNIDAKGRIIIPAKFRQDLGNKFVITRGM-----DGCLFGYPMSEWKKVEDKI 65

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +         +       +  + D +GR+ +   +R F  IE +   VG  N  ++W
Sbjct: 66  DSLSVNKRDVRAFTRFFFSAAVECEFDKQGRVNIPSILRNFAKIEKKCVVVGVSNRIEVW 125

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     ++   +  ++ +
Sbjct: 126 SEPAWHAFTSDAAAHF-DEIAE 146


>gi|284030810|ref|YP_003380741.1| MraZ protein [Kribbella flavida DSM 17836]
 gi|283810103|gb|ADB31942.1| MraZ protein [Kribbella flavida DSM 17836]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA+     L   +     ++SV          +++
Sbjct: 1   MFLGTHFPKLDDKGRLFLPAKFRDELAE----GLVITRG-QERSLSVWPEAEFVQLTEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A     ++  G      D +GR+ +   +R + G++ +   +G  N  ++W
Sbjct: 56  KQAPITNKGARDYLRMLFAGASNEVPDKQGRVTIPPMLRDYAGLDRDCVVIGAMNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           N + + +   E    +   L ++
Sbjct: 116 NTENWNRYSAEQEQAFAD-LSEE 137


>gi|77361428|ref|YP_341003.1| hypothetical protein PSHAa2513 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|91207208|sp|Q3IFZ5|MRAZ_PSEHT RecName: Full=Protein MraZ
 gi|76876339|emb|CAI87561.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 152

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 57/134 (42%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR +VP  +R  L       + C      P + +      +  E ++
Sbjct: 1   MFRGASSLSLDDKGRFAVPTKYRDDLLSEDQGTVICTVALNEPCLWLYPLAQWQEIESRL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +  + +A ++  ++ G     ++D  GRIL+   +R    +  ++  VG  N F++W
Sbjct: 61  AKISNMNPRARRMQRMLLGNATEYQLDKNGRILLAPSLRAHADLGKKIMLVGLMNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   + +   +   
Sbjct: 121 DEARWHQQMRQDTE 134


>gi|116618595|ref|YP_818966.1| hypothetical protein LEUM_1501 [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227431985|ref|ZP_03914005.1| cell division protein MraZ [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|122271205|sp|Q03W29|MRAZ_LEUMM RecName: Full=Protein MraZ
 gi|116097442|gb|ABJ62593.1| hypothetical protein, MraZ [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227352270|gb|EEJ42476.1| cell division protein MraZ [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 60/136 (44%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+K R+ +P  FR  L  + I   +  +      +      + E  ++++
Sbjct: 1   MFMGEYSHTLDTKSRLIIPAKFRNQLGDQFIITKWMEKS-----LRAMPMAVWEKLQEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A      V  G +  + D +GRI++ + +R +  +E  V   G G+ F++W
Sbjct: 56  NQLPLGKKDARAFRRFVMAGALEAEFDKQGRIVVPNNLREYASLEKSVVVTGVGDSFEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +     E+ +++
Sbjct: 116 SAENWSAYTAETADDF 131


>gi|330446834|ref|ZP_08310485.1| mraZ family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491025|dbj|GAA04982.1| mraZ family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 152

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 70/143 (48%), Gaps = 5/143 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                 +  IDSKGR+++P  +R  + ++C     C  D  F  + +   +  E+ E K+
Sbjct: 1   MLRGATSISIDSKGRIAIPKRYRQWITEQCGGLFICTIDHQFSCLLLYPINEWEHIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +       ++  L+ G     +MD +GRIL++  +R +  +++++  VG+ N F++W
Sbjct: 61  ATLSSLHPAERRIQRLLLGHASECEMDGQGRILLSPTLRQYAHLQDKIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQE-----ESRNEYCR 140
           +   +++  E     ++ +   +
Sbjct: 121 SDVLWQQQIELDINLQAEDALAQ 143


>gi|28871552|ref|NP_794171.1| marZ family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213966576|ref|ZP_03394727.1| marZ family protein [Pseudomonas syringae pv. tomato T1]
 gi|237799281|ref|ZP_04587742.1| cell division protein MraZ [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|301384709|ref|ZP_07233127.1| cell division protein MraZ [Pseudomonas syringae pv. tomato Max13]
 gi|302059803|ref|ZP_07251344.1| cell division protein MraZ [Pseudomonas syringae pv. tomato K40]
 gi|302131750|ref|ZP_07257740.1| cell division protein MraZ [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|38257957|sp|Q87WX6|MRAZ_PSESM RecName: Full=Protein MraZ
 gi|28854803|gb|AAO57866.1| marZ family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928426|gb|EEB61970.1| marZ family protein [Pseudomonas syringae pv. tomato T1]
 gi|331016725|gb|EGH96781.1| cell division protein MraZ [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
 gi|331022137|gb|EGI02194.1| cell division protein MraZ [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 151

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L  R    +    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDAKGRLAMPSRYRDELDSRSAGQMIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYARLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|167765840|ref|ZP_02437893.1| hypothetical protein CLOSS21_00331 [Clostridium sp. SS2/1]
 gi|167712557|gb|EDS23136.1| hypothetical protein CLOSS21_00331 [Clostridium sp. SS2/1]
          Length = 158

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 59/145 (40%), Gaps = 6/145 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS F+      ID+KGR+ +P  FR  L Q  +             + V   +  E F+ 
Sbjct: 14  MSMFMGEFNHTIDAKGRLIIPSRFREELGQEFVMTKGL-----DGCLFVFPQNEWESFQG 68

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+      +  A + S     G    +MD +GR L+   +R F  ++ EV   G  +  +
Sbjct: 69  KLKTLPLINKDARKFSRFFMAGAAPCEMDKQGRTLIPATLREFAQMKKEVVLTGMADRIE 128

Query: 121 LWNPQTF-RKLQEESRNEYCRQLLQ 144
           +W+ + +      E  ++    + +
Sbjct: 129 IWSKEKWIENNSYEDMDDIAASMQE 153


>gi|257885173|ref|ZP_05664826.1| MraZ family protein [Enterococcus faecium 1,231,501]
 gi|257821025|gb|EEV48159.1| MraZ family protein [Enterococcus faecium 1,231,501]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 49/142 (34%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ VP   R  L ++ +             +        E  E K+
Sbjct: 1   MLMGEFQHNIDAKGRLIVPSKLREELGEKFVLTRGL-----DGCLFGYPMSEWENLEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A       +      ++D +GRI +   +R +  +       G  N  ++W
Sbjct: 56  NEMPLAKKDARTFVRFFYSAATECELDKQGRINIPSTLRNYAALTKGCVVNGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   ++     + + +  ++ +
Sbjct: 116 DETRWQDFSAAAEDNF-DEIAE 136


>gi|294787095|ref|ZP_06752349.1| MraZ protein [Parascardovia denticolens F0305]
 gi|315226747|ref|ZP_07868535.1| cell division protein MraZ [Parascardovia denticolens DSM 10105]
 gi|294485928|gb|EFG33562.1| MraZ protein [Parascardovia denticolens F0305]
 gi|315120879|gb|EFT84011.1| cell division protein MraZ [Parascardovia denticolens DSM 10105]
          Length = 170

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 56/139 (40%), Gaps = 5/139 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           +  L     KID+KGRV++P  FR+ L Q C+             I +           +
Sbjct: 26  ALLLGTYAPKIDAKGRVALPAKFRSQLGQGCVLAR-----GQERCIYLLPFGEFRRIAAQ 80

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I   +  +  A     +   G +  + D +GR+++   +R +  I+ ++  +G G   ++
Sbjct: 81  IQRTSLSNKAARNYLRVFLSGAVDQEPDKQGRVILPSILRDYAHIDKDIVIIGVGTRAEI 140

Query: 122 WNPQTFRKLQEESRNEYCR 140
           WN   +     E  + Y  
Sbjct: 141 WNKADWDAYLAEQEDGYSD 159


>gi|91776630|ref|YP_546386.1| hypothetical protein Mfla_2278 [Methylobacillus flagellatus KT]
 gi|122399510|sp|Q1GYZ2|MRAZ_METFK RecName: Full=Protein MraZ
 gi|91710617|gb|ABE50545.1| protein of unknown function UPF0040 [Methylobacillus flagellatus
           KT]
          Length = 148

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 69/143 (48%), Gaps = 1/143 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR++VP   R  L  +   +L          + +      E  + KI
Sbjct: 1   MFRGATSLNMDAKGRLAVPAKHRDALHAQSEGNLVLT-AHPHRCLLLYPLPAWEPIQSKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F  Q++ L  L+ G    +++D  GR+L++  +R F G E +V  VG+G++F+LW
Sbjct: 60  MALSSFDRQSSALQRLLVGFAEDVELDGAGRLLVSPVLREFAGFEKQVMLVGQGSHFELW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +R   ++  +    +L  +
Sbjct: 120 SMEAWRAQLQQVMSAESVELPDE 142


>gi|325264795|ref|ZP_08131524.1| MraZ protein [Clostridium sp. D5]
 gi|324030087|gb|EGB91373.1| MraZ protein [Clostridium sp. D5]
          Length = 145

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID KGR+ +P   R  L        +   +     + V + D    F  ++
Sbjct: 1   MLLGEFNHTIDEKGRLIIPARLRDDLGDS-----FVICNGLEGCLFVYSMDEWNNFVAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A        G       D +GR+L+   +R   G+E +V  VG  +  ++W
Sbjct: 56  ETLPRMNKDARVFKRYFFGSASEGSFDKQGRVLVPPTLRKAAGLEKDVVLVGVQDRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +    S  +    + ++
Sbjct: 116 DKALWEERSMVSEEDL-DAIAER 137


>gi|288919044|ref|ZP_06413385.1| MraZ protein [Frankia sp. EUN1f]
 gi|288349584|gb|EFC83820.1| MraZ protein [Frankia sp. EUN1f]
          Length = 143

 Score =  130 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + T ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHTPRLDDKGRLTLPAKFREELE----GGLVITKG-QERCLYVFPLAEFARISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R + G+  E    G     ++W
Sbjct: 56  RTAPVTAKALRDYSRVFFSSAADDVPDRQGRITIPPALRTYAGLSRECVVNGANTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +     +    +  +L ++
Sbjct: 116 DSTRWETYLADQEETFA-ELSEE 137


>gi|90416327|ref|ZP_01224259.1| hypothetical protein GB2207_11633 [marine gamma proteobacterium
           HTCC2207]
 gi|90332052|gb|EAS47266.1| hypothetical protein GB2207_11633 [marine gamma proteobacterium
           HTCC2207]
          Length = 155

 Score =  130 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 70/143 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D+KGR+++P  +R +L + C +DL    D     +++      + FE+K+
Sbjct: 1   MFKGSDPINMDTKGRMAIPTRYRPLLDEICSSDLVITIDMKSACLTLSPLPEWKKFEEKV 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A           LS  V G    L++D  GRIL+   +R +  +E ++  VGR    ++W
Sbjct: 61  AALPALDELGEMLSRFVVGQAKDLQVDGSGRILIPPELRGYAQLEKKLVLVGRSQRLEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +   +E+S+  Y   LL +
Sbjct: 121 SEENWNAEREKSQETYRSMLLDR 143


>gi|15604424|ref|NP_220942.1| cell division protein MraZ [Rickettsia prowazekii str. Madrid E]
 gi|6648007|sp|Q9ZCY1|MRAZ_RICPR RecName: Full=Protein MraZ
 gi|3861118|emb|CAA15018.1| unknown [Rickettsia prowazekii]
 gi|292572191|gb|ADE30106.1| MraZ protein [Rickettsia prowazekii Rp22]
          Length = 149

 Score =  130 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 65/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RV+VP  +R +L +     +  +       I V     +E   +
Sbjct: 1   MNVFLSKYINGVDKKSRVTVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGIAHIEKLRK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D +GRI++   +    GIE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLAFDGDGRIILPQSLMKHAGIEEQACFVGKGIIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W P+ F K    ++N
Sbjct: 121 IWQPKNFEKYLSYAQN 136


>gi|159900037|ref|YP_001546284.1| MraZ protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|226709986|sp|A9B519|MRAZ_HERA2 RecName: Full=Protein MraZ
 gi|159893076|gb|ABX06156.1| MraZ protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 60/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      +D KGR+++P  FR  LA+     L   + F    + +    +      +I
Sbjct: 1   MFLGEYEHTVDEKGRLAIPAKFRAGLAE----GLVLTRGF-DQNLLLYPMPVWRELAARI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A  L  L+  G   L +D +GRI++   +R +  I N+    G  ++ ++W
Sbjct: 56  NALPITQPSARNLRRLMFAGASDLGLDKQGRIVLPPNLRQYATITNQAVVTGMDSFIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + ++ + +   +E    L +
Sbjct: 116 SAERWQTVLDSFADEAPA-LAE 136


>gi|148657876|ref|YP_001278081.1| MraZ protein [Roseiflexus sp. RS-1]
 gi|167012271|sp|A5UZS8|MRAZ_ROSS1 RecName: Full=Protein MraZ
 gi|148569986|gb|ABQ92131.1| MraZ protein [Roseiflexus sp. RS-1]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      ID KGR+++P  FR  L +     +   + F    +      + E   +++
Sbjct: 1   MFLGEYEHTIDDKGRLAIPARFRDALNE----GVVITRGF-DKCLMGFPRSVWEELARQV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     S +  QL  ++  G   + +D +GRIL+   +R F  + ++    G   +F++W
Sbjct: 56  SSLPIGSEETRQLQRMLFSGAADMTLDRQGRILIPQNLREFAELGDQAIIAGLNRHFEIW 115

Query: 123 NPQTFRKLQEESRNE---YCRQLLQ 144
            P+ ++ +          + ++L +
Sbjct: 116 APRRWQNVLSAMDANASLFAQKLAE 140


>gi|227524040|ref|ZP_03954089.1| cell division protein MraZ [Lactobacillus hilgardii ATCC 8290]
 gi|227088779|gb|EEI24091.1| cell division protein MraZ [Lactobacillus hilgardii ATCC 8290]
          Length = 151

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID+KGR+ +P  FR  L  + +             +        +  E KI
Sbjct: 11  MLLGEFQHNIDAKGRIIIPAKFRQDLGNKFVITRGM-----DGCLFGYPMSEWKKVEDKI 65

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +         +       +  + D +GR+ +   +R F  IE +   VG  N  ++W
Sbjct: 66  DSLSINKRDVRAFTRFFFSAAVECEFDKQGRVNIPSILRNFAKIEKKCVVVGVSNRIEVW 125

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     ++   +  ++ +
Sbjct: 126 SEPAWHAFTSDAAAHF-DEIAE 146


>gi|199598135|ref|ZP_03211557.1| hypothetical protein LRH_05756 [Lactobacillus rhamnosus HN001]
 gi|229552070|ref|ZP_04440795.1| cell division protein MraZ [Lactobacillus rhamnosus LMS2-1]
 gi|258508272|ref|YP_003171023.1| cell division protein MraZ [Lactobacillus rhamnosus GG]
 gi|258539485|ref|YP_003173984.1| cell division protein MraZ [Lactobacillus rhamnosus Lc 705]
 gi|199590896|gb|EDY98980.1| hypothetical protein LRH_05756 [Lactobacillus rhamnosus HN001]
 gi|229314503|gb|EEN80476.1| cell division protein MraZ [Lactobacillus rhamnosus LMS2-1]
 gi|257148199|emb|CAR87172.1| Cell division protein MraZ [Lactobacillus rhamnosus GG]
 gi|257151161|emb|CAR90133.1| Cell division protein MraZ [Lactobacillus rhamnosus Lc 705]
 gi|259649589|dbj|BAI41751.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 50/136 (36%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +    + ID+KGR+ +P  FR  L    +             +        +  + K+
Sbjct: 1   MLMGEFERSIDAKGRLIIPAKFREQLGASFVLTRGM-----DGCLFGYPIAEWDKLQAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A   +  +       ++D +GRI +   +     ++ +   VG     ++W
Sbjct: 56  ATLPLAKKDARTFTRFLFSAATECEIDKQGRINIPKPLFKHAALKKDCVLVGVNTRIEVW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +++  + +  ++
Sbjct: 116 DAERWQQFADTAEEDF 131


>gi|169827003|ref|YP_001697161.1| protein mraZ [Lysinibacillus sphaericus C3-41]
 gi|168991491|gb|ACA39031.1| Protein mraZ [Lysinibacillus sphaericus C3-41]
          Length = 141

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 49/140 (35%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      +D+KGR+ VP  FR  L +  +             +     +     E+K+ +
Sbjct: 1   MGEYQHSVDAKGRLIVPAKFREALGEAFVVTRGL-----DNCLFGYPMNEWRKLEEKLKD 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                      +     G   +++D +GRI +   +     +  E   +G  N  ++W  
Sbjct: 56  LPMTKKDTRAFARFFFSGATEVEIDKQGRINIPATLMQHAHLVKECVVLGVSNRIEIWAK 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
             +     ES   +  ++ +
Sbjct: 116 DAWEAYFSESEQSF-NEIAE 134


>gi|269926722|ref|YP_003323345.1| MraZ protein [Thermobaculum terrenum ATCC BAA-798]
 gi|269790382|gb|ACZ42523.1| MraZ protein [Thermobaculum terrenum ATCC BAA-798]
          Length = 144

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 62/138 (44%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+++P  FR  LA+         + F  P ++V      +   + +
Sbjct: 1   MFLGRFDNKLDDKGRLAMPAKFRARLAE----GFVVTRGF-EPCLTVYPMSEWKKLTEAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +     +A  +  ++       ++D +GRIL+ +++R   G+ +EV   G   Y ++W
Sbjct: 56  NRFPVTDQKARIIRRVLFAQACDTELDKQGRILIPEYLREAAGLTSEVVVAGMDTYIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +++ +S      
Sbjct: 116 DKARWEEMERQSEENAAD 133


>gi|309792353|ref|ZP_07686821.1| MraZ protein [Oscillochloris trichoides DG6]
 gi|308225574|gb|EFO79334.1| MraZ protein [Oscillochloris trichoides DG6]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 5/131 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      ID KGRV++P  FR  L++     +   + F    +      + +   QK+
Sbjct: 1   MFLGEFEHSIDDKGRVAIPARFREELSE----GMVLTRGF-DACLQAFPRAIWQQLAQKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  S +A  L  ++      +++D +GRIL+   +R + G+  +V   G   YF+LW
Sbjct: 56  SSLSLGSPEARTLRRMLFSNAAEVEVDRQGRILVPQNLREYAGLAEQVVISGMDTYFELW 115

Query: 123 NPQTFRKLQEE 133
           +   +R + E+
Sbjct: 116 SADRWRNVMEQ 126


>gi|116629845|ref|YP_815017.1| cell division protein MraZ [Lactobacillus gasseri ATCC 33323]
 gi|238853963|ref|ZP_04644320.1| MraZ protein [Lactobacillus gasseri 202-4]
 gi|282851644|ref|ZP_06261009.1| protein MraZ [Lactobacillus gasseri 224-1]
 gi|311110515|ref|ZP_07711912.1| MraZ protein [Lactobacillus gasseri MV-22]
 gi|122273217|sp|Q042P3|MRAZ_LACGA RecName: Full=Protein MraZ
 gi|116095427|gb|ABJ60579.1| hypothetical protein, MraZ [Lactobacillus gasseri ATCC 33323]
 gi|238833408|gb|EEQ25688.1| MraZ protein [Lactobacillus gasseri 202-4]
 gi|282557612|gb|EFB63209.1| protein MraZ [Lactobacillus gasseri 224-1]
 gi|311065669|gb|EFQ46009.1| MraZ protein [Lactobacillus gasseri MV-22]
          Length = 143

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 57/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  + ++ +             I     +  +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRDEIGEKMVFTRGM-----EGCIFGYPIEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTKRSARKFTRLFYSGAMESEFDKQGRVNLTMTLKEHAALIKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    EE+   Y
Sbjct: 116 SAERWNDFSEEANENY 131


>gi|238898854|ref|YP_002924536.1| cell division protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259509656|sp|C4K745|MRAZ_HAMD5 RecName: Full=Protein MraZ
 gi|229466614|gb|ACQ68388.1| cell division protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 152

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 69/146 (47%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+ +P  +R IL ++  + + C  D     + +      E  E+K+
Sbjct: 1   MFRGATMLSLDNKGRLVIPVRYRDILKEKSQSRMICTIDLHQTCLLLYPFLEWESIEKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +    ++  L+ G     +MD  GR+L++  +R    +  EV  +G+ N F++W
Sbjct: 61  SDLSSMNPLERRVQRLLLGHASECEMDKSGRLLISATLRQHAQLSKEVMLIGQLNKFEIW 120

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQK 145
           +   +++  ++   S+      L ++
Sbjct: 121 SGPNWQQQIKDDITSKQPVQESLSER 146


>gi|160933346|ref|ZP_02080734.1| hypothetical protein CLOLEP_02191 [Clostridium leptum DSM 753]
 gi|156867223|gb|EDO60595.1| hypothetical protein CLOLEP_02191 [Clostridium leptum DSM 753]
          Length = 139

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      IDSKGRV VP  FR  L +                + V + +  +  ++KI
Sbjct: 1   MLIGEYQHNIDSKGRVIVPVKFREDLGECFYVTKGL-----DGCLFVLSGEGWKGLQEKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +   L      G   ++ D +GRIL+   +R   G+  +VTFVG  +  ++W
Sbjct: 56  QSMPLSKSRG--LQRFFFSGATDVETDKQGRILIPQPLRDHAGLTKDVTFVGVSSRVEIW 113

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + ++  E   E   + + +
Sbjct: 114 DTSRWNQVNGELTEESIAEAMDE 136


>gi|28211298|ref|NP_782242.1| cell division protein MraZ [Clostridium tetani E88]
 gi|51316443|sp|Q894B3|MRAZ_CLOTE RecName: Full=Protein MraZ
 gi|28203738|gb|AAO36179.1| mraZ protein [Clostridium tetani E88]
          Length = 142

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 55/143 (38%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSK R+ +P  FR  L +  I             + +   +     E+K+
Sbjct: 1   MFIGEYNHGVDSKNRIIIPSKFREELGESFILTKGL-----DNCLYIYPMEEWRILEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G   + +D +GR L+   +  +  I  ++  +G     ++W
Sbjct: 56  KKLPLTNKDARAFVRFFFSGANEISIDKQGRALIPQNLMKYANINKDIVSIGVATRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + +  + + +    Q+ +K
Sbjct: 116 SREKWEEYNDANID--YEQIAEK 136


>gi|312196213|ref|YP_004016274.1| MraZ protein [Frankia sp. EuI1c]
 gi|311227549|gb|ADP80404.1| MraZ protein [Frankia sp. EuI1c]
          Length = 143

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + + ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHSPRLDDKGRLTLPAKFREELE----GGLVITKG-QERCLYVFPMAEFSRISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R + G+  +    G     ++W
Sbjct: 56  RTAPVTAKSLRDYSRVFFSSANDDVPDKQGRITIPPALRDYAGLTRDCIVNGANTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +     E    +  +L ++
Sbjct: 116 DTERWAAYLTEQEESFA-ELSEE 137


>gi|227822660|ref|YP_002826632.1| cell division protein MraZ [Sinorhizobium fredii NGR234]
 gi|227341661|gb|ACP25879.1| protein MraZ [Sinorhizobium fredii NGR234]
          Length = 146

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 109/136 (80%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLS+ T +ID+KGRVSVP  FR +L +  + +LYCFQDF FPA+SVG  +LL+ FE+
Sbjct: 1   MNRFLSHATNRIDAKGRVSVPSAFRAVLLEAGVRELYCFQDFVFPAVSVGGPELLDRFEK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++A  +PFS  ANQ+SLLVHGGG+F+K+D EGR+++TDFIR FTGI  +VTFVGRG++FQ
Sbjct: 61  QMAAEDPFSDAANQMSLLVHGGGVFVKLDPEGRLMVTDFIRDFTGISTDVTFVGRGDHFQ 120

Query: 121 LWNPQTFRKLQEESRN 136
           LW PQ F + Q E+R 
Sbjct: 121 LWEPQAFARAQAEARE 136


>gi|197302578|ref|ZP_03167633.1| hypothetical protein RUMLAC_01307 [Ruminococcus lactaris ATCC
           29176]
 gi|197298476|gb|EDY33021.1| hypothetical protein RUMLAC_01307 [Ruminococcus lactaris ATCC
           29176]
          Length = 145

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID KGR+ +P   R  L        +   +     + V + +    F  ++
Sbjct: 1   MLLGEYNHNIDEKGRLIIPAKLREGLGDS-----FVICNGLEGCLFVYSQEEWNKFVAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A        G       D +GR+L+   +R    +E EV  VG  +  ++W
Sbjct: 56  ESLPRMNKDARMFKRYFFGSANEGSFDRQGRVLVPTSLRKAAHLEKEVVLVGVQDRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +  + S  +    + ++
Sbjct: 116 DKALWEEKSQISEEDL-DAIAER 137


>gi|205455562|sp|Q0RNQ0|MRAZ_FRAAA RecName: Full=Protein MraZ
          Length = 143

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 52/143 (36%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + T ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHTPRLDDKGRLTLPAKFRDELE----GGLVITKG-QERCLYVFPMAEFTRISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R + G+  +    G     ++W
Sbjct: 56  RTAPVTAKALRDYSRVFFSSAADDAPDRQGRITIPAPLRTYAGLTRDCVVNGANTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q ++   E     +  +L ++
Sbjct: 116 DAQRWQAYLESQEESFA-ELSEE 137


>gi|310823498|ref|YP_003955856.1| protein MraZ [Stigmatella aurantiaca DW4/3-1]
 gi|309396570|gb|ADO74029.1| Protein MraZ [Stigmatella aurantiaca DW4/3-1]
          Length = 149

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 54/147 (36%), Gaps = 6/147 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F      +ID+KGR S+P   R  L       L        P +        E  E  +
Sbjct: 1   MFRGVYEHQIDAKGRTSLPARLRETLVGAYDERLILTTAL-DPCLHAYPVREWEALETAL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              NP       L  L         +D  GRIL+   +R    +E ++ +VG     +LW
Sbjct: 60  GRRNPMEPGVKTLMRLYVASAQECPLDKLGRILIPPSLRAHAKLEKDMVWVGMVKVIELW 119

Query: 123 NPQTFRKLQEESR-----NEYCRQLLQ 144
           +   + K QEE+R      +  R L +
Sbjct: 120 SRDGWAKAQEEARAAADSADVARVLAE 146


>gi|84495973|ref|ZP_00994827.1| hypothetical protein JNB_00600 [Janibacter sp. HTCC2649]
 gi|84382741|gb|EAP98622.1| hypothetical protein JNB_00600 [Janibacter sp. HTCC2649]
          Length = 146

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 56/143 (39%), Gaps = 5/143 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + FL   T ++D KGR+ +P  FR  L+    T L   +      + V   D      ++
Sbjct: 3   AVFLGTHTPRLDDKGRLFLPAKFRERLS----TGLVVTRG-QERCLYVFPMDEFVKVTEQ 57

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + E    +        +   G      D +GR+ +   +R + G+  E T +G G+  ++
Sbjct: 58  MQEAPTTNRAVRDYIRVFLSGASDEIPDKQGRVTVPAHLRQYAGLTRECTVIGTGSRVEV 117

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   +      +   Y  Q  +
Sbjct: 118 WDTDAWNAYLASTEQAYSEQAEE 140


>gi|227512228|ref|ZP_03942277.1| cell division protein MraZ [Lactobacillus buchneri ATCC 11577]
 gi|227084622|gb|EEI19934.1| cell division protein MraZ [Lactobacillus buchneri ATCC 11577]
          Length = 151

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
              L      ID+KGR+ +P  FR  L  + +             +        +  E K
Sbjct: 10  RMLLGEFQHNIDAKGRIIIPAKFRQDLGNKFVITRGM-----DGCLFGYPMSEWKKVEDK 64

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I   +         +       +  + D +GR+ +   +R F  IE +   VG  N  ++
Sbjct: 65  IDSLSINKRDVRAFTRFFFSAAVECEFDKQGRVNIPSILRNFAKIEKKCVVVGVSNRIEV 124

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   +     ++   +  ++ +
Sbjct: 125 WSEPAWHAFTSDAAAHF-DEIAE 146


>gi|238855279|ref|ZP_04645598.1| MraZ protein [Lactobacillus jensenii 269-3]
 gi|260664638|ref|ZP_05865490.1| mraZ [Lactobacillus jensenii SJ-7A-US]
 gi|282932428|ref|ZP_06337853.1| protein MraZ [Lactobacillus jensenii 208-1]
 gi|313471906|ref|ZP_07812398.1| MraZ protein [Lactobacillus jensenii 1153]
 gi|238832171|gb|EEQ24489.1| MraZ protein [Lactobacillus jensenii 269-3]
 gi|239529172|gb|EEQ68173.1| MraZ protein [Lactobacillus jensenii 1153]
 gi|260561703|gb|EEX27675.1| mraZ [Lactobacillus jensenii SJ-7A-US]
 gi|281303377|gb|EFA95554.1| protein MraZ [Lactobacillus jensenii 208-1]
          Length = 143

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 57/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR       + D   F       I   + +  +  E K+
Sbjct: 1   MFMGEYHHNLDTKGRLIIPAKFRNQ-----MGDKIIFTRGMEGCIFGYSEEEWKKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         + + L + G +  + D +GR+ +T  ++    +E E   VG  N  ++W
Sbjct: 56  AKLPLTKRNVRKFTRLFYSGAMESEFDKQGRVNLTTTLKEHAELEKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    +++   Y
Sbjct: 116 SQRRWDDFTDDADENY 131


>gi|241895697|ref|ZP_04782993.1| cell division protein MraZ [Weissella paramesenteroides ATCC 33313]
 gi|241871064|gb|EER74815.1| cell division protein MraZ [Weissella paramesenteroides ATCC 33313]
          Length = 144

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ +P  FR  L +  +   +        ++     +  + F +KI
Sbjct: 1   MFMGTYQHSLDTKNRLIIPAKFRNQLGESFVITRWM-----DHSLRAYTLEGWQDFSKKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN-YFQL 121
                 + +A Q    V GG + ++ D +GRI ++  +R +  IE  VT  G G+  F+L
Sbjct: 56  NALPETNSKARQFKRFVFGGALEVEFDKQGRINLSQTLRDYAKIEKNVTVFGLGDTTFEL 115

Query: 122 WNPQTFRKLQEESRNEY 138
           W+ + ++  ++E+   +
Sbjct: 116 WSTEKWQAYEDETAENF 132


>gi|291550006|emb|CBL26268.1| mraZ protein [Ruminococcus torques L2-14]
          Length = 145

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID KGR+ +P   R  L        +   +     + V + +    F  ++
Sbjct: 1   MLLGEFNHNIDEKGRLIIPAKLREDLGDS-----FVICNGLEGCLFVYSQEEWNKFVAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A        G       D +GR+L+   +R    +E EV  VG  +  ++W
Sbjct: 56  ESLPRMNKDARIFKRYFFGSASEGSFDKQGRVLVPPSLRKNAHLEKEVVLVGVQDRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +  + S  +    + ++
Sbjct: 116 DKALWEEKNQISEEDL-DAIAER 137


>gi|315125594|ref|YP_004067597.1| hypothetical protein PSM_A0492 [Pseudoalteromonas sp. SM9913]
 gi|315014107|gb|ADT67445.1| hypothetical protein PSM_A0492 [Pseudoalteromonas sp. SM9913]
          Length = 152

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 56/134 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR +VP  +R  L       + C      P + +         E ++
Sbjct: 1   MFRGASSLSLDDKGRFAVPTKYRDTLLSEDQGTVICTVALNEPCLWLYPLAEWLEIESRL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +  + +A ++  ++ G     ++D  GRIL+   +R    +  ++  VG  N F++W
Sbjct: 61  AKISNMNPRARRMQRMLLGNATEYQLDKNGRILLAPSLRSHAELGKKIMLVGLMNKFEIW 120

Query: 123 NPQTFRKLQEESRN 136
           +   + +   +   
Sbjct: 121 DEARWHEQMRQDTE 134


>gi|302380733|ref|ZP_07269198.1| protein MraZ [Finegoldia magna ACS-171-V-Col3]
 gi|303233910|ref|ZP_07320559.1| protein MraZ [Finegoldia magna BVS033A4]
 gi|302311676|gb|EFK93692.1| protein MraZ [Finegoldia magna ACS-171-V-Col3]
 gi|302494835|gb|EFL54592.1| protein MraZ [Finegoldia magna BVS033A4]
          Length = 143

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F++     IDSKGRV +P  FR  + +                + V          +K+
Sbjct: 1   MFINEYFHNIDSKGRVIMPSKFRDEIGEEFYITKGM-----DECLFVYPVSAFIQMTEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +    QA   S +   G    ++D +GR L+   +R +  I+ EV  +G  N  ++W
Sbjct: 56  NKLSLTRRQARAFSRVFFAGASNQEIDKQGRFLIPQSLRSYADIKKEVAIIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + + +   +S   Y
Sbjct: 116 DKEKWEQYSNDSSLNY 131


>gi|221133796|ref|ZP_03560101.1| cell division protein MraZ [Glaciecola sp. HTCC2999]
          Length = 152

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 57/130 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGRV++P  +R  L   C   + C  D     + +      E  E K+
Sbjct: 1   MFRGANAINLDVKGRVAIPTRYRQSLLDDCAGRMVCTIDTMQKCLLLYPLHEWEEIELKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +  +    +L  L+ G  +   MD  GR  ++  +R    ++ ++  VG+ N F++W
Sbjct: 61  QKLSTTNPHERRLRRLLLGYAMEGDMDKNGRFHLSTPLRQHAKLDKQIMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQE 132
           +   +++  E
Sbjct: 121 DADLWQQQIE 130


>gi|150397292|ref|YP_001327759.1| cell division protein MraZ [Sinorhizobium medicae WSM419]
 gi|150028807|gb|ABR60924.1| mraZ protein [Sinorhizobium medicae WSM419]
          Length = 146

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 112/136 (82%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLS+VT +ID+KGRVSVP +FR +L++  + +LYCFQDF FPAISVG  +LL+ FE+
Sbjct: 1   MNRFLSHVTNRIDAKGRVSVPSIFRAVLSEAGVRELYCFQDFVFPAISVGGPELLDRFEK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +++  +PFS  ANQ+SLLVHGGG++L++D EGR+++TDFIR FTGI  +VTFVGRG++FQ
Sbjct: 61  QMSAEDPFSDAANQMSLLVHGGGVYLRLDQEGRLMLTDFIRDFTGISTDVTFVGRGDHFQ 120

Query: 121 LWNPQTFRKLQEESRN 136
           LW P+ F + Q E+R 
Sbjct: 121 LWEPRAFARAQAEARE 136


>gi|226323691|ref|ZP_03799209.1| hypothetical protein COPCOM_01466 [Coprococcus comes ATCC 27758]
 gi|225207875|gb|EEG90229.1| hypothetical protein COPCOM_01466 [Coprococcus comes ATCC 27758]
          Length = 166

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 52/138 (37%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    IDSKGR+ +P   R  L +  +             + +   +  + FE+K+
Sbjct: 22  MLTGEFNHSIDSKGRLIIPSKLRESLGEHFVITKGM-----DGCLFLYPDNEWKAFEEKL 76

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + +A        G     ++D +GR+L++  +R +  +E EV   G  +  ++W
Sbjct: 77  RTLPLTNKKARDFKRFFLGSATEGELDKQGRVLISSSLRAYADLEKEVVLAGVLDKVEIW 136

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +     +       
Sbjct: 137 SKEAWEARTADVEENIED 154


>gi|297626719|ref|YP_003688482.1| Protein mraZ [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296922484|emb|CBL57057.1| Protein mraZ [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 145

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR  +P  FR  LA      L   +      ++V          Q +
Sbjct: 1   MFLGTYTPKLDEKGRFFLPAKFRDELA----PGLVITRS-QDRCLAVYPMATFAEMTQSV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +       Q      ++  G      D +GR+ +   +R + G++ ++  VG  N  ++W
Sbjct: 56  STAPATLKQVRDFQRMLAAGASDEIPDKQGRVTVPPALRSYAGLDKDIVVVGAINRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
               +++      + + +   +
Sbjct: 116 GSTAWKEYSTAQEDVFAQMNEE 137


>gi|269219542|ref|ZP_06163396.1| MraZ protein [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269210784|gb|EEZ77124.1| MraZ protein [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 154

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 60/143 (41%), Gaps = 5/143 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + FL     K+D KGR+ +P  FR  L +     L   +      + V   +  E F+ K
Sbjct: 11  AVFLGTYEPKLDDKGRLILPAKFRDQLQR----GLVITRG-QEHCLFVFTIEEFEEFQTK 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +    S +A     ++  G      D +GRI +   +R + G+E ++  +G G+  ++
Sbjct: 66  LHQAPLTSKEARDYQRVLFSGANDQVPDKQGRISIPSNLRKYAGLERDLAVIGSGSRIEI 125

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   + +        +  +  +
Sbjct: 126 WDLTAWNEYLNTQEAAFADREDE 148


>gi|169334629|ref|ZP_02861822.1| hypothetical protein ANASTE_01032 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259346|gb|EDS73312.1| hypothetical protein ANASTE_01032 [Anaerofustis stercorihominis DSM
           17244]
          Length = 145

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 55/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGR++VP  FR  L        +         ISV      +    KI
Sbjct: 1   MLSGEYNHSVDTKGRINVPAKFRCELGDS-----FIMCKGLDKCISVYPKSAWDELAAKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A + S  + G  +    D +GR  ++  +  + GIE ++  VG     ++W
Sbjct: 56  KSLPTTDRNARRFSRFILGSALECTPDKQGRTKVSASLMEYAGIEKDIVVVGVETKVEIW 115

Query: 123 NPQTFRKL---QEESRNEYCRQLLQ 144
           + + + K     ++   +  +++ +
Sbjct: 116 DSKEWAKYNDVSDDCMEDVAQEMFE 140


>gi|170016881|ref|YP_001727800.1| MraZ protein [Leuconostoc citreum KM20]
 gi|226709992|sp|B1MXV4|MRAZ_LEUCK RecName: Full=Protein MraZ
 gi|169803738|gb|ACA82356.1| MraZ protein [Leuconostoc citreum KM20]
          Length = 143

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 64/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D KGR+ +P  FR  L ++ I   +        A+      + E  EQ++
Sbjct: 1   MFMGEYSHTLDVKGRLIIPAKFRNQLGEKFIVTRWM-----EHALRAMPMPVWEKLEQQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A Q    V  G +  ++D +GRI++   ++ + G+   V   G G+ F++W
Sbjct: 56  NQLPLGKKEARQFKRFVMAGAMEAEIDKQGRIIIPSNLKTYAGLAKNVIVTGSGDSFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + ++    E+   +   + +
Sbjct: 116 SDENWQSYTAETAENF-DDIAE 136


>gi|255527767|ref|ZP_05394620.1| MraZ protein [Clostridium carboxidivorans P7]
 gi|296186679|ref|ZP_06855081.1| protein MraZ [Clostridium carboxidivorans P7]
 gi|296187068|ref|ZP_06855467.1| protein MraZ [Clostridium carboxidivorans P7]
 gi|255508554|gb|EET84941.1| MraZ protein [Clostridium carboxidivorans P7]
 gi|296048355|gb|EFG87790.1| protein MraZ [Clostridium carboxidivorans P7]
 gi|296048716|gb|EFG88148.1| protein MraZ [Clostridium carboxidivorans P7]
          Length = 142

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 54/144 (37%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ +P  FR  L  + I             +     D     E K+
Sbjct: 1   MFIGEYEHALDNKNRIIIPSKFREELGSKFILTKGL-----DGCLYAYPLDEWSVLENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G   +++D +GR L+   +  +  I+ E+  +G  N  ++W
Sbjct: 56  RKLPLTNKNARAFVRFFFSGANEMELDKQGRTLIPQSLLEYGEIKKEIVSIGVSNRLEIW 115

Query: 123 NPQTFRKLQEE--SRNEYCRQLLQ 144
           + + + +        ++   Q+ +
Sbjct: 116 SKEKWIQYNSSNIDFDKIAEQMSE 139


>gi|225375623|ref|ZP_03752844.1| hypothetical protein ROSEINA2194_01248 [Roseburia inulinivorans DSM
           16841]
 gi|225212602|gb|EEG94956.1| hypothetical protein ROSEINA2194_01248 [Roseburia inulinivorans DSM
           16841]
          Length = 178

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ VP  FR  L    +             + V  S+     E+K 
Sbjct: 35  MFMGEYNHTVDPKGRLIVPAKFREQLGDEFVVTKGL-----DGCLFVYTSEEWHNIEEKF 89

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  S  A + S       + +   S        F+R +  +  +V  VG  +  ++W
Sbjct: 90  RNISMTSKDARKFSRFFLQEQLPVNWTSREESFFHQFLREYANLTKDVVLVGVLSRVEIW 149

Query: 123 NPQTFRK--LQEESRNEYCRQLLQ 144
           +   +++    E+  +E    +  
Sbjct: 150 DKDRWQENTYDEDEMDEIAEHMAD 173


>gi|15895402|ref|NP_348751.1| cell division protein MraZ [Clostridium acetobutylicum ATCC 824]
 gi|20139081|sp|Q97H80|MRAZ_CLOAB RecName: Full=Protein MraZ
 gi|15025124|gb|AAK80091.1|AE007714_4 Uncharacterized conserved protein, YLLB B.subtilis family
           [Clostridium acetobutylicum ATCC 824]
 gi|325509548|gb|ADZ21184.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 142

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 54/144 (37%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ +P  FR  L    I             + V      +  E+K+
Sbjct: 1   MFIGEYNHALDTKNRIIIPSKFREELGDNFILTKGL-----DGCLYVYPLGEWKVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G   + +D +GR+L+   +  +  I  E+  +G     ++W
Sbjct: 56  KKLPLTNHNARAFVRFFFSGANEVSLDKQGRVLVPQNLIEYASINKEIISIGVSTRIEIW 115

Query: 123 NPQTFRKLQEES--RNEYCRQLLQ 144
           + + + +  E S   N    ++ +
Sbjct: 116 SKEKWVEYNESSVDMNAIAEKMSE 139


>gi|88856504|ref|ZP_01131161.1| hypothetical protein A20C1_02124 [marine actinobacterium PHSC20C1]
 gi|88814158|gb|EAR24023.1| hypothetical protein A20C1_02124 [marine actinobacterium PHSC20C1]
          Length = 143

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA      +   +      + V +    E   + I
Sbjct: 1   MFLGTYAPKLDDKGRIILPAKFREELAS----GVVVTRG-QERCLYVFSQREFEVMHETI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S Q      L   G      D + R+ +   +R + G++ E+T +G GN  ++W
Sbjct: 56  RKAPVTSKQGRDFLRLFLSGANQETPDKQHRVTIPAGLREYAGLDRELTVIGAGNRAEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    E +  +Y
Sbjct: 116 DTEAWNNYYEANEADY 131


>gi|260589611|ref|ZP_05855524.1| MraZ protein [Blautia hansenii DSM 20583]
 gi|260539851|gb|EEX20420.1| MraZ protein [Blautia hansenii DSM 20583]
          Length = 143

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  ID KGR+ +P  FR  L +  +             +S+  ++  + FE+K+
Sbjct: 1   MFMGEYSHTIDVKGRMIIPAKFREELGEEFVLTKGL-----DGCLSIYPNNEWKAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A              ++D +GRIL+   +R F G+  +V   G     ++W
Sbjct: 56  KALPLNDKNARAFLRFFVASATMCELDKQGRILVPGTLREFAGLNKDVVLTGNLTRIEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + + +       +   + +Q
Sbjct: 116 SKEKWLENSNYEDMDAIAEGMQ 137


>gi|297588284|ref|ZP_06946927.1| cell division protein MraZ [Finegoldia magna ATCC 53516]
 gi|297573657|gb|EFH92378.1| cell division protein MraZ [Finegoldia magna ATCC 53516]
          Length = 147

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 5/137 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F++     IDSKGRV +P  FR  + +                + V          +K
Sbjct: 4   KMFINEYFHNIDSKGRVIMPSKFRDEIGEEFYITKGM-----DECLFVYPVSAFIQMTEK 58

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + + +    QA   S +   G    ++D +GR L+   +R +  I+ EV  +G  N  ++
Sbjct: 59  LNKLSLTRRQARAFSRVFFAGASNQEIDKQGRFLIPQSLRNYADIKKEVAIIGVSNRIEI 118

Query: 122 WNPQTFRKLQEESRNEY 138
           W+ + + +   +S   Y
Sbjct: 119 WDKEKWEQYSNDSSLNY 135


>gi|260063720|ref|YP_003196800.1| mraZ protein [Robiginitalea biformata HTCC2501]
 gi|88783165|gb|EAR14338.1| mraZ protein [Robiginitalea biformata HTCC2501]
          Length = 154

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     K DSKGR+ +P   +  +           +  F P + +          Q
Sbjct: 1   MISFIGTYECKADSKGRIMIPVALKNQMVPILNEGFVIKRSVFQPCLELYPMAEWNQLMQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++ + N F  + N        G   +++D+ GR+L+   +    GI  EV      N  +
Sbjct: 61  QMHKKNRFRKKNNDFIRRFTAGVKLVEIDATGRLLIPKNLIDVAGIGKEVVLSSAINIVE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+  ++  + EE+  ++   L ++
Sbjct: 121 IWDKDSYENVLEETAADFAD-LAEE 144


>gi|320352814|ref|YP_004194153.1| MraZ protein [Desulfobulbus propionicus DSM 2032]
 gi|320121316|gb|ADW16862.1| MraZ protein [Desulfobulbus propionicus DSM 2032]
          Length = 150

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 62/140 (44%), Gaps = 1/140 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RF S+    +D KGR+++P  FR +L ++  +++      +   +        E  E+
Sbjct: 1   MQRFRSHSEHSLDPKGRLNIPTRFRDVLREQYNSEMLI-ITHWQNCLRAYPVAEWEALEE 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            +          ++    +  G     +D +GRIL+   +R   GIE +V  VG   +F+
Sbjct: 60  TLLAQGKNQPDFSRFVRYLIAGVSECPLDKQGRILLPPALRSGLGIEKDVVVVGMLQHFE 119

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+ + + +    +R  +  
Sbjct: 120 IWDKKAWEEETRHTRETFGD 139


>gi|296140351|ref|YP_003647594.1| MraZ protein [Tsukamurella paurometabola DSM 20162]
 gi|296028485|gb|ADG79255.1| MraZ protein [Tsukamurella paurometabola DSM 20162]
          Length = 143

 Score =  129 bits (325), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  +R  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFTGTYTPKLDDKGRLTLPAKYREELA----GGLTITKG-QDRSLTVYPKAEFERIAERA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                                   + DS+GRI ++   R + G+  E   VG   + ++W
Sbjct: 56  DAIEWTDPAGRAFYRNFFASSDDQRPDSQGRITLSADHRRYAGLSKECVVVGSRRFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +   Q +   +Y +   +
Sbjct: 116 DAEAWEAYQTQHEEDYAQPQSE 137


>gi|227494639|ref|ZP_03924955.1| cell division protein MraZ [Actinomyces coleocanis DSM 15436]
 gi|226831821|gb|EEH64204.1| cell division protein MraZ [Actinomyces coleocanis DSM 15436]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGRV +P  FR  LA      L   +      + +      E    ++
Sbjct: 1   MFMGTHEPKLDAKGRVILPAKFRDQLAD----GLVVTRG-QDRCLYIFTKAEFENIYDQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++    S  A     ++  G     +D +GR+ +   +R +  +E +V   G G   ++W
Sbjct: 56  SKAPITSKNARDFLRVLMAGASDELLDKQGRLTIPQTLRRYAQLERDVVVTGVGARLEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q + +    + + +   + +
Sbjct: 116 DAQRWDEYLSVTEDVFSDAVEE 137


>gi|317495031|ref|ZP_07953403.1| MraZ protein [Gemella moribillum M424]
 gi|316914803|gb|EFV36277.1| MraZ protein [Gemella moribillum M424]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 53/145 (36%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     K+D+KGR+S+P  FR  L ++ I             +   +    +  E KI
Sbjct: 1   MFIGQYNNKMDAKGRLSIPIKFRDELGEKFIITRGL-----DSCLFGYSLQEWQKVESKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G   +++D +GRI + + +     +  E    G  N  ++W
Sbjct: 56  KSLPITKKNARTFQRFFFSGATEVEIDKQGRINIPNALIEHAFLNKECVVNGLSNRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   +  L  ES     E   +L  
Sbjct: 116 DKAHWEDLLLESEASVEEIAEELED 140


>gi|300173579|ref|YP_003772745.1| cell division protein MraZ [Leuconostoc gasicomitatum LMG 18811]
 gi|299887958|emb|CBL91926.1| Cell division protein, MraZ protein [Leuconostoc gasicomitatum LMG
           18811]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 66/142 (46%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D KGR+ +P  FR  L ++ I   +        A+      + E  E+++
Sbjct: 1   MFMGEYSHTLDIKGRLIIPAKFRNQLGEKFIVTRWM-----EHALRAMPMPVWEKLEKQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A Q    V  G +  ++D +GRI++   ++ + G+E  VT  G G+ F++W
Sbjct: 56  NALPLGKKEARQFKRFVMAGAMEAEIDKQGRIIIPSNLKDYAGLEKSVTVTGSGDSFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +      + +++  ++ +
Sbjct: 116 SSENWHDYTLATADDF-DEIAE 136


>gi|312112903|ref|YP_004010499.1| MraZ domain protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218032|gb|ADP69400.1| MraZ domain protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 150

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/144 (30%), Positives = 73/144 (50%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F S +  K+D +GRV++P  FR +LAQ   ++++C+    +  I  G S L+E  ++
Sbjct: 1   MDEFASRIDSKVDQRGRVAIPAPFRAVLAQEGTSEIHCYPHLDYATIEAGGSRLVEEIKE 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            +      S     L L+  G    LK+D +GR ++   +R   GI     FVG GN FQ
Sbjct: 61  IVGRQPTGSALREALELVYFGECEKLKVDPDGRTVLPKRLRDHAGITETAVFVGLGNKFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W P+ + K +E +R +      +
Sbjct: 121 IWEPEAYNKFRERAREQALALRKE 144


>gi|317124640|ref|YP_004098752.1| MraZ protein [Intrasporangium calvum DSM 43043]
 gi|315588728|gb|ADU48025.1| MraZ protein [Intrasporangium calvum DSM 43043]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  +R  +A      L   +      + +   D      +++
Sbjct: 1   MFLGTHTPRLDDKGRIFLPAKYRDRMA----GGLVVTRG-QEHCLFLYPMDEFVKVAEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S  A     +   G      D +GR  +   +R + G++ EVT +G G   ++W
Sbjct: 56  RQAPTTSKAARDYMRVFLSGASDEVPDKQGRFTIPANLRHYAGLDREVTVIGAGARLEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +    E +   +   + +
Sbjct: 116 DSGAWNAYLEATEQSFADTVEE 137


>gi|254787006|ref|YP_003074435.1| cell division protein MraZ [Teredinibacter turnerae T7901]
 gi|259509664|sp|C5BP43|MRAZ_TERTT RecName: Full=Protein MraZ
 gi|237686398|gb|ACR13662.1| MraZ protein [Teredinibacter turnerae T7901]
          Length = 147

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 63/143 (44%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  N    +D+KGR+++P + R  LA  C   +          I +      +    KI
Sbjct: 1   MFQGNQAINMDAKGRMAIPAMHRDALASACGGRIVMTAHTEDRCILIYPEPEWQEILPKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  A +   L+ G    +++DS GR+L+   +R +  ++ ++  VG G  F+LW
Sbjct: 61  EALPTFNKAALRAQRLLLGYACAMELDSNGRVLVPPTLRNYANLDKKLMLVGMGKKFELW 120

Query: 123 NPQTFRKLQE--ESRNEYCRQLL 143
           + +++       +   E   ++L
Sbjct: 121 SEESWWASVADLDVDEELPAEML 143


>gi|297559863|ref|YP_003678837.1| MraZ protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296844311|gb|ADH66331.1| MraZ protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 56/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  +R  L+      L   +      + V  ++        +
Sbjct: 1   MFLGTHTPRLDQKGRLFLPAKYRDELS----GGLVITKG-QERCLYVFPTEEFRRITDAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +      S ++         D +GR+ +   +R + G+E E   +G     ++W
Sbjct: 56  ATTPVTAKAVRDYSRVLFASASDENCDKQGRVTIPAKLRDYAGLERECVVIGANTRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +   + E    +  QL ++
Sbjct: 116 DSRAWSDYEAEQEPAFA-QLSEE 137


>gi|253997378|ref|YP_003049442.1| cell division protein MraZ [Methylotenera mobilis JLW8]
 gi|253984057|gb|ACT48915.1| MraZ protein [Methylotenera mobilis JLW8]
          Length = 148

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 65/135 (48%), Gaps = 1/135 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+K R++VP   R  L   C  +L          + +      E  + K+
Sbjct: 1   MFRGATSLSLDAKNRLTVPTKHREALQLECAGNLVLT-AHPHRCLLLYPQPAWEPIQAKM 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F  Q++ L  L+ G    + +DS GR+L++  +R F G++ EV  VG+G++F+LW
Sbjct: 60  MALSSFDKQSSALQRLLVGFAEDISLDSAGRLLVSPVLRDFAGLDKEVMLVGQGSHFELW 119

Query: 123 NPQTFRKLQEESRNE 137
           +   +R   E+   +
Sbjct: 120 SMTAWRAQLEQVMQD 134


>gi|237733758|ref|ZP_04564239.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229383096|gb|EEO33187.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 59/142 (41%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P   R      C   +   + F    +++   +    + QK+
Sbjct: 1   MFMGEFRHNIDAKGRLIIPSKLREQ----CGESVVITRGF-DGCLALYTQEGWNDYYQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A     ++       + D  GR+ + + +R+   +E E   VG G++ ++W
Sbjct: 56  QTLPKTKREARNFVRIITSRASECEFDKLGRVNIPNVLRIEGKLEKECIIVGVGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   +    + +++ +  ++ +
Sbjct: 116 NQNIWDDYYDANKDNF-DEISE 136


>gi|313899194|ref|ZP_07832714.1| protein MraZ [Clostridium sp. HGF2]
 gi|312956017|gb|EFR37665.1| protein MraZ [Clostridium sp. HGF2]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 56/145 (38%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L                  ++V   +  E   +++
Sbjct: 1   MFMGEYAHNIDKKGRIIIPAKFREELGD-----HVIITRGLDGCLAVYTKEQWETIYEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A     ++       ++D++GR+L+   +     +  E   +G  N+ ++W
Sbjct: 56  MKLPSTKKDARMFVRMMTSKAAECEIDAQGRVLIPSPLVKLAELVKECMVIGAANHVEIW 115

Query: 123 NPQTFRKLQEESRNEY---CRQLLQ 144
           + + +  + EE+ + +      L +
Sbjct: 116 SRERWEPVDEEANDAFEDIAESLTE 140


>gi|313677371|ref|YP_004055367.1| mraz protein [Marivirga tractuosa DSM 4126]
 gi|312944069|gb|ADR23259.1| MraZ protein [Marivirga tractuosa DSM 4126]
          Length = 148

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 65/145 (44%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F      K+D+KGR+ +P   +  L +    +L   + F  P + +      +    
Sbjct: 1   MAFFTGEYDCKLDAKGRMVLPAKIKNALPEGSGDELVVRRGF-EPCLVLYPMLEYKKIFS 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KIA  N F+ +   L      G   +++DS GRIL+   +  F G+E E   VG GN  +
Sbjct: 60  KIAGLNEFNAEYRNLQRNFFRGNAIVELDSAGRILIPKNMMAFAGLEKESIVVGMGNRVE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   +     + + E+   L +K
Sbjct: 120 IWDASKYDDYLIKDQQEFSD-LAEK 143


>gi|47093594|ref|ZP_00231352.1| mraZ protein [Listeria monocytogenes str. 4b H7858]
 gi|47018018|gb|EAL08793.1| mraZ protein [Listeria monocytogenes str. 4b H7858]
          Length = 141

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 51/140 (36%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID KGR+ VP  FR +L    +             +     +  +  E+K+  
Sbjct: 1   MGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKLQT 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W+ 
Sbjct: 56  LPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIWSK 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
             +  +  E+   +   L +
Sbjct: 116 SEWDDVFNEAEESFAD-LAE 134


>gi|300854239|ref|YP_003779223.1| hypothetical protein CLJU_c10530 [Clostridium ljungdahlii DSM
           13528]
 gi|300434354|gb|ADK14121.1| putative protein with a duplicated MraZ domain [Clostridium
           ljungdahlii DSM 13528]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 52/144 (36%), Gaps = 7/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      +DSK R+ +P  FR  L           +      +           E+K+
Sbjct: 1   MFLGEYEHSLDSKNRIIIPSKFREELG----NKFILTKGL-DSCLYAFPLCEWHLLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +  A         G   ++ D +GRIL+   +  +  I  E+  +G  +  ++W
Sbjct: 56  KKLPLTNKNARVFVRFFFSGANEMEPDKQGRILIPQTLLEYAAINKEIVSIGVSSRIEIW 115

Query: 123 NPQTFRKL--QEESRNEYCRQLLQ 144
           + + + +      + +    Q+ +
Sbjct: 116 SKENWIEYNNLNINFDNIAEQMNE 139


>gi|50955158|ref|YP_062446.1| cell division protein MraZ [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|90103492|sp|Q6AE55|MRAZ_LEIXX RecName: Full=Protein MraZ
 gi|50951640|gb|AAT89341.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 55/137 (40%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA      L   +      + V +    +   +KI
Sbjct: 1   MFLGTYAPKLDEKGRIILPAKFREELAS----GLVLTRG-QEHCVYVFSQREFQSLHEKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S QA     +   G      D + R+ +   +R + G++ ++  +G G+  ++W
Sbjct: 56  RQAPVTSKQARDYLRVFLSGASAEVPDKQNRVTVPPALRSYAGLDRDLVVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYC 139
           + + +     +    + 
Sbjct: 116 DAEAWETYLAKQEAAFA 132


>gi|258404865|ref|YP_003197607.1| MraZ protein [Desulfohalobium retbaense DSM 5692]
 gi|257797092|gb|ACV68029.1| MraZ protein [Desulfohalobium retbaense DSM 5692]
          Length = 151

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 61/144 (42%), Gaps = 4/144 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +  + +DSKGR+ +P  FR  +            +F    +        E  E+  
Sbjct: 1   MFRGHSYRNMDSKGRLMLPPEFRDHIVAGDDDGRLMLTNF-DGCVVGYTVPEWEAIERSF 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E N  S +         GG + +++D +GRIL+  ++R +  ++ EV   G G  F++W
Sbjct: 60  YEANNSSKKIRAFQRFFIGGAMDVQLDKQGRILVPPYLRQYASLDREVVLAGVGRKFEIW 119

Query: 123 NPQTFRKLQEESRNEY---CRQLL 143
           +   F   ++E   ++     +L 
Sbjct: 120 SQALFEAQRQEVEEDFDSVMDELA 143


>gi|227877317|ref|ZP_03995390.1| cell division protein MraZ [Lactobacillus crispatus JV-V01]
 gi|256842879|ref|ZP_05548367.1| mraZ protein [Lactobacillus crispatus 125-2-CHN]
 gi|256848747|ref|ZP_05554181.1| mraZ [Lactobacillus crispatus MV-1A-US]
 gi|262045845|ref|ZP_06018809.1| mraZ protein [Lactobacillus crispatus MV-3A-US]
 gi|293381713|ref|ZP_06627694.1| protein MraZ [Lactobacillus crispatus 214-1]
 gi|295692683|ref|YP_003601293.1| protein mraz [Lactobacillus crispatus ST1]
 gi|312977603|ref|ZP_07789350.1| MraZ protein [Lactobacillus crispatus CTV-05]
 gi|227863173|gb|EEJ70619.1| cell division protein MraZ [Lactobacillus crispatus JV-V01]
 gi|256614299|gb|EEU19500.1| mraZ protein [Lactobacillus crispatus 125-2-CHN]
 gi|256714286|gb|EEU29273.1| mraZ [Lactobacillus crispatus MV-1A-US]
 gi|260573804|gb|EEX30360.1| mraZ protein [Lactobacillus crispatus MV-3A-US]
 gi|290921760|gb|EFD98781.1| protein MraZ [Lactobacillus crispatus 214-1]
 gi|295030789|emb|CBL50268.1| Protein mraZ [Lactobacillus crispatus ST1]
 gi|310895342|gb|EFQ44409.1| MraZ protein [Lactobacillus crispatus CTV-05]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P   R  +  + I             I   + +     E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKLRDQIGDKMIFTRGM-----EGCIFGYSMEEWSKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         +   L + G +  + D +GR+ +T  +++   +  E   +G  +  ++W
Sbjct: 56  AKLPLTKRNTRKFMRLFYSGAMECEFDKQGRVNLTTTLKMHAKLIKECVIIGVSDRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +   +EE+  +Y
Sbjct: 116 SKERWTSFEEEANEDY 131


>gi|167745323|ref|ZP_02417450.1| hypothetical protein ANACAC_00014 [Anaerostipes caccae DSM 14662]
 gi|317473245|ref|ZP_07932542.1| MraZ protein [Anaerostipes sp. 3_2_56FAA]
 gi|167655044|gb|EDR99173.1| hypothetical protein ANACAC_00014 [Anaerostipes caccae DSM 14662]
 gi|316899340|gb|EFV21357.1| MraZ protein [Anaerostipes sp. 3_2_56FAA]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 58/143 (40%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L    +             + V      E FE+K+
Sbjct: 1   MFMGEYNHTIDAKGRLIIPSKFREALGSEFVLTKGL-----DGCLFVFPMKEWEAFEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A + S     G    ++D +GRIL+   +R F  ++ EV   G  +  ++W
Sbjct: 56  RSLPLIDKNARKFSRFFLAGASTCELDKQGRILVPGTLREFAQMDKEVVLTGMLDRIEVW 115

Query: 123 NPQTFRKLQE-ESRNEYCRQLLQ 144
           + + + +    +  ++  + + +
Sbjct: 116 SKEQWLENNAYDDMDDIAQSMQE 138


>gi|150016451|ref|YP_001308705.1| cell division protein MraZ [Clostridium beijerinckii NCIMB 8052]
 gi|189028613|sp|A6LTR9|MRAZ_CLOB8 RecName: Full=Protein MraZ
 gi|149902916|gb|ABR33749.1| MraZ protein [Clostridium beijerinckii NCIMB 8052]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 53/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D K R+ VP   R  L           +      +     D     E K+
Sbjct: 1   MFIGEYQHALDPKNRIIVPAKLRDGLG----NKFVITKGL-DGCLYAYPLDEWRILEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   +++D +GR L+   ++ + GIE ++  +G  +  ++W
Sbjct: 56  KTLPLTNKDARSFVRFFFSGACEVELDKQGRGLIPQNLKEYAGIEKDIVSIGVLSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + +  E + +     + +K
Sbjct: 116 SKEKWSEYNESNID--FDSIAEK 136


>gi|90418203|ref|ZP_01226115.1| cell division protein MraZ [Aurantimonas manganoxydans SI85-9A1]
 gi|90337875|gb|EAS51526.1| cell division protein MraZ [Aurantimonas manganoxydans SI85-9A1]
          Length = 153

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/140 (47%), Positives = 85/140 (60%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  FLSN    IDSKGRVSVP  FR ++A R I DL+  +    P + VG  DLLE FE+
Sbjct: 1   MDWFLSNYVNNIDSKGRVSVPASFRQVIAARGIRDLFAMRSLSLPVMEVGGPDLLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++   +PFS     L+L  +G G +LK D+EGRI++TDFIR  TGI ++V FVG   YFQ
Sbjct: 61  QMDAQDPFSEAYQDLALFAYGDGAYLKFDAEGRIVVTDFIRSHTGITDKVAFVGTRKYFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           LW P  F   + E+R     
Sbjct: 121 LWEPARFEAARSEARARLLA 140


>gi|255326219|ref|ZP_05367305.1| MraZ protein [Rothia mucilaginosa ATCC 25296]
 gi|255296673|gb|EET76004.1| MraZ protein [Rothia mucilaginosa ATCC 25296]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D+KGR+ +P  FR  L+      L   +      + V  +   E   +++
Sbjct: 1   MFLGTYSPRMDAKGRIILPAKFREELSA----GLVLTRG-QERCLYVFPAAEFERIHERM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A     +   G      D +GRI +   +R + G+ + +  +G G   ++W
Sbjct: 56  RTAPLPGRAARDFLRVFLSGASDELPDKQGRITIPPILRQYAGLTDNLVVIGSGTRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +    +  E+  
Sbjct: 116 DAAAWEEYLARTEAEFAS 133


>gi|51892338|ref|YP_075029.1| cell division protein MraZ [Symbiobacterium thermophilum IAM 14863]
 gi|90103502|sp|Q67Q58|MRAZ_SYMTH RecName: Full=Protein MraZ
 gi|51856027|dbj|BAD40185.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 138

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ +P   R  L +R I             + V      E   QK+  
Sbjct: 1   MGEFQHAIDAKGRLIIPAKLREGLGERFIATKGL-----DRCLFVFPLAEFEAVSQKLRG 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
               S  A   + L   G    ++D +GRIL+   +R + GI+ +   VG  N  ++W  
Sbjct: 56  LGMSSSAARAFNRLFFSGATECELDPQGRILLPANLREYAGIQKDCVIVGVENRVEIWAA 115

Query: 125 QTFRKLQEESRNEYCRQLLQK 145
           + + +  EE+  E   ++ +K
Sbjct: 116 ERWAEYSEEA-GELYTEIAEK 135



 Score = 33.8 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 7/62 (11%), Positives = 21/62 (33%), Gaps = 4/62 (6%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F      ++D +GR+ +P   R     +    +          + +  ++    + ++  
Sbjct: 71  FSGATECELDPQGRILLPANLREYAGIQKDCVIV----GVENRVEIWAAERWAEYSEEAG 126

Query: 64  EY 65
           E 
Sbjct: 127 EL 128


>gi|315122410|ref|YP_004062899.1| cell division protein MraZ [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495812|gb|ADR52411.1| cell division protein MraZ [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 148

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 117/144 (81%), Positives = 127/144 (88%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           SRFLSN T+KIDSKGRVS+P  FRTIL +RCI DLYCFQDFFFP+ISVGNSD LE FE+K
Sbjct: 5   SRFLSNATKKIDSKGRVSIPSFFRTILTKRCICDLYCFQDFFFPSISVGNSDFLERFERK 64

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I EY+P SIQ NQLSLLVHGGG+FLKMDSEGRI+MTDFIR FTGIENEVTFVGRGNYFQL
Sbjct: 65  IEEYDPLSIQYNQLSLLVHGGGVFLKMDSEGRIMMTDFIRSFTGIENEVTFVGRGNYFQL 124

Query: 122 WNPQTFRKLQEESRNEYCRQLLQK 145
           WNP TF+ LQE+ RNEYC Q  QK
Sbjct: 125 WNPDTFKNLQEKYRNEYCLQFSQK 148


>gi|330994432|ref|ZP_08318357.1| Protein MraZ [Gluconacetobacter sp. SXCC-1]
 gi|329758432|gb|EGG74951.1| Protein MraZ [Gluconacetobacter sp. SXCC-1]
          Length = 157

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTIL---AQRCITDLYCFQDFFFPAISVGNSDLLEY 57
           MS FL     ++D+KGRVS+P  FRT L   A+              P +    +D    
Sbjct: 1   MSVFLGTHLNRLDAKGRVSIPSAFRTALRARAKSGEPLAILRPSHLHPCLEAWPADAFAA 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
             + + E + FS   + L+  ++      + D EGRIL+ + +R   G+ ++VTF+G G 
Sbjct: 61  LTRPLDEMDIFSEDHDDLATALYADAYPFEADREGRILLPESLRGHAGLTDQVTFMGLGR 120

Query: 118 YFQLWNPQ 125
            FQ+WNPQ
Sbjct: 121 TFQIWNPQ 128


>gi|213965206|ref|ZP_03393403.1| MraZ protein [Corynebacterium amycolatum SK46]
 gi|213952058|gb|EEB63443.1| MraZ protein [Corynebacterium amycolatum SK46]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      Q+ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREDLAGGLMVTK-----GQDHSLAVYPKEEFVKLAQRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +  + +A      +       + D  GRI ++   R +  +  E   +G  ++ ++W
Sbjct: 56  TKASRTNAKARAFIRNLAASTDEQRPDGSGRITLSMDHRRYANLSKECVVIGSIDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +++   Q E   ++  
Sbjct: 116 DKESWEAYQAEHEADFSE 133


>gi|283458389|ref|YP_003363013.1| hypothetical protein RMDY18_13610 [Rothia mucilaginosa DY-18]
 gi|283134428|dbj|BAI65193.1| uncharacterized protein conserved in archaea [Rothia mucilaginosa
           DY-18]
          Length = 143

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D+KGR+ +P  FR  L+      L   +      + V  +   E   +++
Sbjct: 1   MFLGTYSPRMDAKGRIILPAKFREELSA----GLVLTRG-QERCLYVFPAAEFERIHERM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A     +   G      D +GRI +   +R + G+ + +  +G G   ++W
Sbjct: 56  RTAPLPGRAARDFLRVFLSGASDELPDKQGRITIPPILRQYAGLTDNLVVIGSGTRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +    +  E+  
Sbjct: 116 DAAAWEEYLARTEAEFAA 133


>gi|118587350|ref|ZP_01544776.1| cell division protein MraZ [Oenococcus oeni ATCC BAA-1163]
 gi|118432174|gb|EAV38914.1| cell division protein MraZ [Oenococcus oeni ATCC BAA-1163]
          Length = 167

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 57/144 (39%), Gaps = 6/144 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      +D K R+ +P  FR  L    +   +        ++     D  + FE+K
Sbjct: 24  RMFMGEYQHTLDDKSRLIIPAKFRNQLGDTFVVTRWM-----EHSLFAFPKDEWDKFEEK 78

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +    +  A      V  G I    D +GRI++   ++    ++  V   G GN F++
Sbjct: 79  LNKLPFGAKDARAFRRFVLAGAIESDFDKQGRIIIPTVLKEHAQLKKNVVITGSGNGFEI 138

Query: 122 WNPQTFRKLQEESRNEYCRQLLQK 145
           W+   + +    +   +  Q+ ++
Sbjct: 139 WSKDNWEEYTAGTAENF-DQIAEE 161


>gi|262273822|ref|ZP_06051635.1| cell division protein mraZ [Grimontia hollisae CIP 101886]
 gi|262222237|gb|EEY73549.1| cell division protein mraZ [Grimontia hollisae CIP 101886]
          Length = 152

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 3/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                     D+KGRV++P  +R  L   C     C  D   P + +      E  E K+
Sbjct: 1   MLRGVSAISPDAKGRVALPKRYREELDALCDGVFVCTIDHQLPCLLLYPLPEWERIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +  +    +L  L+ G     +MD +GRIL+   +R + G+  +   VG+ N F++W
Sbjct: 61  SRLSSLNPAERRLQRLLLGHAFECEMDGQGRILIAPTLRDYAGLHGKAMLVGQLNKFEIW 120

Query: 123 NPQTFRKLQE---ESRNEYCRQLLQK 145
           N   +++  +   + + E    L  +
Sbjct: 121 NSDKWQQQIDLDIQHQAESAEALSDR 146


>gi|51473751|ref|YP_067508.1| cell division protein MraZ [Rickettsia typhi str. Wilmington]
 gi|90103499|sp|Q68WG6|MRAZ_RICTY RecName: Full=Protein MraZ
 gi|51460063|gb|AAU04026.1| protein MraZ [Rickettsia typhi str. Wilmington]
          Length = 149

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 64/136 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FLS     +D K RV+VP  +R +L +     +  +       I V     +E   +
Sbjct: 1   MNVFLSKYINGVDKKSRVTVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGIAHIEKLRK 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +P+S + +    ++ G  + L  D EGRI++   +     IE +  FVG+G  F+
Sbjct: 61  MIETLDPYSEERDAFETMIFGEAVQLAFDGEGRIILPQSLMKHADIEEQACFVGKGIIFE 120

Query: 121 LWNPQTFRKLQEESRN 136
           +W PQ F K    ++N
Sbjct: 121 IWQPQNFEKYLSYAQN 136


>gi|308177868|ref|YP_003917274.1| MraZ protein [Arthrobacter arilaitensis Re117]
 gi|307745331|emb|CBT76303.1| MraZ protein [Arthrobacter arilaitensis Re117]
          Length = 137

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 63/138 (45%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  +R  L+      L   +      I V +    E   +++
Sbjct: 1   MFLGTYTPRLDEKGRLILPAKYRDELS----YGLVLTRG-QERCIYVFSQREFEKQHEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +  S +A   + +   G      D +GR+ +   +R + G++ EVT +G GN  ++W
Sbjct: 56  AQASLTSRRARDYARVFLSGASDEVPDKQGRVTIPQVLRTYGGLDREVTVIGAGNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +++  +E    +  
Sbjct: 116 DTTAWQQYLDEQEEVFSD 133


>gi|256830380|ref|YP_003159108.1| MraZ protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579556|gb|ACU90692.1| MraZ protein [Desulfomicrobium baculatum DSM 4028]
          Length = 151

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 59/146 (40%), Gaps = 4/146 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +  +  D KGR+ +P  FR  +            +F    ++       E  EQ  
Sbjct: 1   MFRGHSQRTQDPKGRLMLPPEFRDEVFANSPDGKLVLTNFDD-CVAAYPLPEWEIIEQSF 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ N    +          G   + +D +GRIL+   +R + G++ ++   G G  F++W
Sbjct: 60  SKLNMADRKVRDFHRFFISGAAEVTLDKQGRILIPPHLRNYAGLQKDIVLAGVGRKFEIW 119

Query: 123 NPQTFRK---LQEESRNEYCRQLLQK 145
           + + F       +E+ ++    L +K
Sbjct: 120 DQERFEAGRNALQENVDQVMDDLAEK 145


>gi|251772189|gb|EES52759.1| MraZ family protein [Leptospirillum ferrodiazotrophum]
          Length = 149

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 53/135 (39%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F       +D+KGRV++P  FR  L                  + V    + +  E 
Sbjct: 3   MAFFRGRYLHSLDAKGRVAIPQRFRESLGGGDEALRLVMTVDPEGCLVVYPEAVWQELEG 62

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K       + +       + G      +D +GRIL+   +R + G+E++V FVG    F+
Sbjct: 63  KWHSLPQMNDELKTYLRFMVGWASDGALDRQGRILVPPPLREYAGLEHDVWFVGVLQNFE 122

Query: 121 LWNPQTFRKLQEESR 135
           +WN     K     R
Sbjct: 123 IWNGDRLEKATGRDR 137


>gi|300858823|ref|YP_003783806.1| protein MraZ [Corynebacterium pseudotuberculosis FRC41]
 gi|300686277|gb|ADK29199.1| protein MraZ [Corynebacterium pseudotuberculosis FRC41]
 gi|302206528|gb|ADL10870.1| Cell division protein MraZ [Corynebacterium pseudotuberculosis
           C231]
 gi|302331083|gb|ADL21277.1| Cell division protein MraZ [Corynebacterium pseudotuberculosis
           1002]
 gi|308276770|gb|ADO26669.1| Cell division protein MraZ [Corynebacterium pseudotuberculosis I19]
          Length = 143

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            ++SV   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDELAGGLMVTK-----GQDHSLSVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D +GRI ++   R + G+  +   +G  ++ ++W
Sbjct: 56  AAISRTNPEARAFIRNLAASADEQRPDGQGRITLSAAHREYAGLTKQCVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +   Q E+   +  
Sbjct: 116 DAEAWEAYQSETEAAFSS 133


>gi|221632090|ref|YP_002521311.1| mraZ protein [Thermomicrobium roseum DSM 5159]
 gi|254813293|sp|B9L273|MRAZ_THERP RecName: Full=Protein MraZ
 gi|221155812|gb|ACM04939.1| mraZ protein [Thermomicrobium roseum DSM 5159]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 5/125 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T  ID KGR+++P  FR     + +             +++   D  +   +K+
Sbjct: 1   MFLGRFTHAIDDKGRLAIPARFREAFRGQGVLTRGI-----DRCLTLYPMDSWQPLAEKV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +     A     +V      ++ D +GRIL+   +R + G+E E   VG  +Y ++W
Sbjct: 56  SSLSISDPDARAFRRMVFAEATVVEFDRQGRILLPPELRAYAGLEREAIVVGVHSYVEIW 115

Query: 123 NPQTF 127
           +P+ +
Sbjct: 116 SPENW 120


>gi|296110610|ref|YP_003620991.1| hypothetical protein LKI_02395 [Leuconostoc kimchii IMSNU 11154]
 gi|295832141|gb|ADG40022.1| hypothetical protein LKI_02395 [Leuconostoc kimchii IMSNU 11154]
          Length = 143

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+KGR+ +P  FR  L  + I   +        A+      + E  E+++
Sbjct: 1   MFMGEYSHTLDTKGRLIIPAKFRNQLGDKFIVTRWM-----EHALRAMPMPIWEKLEEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A Q    V  G +  ++D +GRI++   ++ +  +E  VT  G G+ F++W
Sbjct: 56  NQLPLGKKEARQFKRFVLAGAMEAEIDKQGRIIIPSNLKAYASLEKSVTVTGSGDSFEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +      +  ++  ++ +
Sbjct: 116 SSENWHDYTLATAEDF-DEIAE 136


>gi|283783557|ref|YP_003374311.1| protein MraZ [Gardnerella vaginalis 409-05]
 gi|298252637|ref|ZP_06976431.1| conserved uncharacterized protein [Gardnerella vaginalis 5-1]
 gi|283441423|gb|ADB13889.1| protein MraZ [Gardnerella vaginalis 409-05]
 gi|297533001|gb|EFH71885.1| conserved uncharacterized protein [Gardnerella vaginalis 5-1]
          Length = 270

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 55/137 (40%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L   T KID KGRV++P  FR+ L     T     +      + V      +    +I 
Sbjct: 129 LLGTYTPKIDDKGRVALPAKFRSQLG----TGFVMARG-QEHCVYVLPMVEFQRMATQIQ 183

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
             +  +  A     +   G +  + D +GRI++   +R +  + +++  +G G   ++WN
Sbjct: 184 RTSMSNKSARDYLRVFLSGAVDEEPDKQGRIVVPPMLRDYANLGDQIVVIGVGTRAEIWN 243

Query: 124 PQTFRKLQEESRNEYCR 140
              + +   +    Y  
Sbjct: 244 KSAWEEYLADREQGYAD 260


>gi|311693446|gb|ADP96319.1| MraZ protein [marine bacterium HP15]
          Length = 150

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 1/138 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFF-PAISVGNSDLLEYFE 59
           MS FL +    +D+KGR+++P   R  LAQ C   +    +      + V      E   
Sbjct: 1   MSNFLGSHAINMDAKGRLAIPSKVREELAQACGGRIVLTANADEERCLLVYPEPEWEVLR 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            KI      +  A +L  L+ G    +++DS GRIL+   +R +  +E ++  +G+G   
Sbjct: 61  PKIEALPNMNKAARRLQRLILGNAAPMELDSAGRILIPPTLRSYAHLEKKLMLIGQGKKL 120

Query: 120 QLWNPQTFRKLQEESRNE 137
           +LW+ + +    +ES ++
Sbjct: 121 ELWSEERWFAWLDESSDD 138


>gi|154505716|ref|ZP_02042454.1| hypothetical protein RUMGNA_03256 [Ruminococcus gnavus ATCC 29149]
 gi|153794013|gb|EDN76433.1| hypothetical protein RUMGNA_03256 [Ruminococcus gnavus ATCC 29149]
          Length = 145

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID KGR+ +P   R  L +      +   +     + V + D    F  ++
Sbjct: 1   MLLGEFNHSIDEKGRLIIPAKLRDDLGES-----FVICNGLEGCLFVYSQDEWNQFVAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A        G       D +GR+ +   +R    +E +V  VG  +  ++W
Sbjct: 56  NTLPRMNKDARIFKRYFFGSASEGSFDKQGRVSVPASLRKAAHLEKDVVLVGVQDRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +    S  +    + ++
Sbjct: 116 DKALWEERSMVSEEDL-DAIAER 137


>gi|257056487|ref|YP_003134319.1| mraZ protein [Saccharomonospora viridis DSM 43017]
 gi|256586359|gb|ACU97492.1| mraZ protein [Saccharomonospora viridis DSM 43017]
          Length = 143

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +             + V      E   +++
Sbjct: 1   MFLGTHTPKLDDKGRLTLPAKFRDALAGGLMITK-----GQDHCLFVFPRAEFEQLARRV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +         +  G    + D +GRI +   +R + G+  E   +G     ++W
Sbjct: 56  AEAPFTNESVRAYQRYLFAGTEEQRPDGQGRIAIAPELRRYAGLTKECVVIGAITRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    EE  + Y +   +
Sbjct: 116 DARAWGAYLEEHEDSYAKAQEE 137


>gi|315924811|ref|ZP_07921028.1| cell division protein MraZ [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621710|gb|EFV01674.1| cell division protein MraZ [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 50/144 (34%), Gaps = 5/144 (3%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M       T  ID KGR+ VP  FR  L +         +      +        +  ++
Sbjct: 1   MDAIFGEYTYNIDDKGRLIVPPKFRDFLGE----TFVITRGL-DGCLFGFPEGEWQVLQE 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K++       +A   +   + G     MD +GR+ +   +R F  +   V  VG     +
Sbjct: 56  KLSALPLADKKARAFTRFFYAGAAACAMDKQGRVGIPQGLRDFASLRKNVVIVGVTKRIE 115

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+   ++   E +       +  
Sbjct: 116 IWDKAKWQAYNEATAANLADAMAD 139


>gi|308271431|emb|CBX28039.1| Protein mraZ [uncultured Desulfobacterium sp.]
          Length = 160

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 57/141 (40%), Gaps = 2/141 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           ++ F       ID+KGR+ +P  FR I+       +          +     +     E 
Sbjct: 11  LNMFRGTSFHTIDTKGRLIIPSRFRDIIRNSENDGVMV--SRMDRTLYAYTFEEWRKIEN 68

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI      S    +   +  GG      D   RIL+   +R + G+E ++  VG  ++F+
Sbjct: 69  KILSLKEISESMRRFRRVFIGGAFECSCDKHDRILIPPTLRQYAGLEKDMVLVGALDHFE 128

Query: 121 LWNPQTFRKLQEESRNEYCRQ 141
           +W+ + + K  E+   +  ++
Sbjct: 129 IWSLENWNKELEQLEIDSKKE 149


>gi|206889926|ref|YP_002249142.1| MraZ protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741864|gb|ACI20921.1| MraZ protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 151

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 58/141 (41%), Gaps = 1/141 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTIL-AQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59
           M  F+      +D KGRV +P   R +L  +    +LY     F  A+ +   +     E
Sbjct: 1   MISFIGKYYHNLDQKGRVIMPASLREVLTNKYSSGELYLTNAPFDKALHLYPLEEWLKLE 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +KI                V    I  ++D +GRIL+    R   GI + V  VG+    
Sbjct: 61  EKIRGLPKSDESVMYFLRRVIASAIPCELDKQGRILIPYEHRQDAGINSAVVIVGQIERI 120

Query: 120 QLWNPQTFRKLQEESRNEYCR 140
           ++W+  T+  + + ++ +  R
Sbjct: 121 EIWDKATWDSITDPTKVDIKR 141


>gi|295099997|emb|CBK89086.1| mraZ protein [Eubacterium cylindroides T2-87]
          Length = 141

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 57/140 (40%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID KGR+ +P  FR  L +                + V   +  +   +K++ 
Sbjct: 1   MGEYAHNIDRKGRLIMPAKFREELGE-----HVVVNRGLDGCLYVYTVEQWQAVYEKLST 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
               +  A     ++       +MD +GRIL+   +    G+E E   +G  N+ ++W+ 
Sbjct: 56  LPSTNKDARMYQRMMLSKAAECEMDGQGRILIPSSLVALAGLEKECLIIGVANHLEIWSK 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
           + + +L+EE    +  +  +
Sbjct: 116 ERWERLEEEQSASF-EEAAE 134


>gi|239917870|ref|YP_002957428.1| mraZ protein [Micrococcus luteus NCTC 2665]
 gi|281413636|ref|ZP_06245378.1| cell division protein MraZ [Micrococcus luteus NCTC 2665]
 gi|289704964|ref|ZP_06501379.1| protein MraZ [Micrococcus luteus SK58]
 gi|259509658|sp|C5CA39|MRAZ_MICLC RecName: Full=Protein MraZ
 gi|239839077|gb|ACS30874.1| mraZ protein [Micrococcus luteus NCTC 2665]
 gi|289558300|gb|EFD51576.1| protein MraZ [Micrococcus luteus SK58]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D K R+ +P  FR  LA+     L   +      I V ++   E   +++
Sbjct: 1   MFLGTYTPRLDEKSRLILPAKFREELAE----GLVLTRG-QERCIYVFSAREFERVHEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S QA     +   G      D +GR+ +   +R + G++ +VT +G G   ++W
Sbjct: 56  RSAPLSSRQARDYIRVFLSGASDEVPDKQGRVTVPAPLRQYAGLDRDVTVIGAGTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +++     E    +  
Sbjct: 116 DSESWNTYLAEQEAAFSE 133


>gi|330718674|ref|ZP_08313274.1| cell division protein MraZ [Leuconostoc fallax KCTC 3537]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR  L ++ I   +  +      +     +L    E ++
Sbjct: 1   MFMGEYQHTLDTKGRLIIPAKFRNQLGEKFIITRWLDRS-----LRGMPIELWHELEAQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   LV  G +  + D +GRIL+   ++ +  +  +V   G G+ FQ+W
Sbjct: 56  NALPAGKSDARKFRALVFAGAMAAEFDKQGRILLPANLKGYADLTKDVAVTGNGDSFQIW 115

Query: 123 NPQTFRKLQEESRNEY---CRQLLQ 144
           N Q + + Q E+   +      L  
Sbjct: 116 NAQHWLEYQREAEANFDSIAEDLSD 140


>gi|300788106|ref|YP_003768397.1| MraZ protein [Amycolatopsis mediterranei U32]
 gi|299797620|gb|ADJ47995.1| MraZ protein [Amycolatopsis mediterranei U32]
          Length = 146

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + FL   T K+D KGR+++P  FR  LA   +             + V      E   +K
Sbjct: 3   AVFLGTHTPKLDDKGRLALPAKFRDALAGGLMLTK-----GQDHCLFVFPRAEFEQMARK 57

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +AE    +         +  G    + D +GRI +   +R + G+  E   +G     ++
Sbjct: 58  VAEAPFTNEAVRAYQRYLFAGTDEQRPDGQGRITIAPELRRYAGLSKECVVIGAITRLEI 117

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+ Q ++   EE  + Y +   +
Sbjct: 118 WDAQAWQGYLEEHEDSYAKAREE 140


>gi|294791088|ref|ZP_06756246.1| MraZ protein [Scardovia inopinata F0304]
 gi|294458985|gb|EFG27338.1| MraZ protein [Scardovia inopinata F0304]
          Length = 185

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGRV++P  FR  L   C+             I +           +I
Sbjct: 42  LLLGTYTPKIDAKGRVALPAKFRQQLGSGCVLAR-----GQERCIYLLPFAEFRRIAAQI 96

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +  + D +GR+ +   +R +  I  ++  +G G   ++W
Sbjct: 97  QRTSLSNKAARSYLRVFLSGAVDQEPDKQGRVTLPSMLRDYAHISKDIVVIGVGTRAEIW 156

Query: 123 NPQTFRKLQEESRNEYCR 140
           N   +    ++  + Y  
Sbjct: 157 NKADWDTYLDQQEDGYSD 174


>gi|158316864|ref|YP_001509372.1| cell division protein MraZ [Frankia sp. EAN1pec]
 gi|226709983|sp|A8KZB0|MRAZ_FRASN RecName: Full=Protein MraZ
 gi|158112269|gb|ABW14466.1| MraZ protein [Frankia sp. EAN1pec]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + T ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHTPRLDDKGRLTLPAKFREELE----GGLVITKG-QERCLYVFPLAEFTRISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R + G+  E    G     ++W
Sbjct: 56  RTAPVTAKALRDYSRVFFSSASDDVPDRQGRITIPPPLRAYAGLVRECVVNGANTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q +     +    +  ++ ++
Sbjct: 116 DSQRWDTYLADQEETFA-EMSEE 137


>gi|118469214|ref|YP_888513.1| cell division protein MraZ [Mycobacterium smegmatis str. MC2 155]
 gi|167012255|sp|A0R025|MRAZ_MYCS2 RecName: Full=Protein MraZ
 gi|118170501|gb|ABK71397.1| MraZ protein [Mycobacterium smegmatis str. MC2 155]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 62/142 (43%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V   D  E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRDEFEKLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  + +A      +         D++GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  SQASRSNPEARAFLRSLAAATDEQHPDAQGRITLSADHRRYANLSKDCVVIGSVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +++ Q+     +     +
Sbjct: 116 DAQAWQEYQQAHEENFSAATDE 137


>gi|295394730|ref|ZP_06804945.1| cell division protein MraZ [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972326|gb|EFG48186.1| cell division protein MraZ [Brevibacterium mcbrellneri ATCC 49030]
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL    Q++D KGR+ +P  FR  LA      L   +      +++ ++   E   +K+
Sbjct: 1   MFLGTHMQRLDDKGRLILPARFREELA----GGLVVTRG-QEHCLTLFSAREFEAVHEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S  A     +   G    + D +GRI +   +R + G+E E+  +G GN  ++W
Sbjct: 56  RTAPMTSKDARDYLRVFLSGASAEQPDKQGRITIPQILRKYAGLERELAVIGLGNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +  T+     E+   +  +  +
Sbjct: 116 DAHTWESYLNETEQGFADRTDE 137


>gi|312143946|ref|YP_003995392.1| MraZ protein [Halanaerobium sp. 'sapolanicus']
 gi|311904597|gb|ADQ15038.1| MraZ protein [Halanaerobium sp. 'sapolanicus']
          Length = 143

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 57/145 (39%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T  +D+KGR+ +P   R  L++  +             + +   D  +  E+K+
Sbjct: 1   MFMGEFTHNMDNKGRLIIPSKLREELSEEFVITRGL-----DNCLFLYPMDEWKILEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S  A         G     +D +GR+ +   +R +   E+E+  +G  N  +LW
Sbjct: 56  TSLPMTSKNARNFVRFFFSGANECNLDKQGRVSLPVNLRDYADFEHEIVIIGLANRIELW 115

Query: 123 NPQTFRKLQEESRN---EYCRQLLQ 144
             + + K  E+  +   +    + +
Sbjct: 116 AKEKWDKYMEDVEDSYEDIADAMEE 140


>gi|225351428|ref|ZP_03742451.1| hypothetical protein BIFPSEUDO_03023 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157772|gb|EEG71055.1| hypothetical protein BIFPSEUDO_03023 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 171

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 28  LLLGTYTPKIDAKGRMALPAKFRSQLG----PGMVMARG-QERCVYLLPQSEFRRIALQI 82

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +  + D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 83  QRTSMGNKAARDYLRVFLSGAVDQEPDRQGRVLVPQMLRDYANLGSDIVVIGVGTRAEIW 142

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q + +   E    Y  
Sbjct: 143 NKQAWEEYLAEQEQGYSD 160


>gi|330981227|gb|EGH79330.1| cell division protein MraZ [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 151

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 56/126 (44%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D++GR+++P  +R  L  R    L    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDARGRLAMPSRYRDELDSRSAGQLIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L+ D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLEFDGGGRFLVPPRLREYARLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|268318249|ref|YP_003291968.1| MraZ protein [Rhodothermus marinus DSM 4252]
 gi|262335783|gb|ACY49580.1| MraZ protein [Rhodothermus marinus DSM 4252]
          Length = 147

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 61/145 (42%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F       +D KGRV++P   R +L           + F    I +   D  E  E+
Sbjct: 1   MAGFKGQAEYSVDEKGRVAIPAKMRAVLKPEAKGTFTATRGF-EQCIFLYPLDRWEEIEE 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++   N +  +A      +      + +D +GRI++   +  F GI++    +G  ++ +
Sbjct: 60  QMMSLNLYQREARNFVRQLLRWAEEVTLDRQGRIVLPKPLMEFAGIKDRALIIGALDHIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+P TF +        Y   L ++
Sbjct: 120 IWDPATFDQFVNREMESY-ETLAER 143


>gi|302671226|ref|YP_003831186.1| MraZ protein [Butyrivibrio proteoclasticus B316]
 gi|302395699|gb|ADL34604.1| MraZ protein [Butyrivibrio proteoclasticus B316]
          Length = 146

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 6/142 (4%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F    +  ID+KGR+ +P  FR IL ++ +         F   + V + +  E FE+K+ 
Sbjct: 5   FKGEYSHSIDAKGRLIMPAKFREILGEQFVVTR-----GFDGCLFVFSEEGWEKFEEKLQ 59

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                  +A  LS     G I  ++D +GRIL+   +   + IE E    G GN  ++W+
Sbjct: 60  ALPMDKPEARMLSRFFLAGAIDAEVDKQGRILIPSNLLAHSKIEKEAVVAGVGNRVEIWS 119

Query: 124 PQTFRKLQE-ESRNEYCRQLLQ 144
              + K    +  N    ++ +
Sbjct: 120 KDEWEKASTFDDINSIAAKMSE 141


>gi|297243795|ref|ZP_06927725.1| conserved uncharacterized protein [Gardnerella vaginalis AMD]
 gi|296888216|gb|EFH26958.1| conserved uncharacterized protein [Gardnerella vaginalis AMD]
          Length = 270

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 55/137 (40%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L   T KID KGRV++P  FR+ L     T     +      + V      +    +I 
Sbjct: 129 LLGTYTPKIDDKGRVALPAKFRSQLG----TGFVMARG-QEHCVYVLPMVEFQRMTTQIQ 183

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
             +  +  A     +   G +  + D +GRI++   +R +  + +++  +G G   ++WN
Sbjct: 184 RTSMSNKSARDYLRVFLSGAVDEEPDKQGRIVVPPMLRDYANLGDQIVVIGVGTRAEIWN 243

Query: 124 PQTFRKLQEESRNEYCR 140
              + +   +    Y  
Sbjct: 244 KSAWEEYLADREQGYAD 260


>gi|330888583|gb|EGH21244.1| cell division protein MraZ [Pseudomonas syringae pv. mori str.
           301020]
          Length = 151

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 57/126 (45%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D++GR+++P  +R  L  R    L    D   P + +      E  E K+
Sbjct: 1   MFRGANAINLDARGRLAMPSRYRDELDSRSAGQLIVTIDAVDPCLCLYPLSEWELIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +   F  +  +L  L+ G  + L++D  GR L+   +R +  ++  V  VG+ N FQLW
Sbjct: 61  RDLATFREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYARLDKRVMLVGQLNKFQLW 120

Query: 123 NPQTFR 128
           +   + 
Sbjct: 121 DEDAWN 126


>gi|296532829|ref|ZP_06895501.1| cell division protein MraZ [Roseomonas cervicalis ATCC 49957]
 gi|296266842|gb|EFH12795.1| cell division protein MraZ [Roseomonas cervicalis ATCC 49957]
          Length = 158

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 67/140 (47%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RF+   T ++D KGRVSVP  FR  LA+    ++          +     +  E    
Sbjct: 1   MTRFMGTHTNRLDRKGRVSVPAPFRAELARLGTEEIVLRPSHRMACVEAWPMNAFEAMAG 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I +++ FS   + ++  +      ++ D+EGRIL+ + +    G+   + FVG G  FQ
Sbjct: 61  GIDQFDVFSDAQDDMAAALFADAWPMRPDAEGRILLPEELIAHAGLGETIAFVGLGRIFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           LW P   ++  EE+RN    
Sbjct: 121 LWEPAAAKRRTEEARNRARE 140


>gi|298531024|ref|ZP_07018425.1| MraZ protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509047|gb|EFI32952.1| MraZ protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 151

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 56/145 (38%), Gaps = 4/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +  + ID KGR+ +P  FR  + +          +F             E  EQ  
Sbjct: 1   MFRGHSQRSIDPKGRLMLPPEFRETILEHSPEGRVMLTNF-DGCAVGYPLPEWERIEQSF 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + N  + +          G   + +D +GRIL+  ++R + G+  EV   G G  F++W
Sbjct: 60  NQLNMANRKFRDFHRFFISGATEISLDKQGRILVPPYLRSYAGMNREVVLAGVGRKFEIW 119

Query: 123 NPQTFRKLQEESRNEY---CRQLLQ 144
           + + F   +     ++      L +
Sbjct: 120 DMERFEAQRRMMEQDFDGIMDSLAE 144


>gi|163816701|ref|ZP_02208064.1| hypothetical protein COPEUT_02891 [Coprococcus eutactus ATCC 27759]
 gi|158447958|gb|EDP24953.1| hypothetical protein COPEUT_02891 [Coprococcus eutactus ATCC 27759]
          Length = 149

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 63/146 (43%), Gaps = 6/146 (4%)

Query: 1   MSRFL-SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59
           MSR L      K+D+KGR+ +P   R  L +  +             + V +++  E F 
Sbjct: 1   MSRCLSGEYEHKLDAKGRLIMPLKLRAELGESFMVTKGI-----DKCLYVYSNEEWESFV 55

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +K+ +    +  A         G +  + D +GRIL++   R +  I+ +V  +G G   
Sbjct: 56  EKLNKLPITNRTARTFKRRFLSGAVKCEPDGQGRILLSPKQREYAEIDKDVIIIGNGEKA 115

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQK 145
           ++W+   +   +  + +E   +L  K
Sbjct: 116 EIWSKANWEGEENVTDDESMAELADK 141


>gi|319440247|ref|ZP_07989403.1| cell division protein MraZ [Corynebacterium variabile DSM 44702]
          Length = 143

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  LA           +    ++++      +   +K 
Sbjct: 1   MFFGTFTPKLDDKGRLTLPAKFREELADG-----LVVVNGQDHSLTIYPQAEFQVRARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE +  + +       +        +DS+GRI +    R + G+  E   +G  +  ++W
Sbjct: 56  AESSRSNPRVRAFVRRLGASADEQTLDSQGRITVAPAHRSYAGLTKECVVIGSVDRIEVW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     E   ++  
Sbjct: 116 DADAYESYLSEHEADFAE 133


>gi|314936660|ref|ZP_07844007.1| MraZ protein [Staphylococcus hominis subsp. hominis C80]
 gi|313655279|gb|EFS19024.1| MraZ protein [Staphylococcus hominis subsp. hominis C80]
          Length = 143

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 5/126 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 1   MFMGEYEHQLDAKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAIEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFR 128
           + +T+ 
Sbjct: 116 DRETWN 121


>gi|289640761|ref|ZP_06472932.1| MraZ protein [Frankia symbiont of Datisca glomerata]
 gi|289509337|gb|EFD30265.1| MraZ protein [Frankia symbiont of Datisca glomerata]
          Length = 143

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 22/143 (15%), Positives = 47/143 (32%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + T ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHTPRLDDKGRLTLPAKFREELE----GGLVITKG-QERCLYVFPMAEFTRISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R +  +  +    G     ++W
Sbjct: 56  RAAPVTAKALRDYSRVFFSSASDDVPDRQGRITIPPALRTYAELTRDCVVNGANTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +          +   L ++
Sbjct: 116 DAARWETYLAGQEENFAA-LSEE 137


>gi|260430922|ref|ZP_05784893.1| protein MraZ [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414750|gb|EEX08009.1| protein MraZ [Silicibacter lacuscaerulensis ITI-1157]
          Length = 167

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
            RF      K+D+KGRVS+P  FR +L               +  + D     +     +
Sbjct: 3   RRFRGESHHKVDAKGRVSIPASFRRVLEASDPNWQPGGNPELVIVYGDHRRKYLECYTME 62

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            ++  + KI      S+Q   L  L HG      +D  GR+++   +R   G+E E  F+
Sbjct: 63  AIDEVDAKIDALPRGSMQRKMLQRLFHGQSFPTTVDETGRLVLPAKLRNKIGLEGEAFFI 122

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+W P+T+   +  +  E+  +L +
Sbjct: 123 AAGDTFQIWKPETYEAEELAATEEWLDELPE 153



 Score = 34.6 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 20/76 (26%), Gaps = 2/76 (2%)

Query: 2   SRFLSN-VTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQD-FFFPAISVGNSDLLEYFE 59
             F        +D  GR+ +P   R  +            D F         ++ L   E
Sbjct: 86  RLFHGQSFPTTVDETGRLVLPAKLRNKIGLEGEAFFIAAGDTFQIWKPETYEAEELAATE 145

Query: 60  QKIAEYNPFSIQANQL 75
           + + E          L
Sbjct: 146 EWLDELPEDFDPMQFL 161


>gi|228475049|ref|ZP_04059777.1| MraZ protein [Staphylococcus hominis SK119]
 gi|228271034|gb|EEK12422.1| MraZ protein [Staphylococcus hominis SK119]
          Length = 146

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 5/126 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+
Sbjct: 4   MFMGEYEHQLDAKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKM 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G I +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 59  KTLPMTKKDARKFMRMFFSGAIEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 118

Query: 123 NPQTFR 128
           + +T+ 
Sbjct: 119 DRETWN 124


>gi|152967152|ref|YP_001362936.1| cell division protein MraZ [Kineococcus radiotolerans SRS30216]
 gi|189028623|sp|A6WCY3|MRAZ_KINRD RecName: Full=Protein MraZ
 gi|151361669|gb|ABS04672.1| MraZ protein [Kineococcus radiotolerans SRS30216]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  FR  L       L   +      + +      +   +++
Sbjct: 1   MFLGTHTPRLDDKGRLILPARFRDQLLD----GLVITRG-QERCLYIFPMQEFQRMHEEM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    + +A     +   G      D +GR+ +   +R + G+E +V  +G G   +LW
Sbjct: 56  RQAPLTNKEARDYQRVFLSGASSELPDKQGRVTVPPLLRTYAGLERDVAVIGAGARVELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T+    +E    +  +  +
Sbjct: 116 DLRTWESYLDEVEPAFADRREE 137


>gi|15924168|ref|NP_371702.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926761|ref|NP_374294.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282790|ref|NP_645878.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483341|ref|YP_040565.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486018|ref|YP_043239.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650290|ref|YP_186054.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           COL]
 gi|82750785|ref|YP_416526.1| cell division protein MraZ [Staphylococcus aureus RF122]
 gi|87161858|ref|YP_493769.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194884|ref|YP_499684.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148267670|ref|YP_001246613.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393728|ref|YP_001316403.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151221300|ref|YP_001332122.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979499|ref|YP_001441758.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509355|ref|YP_001575014.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140650|ref|ZP_03565143.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253731797|ref|ZP_04865962.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733583|ref|ZP_04867748.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005965|ref|ZP_05144566.2| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425232|ref|ZP_05601657.1| mraZ protein [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427892|ref|ZP_05604290.1| mraZ protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430525|ref|ZP_05606907.1| mraZ protein [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433286|ref|ZP_05609644.1| mraZ protein [Staphylococcus aureus subsp. aureus E1410]
 gi|257436128|ref|ZP_05612175.1| mraZ protein [Staphylococcus aureus subsp. aureus M876]
 gi|257795766|ref|ZP_05644745.1| mraZ family protein [Staphylococcus aureus A9781]
 gi|258415990|ref|ZP_05682260.1| mraZ protein [Staphylococcus aureus A9763]
 gi|258419737|ref|ZP_05682704.1| cell division protein mraZ [Staphylococcus aureus A9719]
 gi|258423778|ref|ZP_05686664.1| cell division protein MraZ [Staphylococcus aureus A9635]
 gi|258438779|ref|ZP_05689932.1| mraZ [Staphylococcus aureus A9299]
 gi|258444515|ref|ZP_05692844.1| mraZ [Staphylococcus aureus A8115]
 gi|258447652|ref|ZP_05695796.1| cell division protein MraZ [Staphylococcus aureus A6300]
 gi|258449494|ref|ZP_05697597.1| cell division protein MraZ [Staphylococcus aureus A6224]
 gi|258451876|ref|ZP_05699897.1| mraZ protein [Staphylococcus aureus A5948]
 gi|258454873|ref|ZP_05702837.1| cell division protein MraZ [Staphylococcus aureus A5937]
 gi|262048752|ref|ZP_06021634.1| hypothetical protein SAD30_1582 [Staphylococcus aureus D30]
 gi|262051680|ref|ZP_06023899.1| hypothetical protein SA930_1507 [Staphylococcus aureus 930918-3]
 gi|269202793|ref|YP_003282062.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282892664|ref|ZP_06300899.1| mraZ protein [Staphylococcus aureus A8117]
 gi|282903730|ref|ZP_06311618.1| MraZ protein [Staphylococcus aureus subsp. aureus C160]
 gi|282905494|ref|ZP_06313349.1| mraZ protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908469|ref|ZP_06316299.1| mraZ protein [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910751|ref|ZP_06318554.1| mraZ protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913954|ref|ZP_06321741.1| protein MraZ [Staphylococcus aureus subsp. aureus M899]
 gi|282916428|ref|ZP_06324190.1| mraZ protein [Staphylococcus aureus subsp. aureus D139]
 gi|282918876|ref|ZP_06326611.1| mraZ protein [Staphylococcus aureus subsp. aureus C427]
 gi|282919959|ref|ZP_06327688.1| mraZ protein [Staphylococcus aureus A9765]
 gi|282923999|ref|ZP_06331675.1| mraZ protein [Staphylococcus aureus subsp. aureus C101]
 gi|282929223|ref|ZP_06336798.1| mraZ protein [Staphylococcus aureus A10102]
 gi|283770240|ref|ZP_06343132.1| mraZ protein [Staphylococcus aureus subsp. aureus H19]
 gi|283957921|ref|ZP_06375372.1| MraZ protein [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284024102|ref|ZP_06378500.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           132]
 gi|293500987|ref|ZP_06666838.1| mraZ protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509945|ref|ZP_06668654.1| mraZ protein [Staphylococcus aureus subsp. aureus M809]
 gi|293526534|ref|ZP_06671219.1| protein MraZ [Staphylococcus aureus subsp. aureus M1015]
 gi|294848171|ref|ZP_06788918.1| mraZ protein [Staphylococcus aureus A9754]
 gi|295407116|ref|ZP_06816917.1| mraZ protein [Staphylococcus aureus A8819]
 gi|295427664|ref|ZP_06820296.1| mraZ protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296276146|ref|ZP_06858653.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297208180|ref|ZP_06924610.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297245998|ref|ZP_06929857.1| mraZ protein [Staphylococcus aureus A8796]
 gi|297591378|ref|ZP_06950016.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MN8]
 gi|300912258|ref|ZP_07129701.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381262|ref|ZP_07363915.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|54037829|sp|P65439|MRAZ_STAAN RecName: Full=Protein MraZ
 gi|54037830|sp|P65440|MRAZ_STAAW RecName: Full=Protein MraZ
 gi|54041491|sp|P65438|MRAZ_STAAM RecName: Full=Protein MraZ
 gi|68565675|sp|Q5HGQ3|MRAZ_STAAC RecName: Full=Protein MraZ
 gi|90103500|sp|Q6GHQ7|MRAZ_STAAR RecName: Full=Protein MraZ
 gi|90103501|sp|Q6GA34|MRAZ_STAAS RecName: Full=Protein MraZ
 gi|91207216|sp|Q2YXE4|MRAZ_STAAB RecName: Full=Protein MraZ
 gi|122539745|sp|Q2FZ97|MRAZ_STAA8 RecName: Full=Protein MraZ
 gi|123486281|sp|Q2FHQ9|MRAZ_STAA3 RecName: Full=Protein MraZ
 gi|167012281|sp|A7X1B6|MRAZ_STAA1 RecName: Full=Protein MraZ
 gi|189028640|sp|A6U0Z8|MRAZ_STAA2 RecName: Full=Protein MraZ
 gi|189028641|sp|A5IS64|MRAZ_STAA9 RecName: Full=Protein MraZ
 gi|189028642|sp|A8Z3L9|MRAZ_STAAT RecName: Full=Protein MraZ
 gi|205445845|sp|A6QG78|MRAZ_STAAE RecName: Full=Protein MraZ
 gi|13700977|dbj|BAB42273.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246948|dbj|BAB57340.1| mraZ protein [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204228|dbj|BAB94926.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49241470|emb|CAG40156.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244461|emb|CAG42889.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284476|gb|AAW36570.1| mraZ protein [Staphylococcus aureus subsp. aureus COL]
 gi|82656316|emb|CAI80730.1| conserved hypothetical protein [Staphylococcus aureus RF122]
 gi|87127832|gb|ABD22346.1| protein mraZ [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202442|gb|ABD30252.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147740739|gb|ABQ49037.1| MraZ protein [Staphylococcus aureus subsp. aureus JH9]
 gi|149946180|gb|ABR52116.1| MraZ protein [Staphylococcus aureus subsp. aureus JH1]
 gi|150374100|dbj|BAF67360.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721634|dbj|BAF78051.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160368164|gb|ABX29135.1| hypothetical protein USA300HOU_1118 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253724468|gb|EES93197.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728453|gb|EES97182.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271689|gb|EEV03827.1| mraZ protein [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257274733|gb|EEV06220.1| mraZ protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278653|gb|EEV09272.1| mraZ protein [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281379|gb|EEV11516.1| mraZ protein [Staphylococcus aureus subsp. aureus E1410]
 gi|257284410|gb|EEV14530.1| mraZ protein [Staphylococcus aureus subsp. aureus M876]
 gi|257789738|gb|EEV28078.1| mraZ family protein [Staphylococcus aureus A9781]
 gi|257839326|gb|EEV63800.1| mraZ protein [Staphylococcus aureus A9763]
 gi|257844322|gb|EEV68704.1| cell division protein mraZ [Staphylococcus aureus A9719]
 gi|257846010|gb|EEV70038.1| cell division protein MraZ [Staphylococcus aureus A9635]
 gi|257848038|gb|EEV72031.1| mraZ [Staphylococcus aureus A9299]
 gi|257850008|gb|EEV73961.1| mraZ [Staphylococcus aureus A8115]
 gi|257853843|gb|EEV76802.1| cell division protein MraZ [Staphylococcus aureus A6300]
 gi|257857482|gb|EEV80380.1| cell division protein MraZ [Staphylococcus aureus A6224]
 gi|257860484|gb|EEV83311.1| mraZ protein [Staphylococcus aureus A5948]
 gi|257863256|gb|EEV86020.1| cell division protein MraZ [Staphylococcus aureus A5937]
 gi|259160415|gb|EEW45440.1| hypothetical protein SA930_1507 [Staphylococcus aureus 930918-3]
 gi|259163208|gb|EEW47768.1| hypothetical protein SAD30_1582 [Staphylococcus aureus D30]
 gi|262075083|gb|ACY11056.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940672|emb|CBI49051.1| protein MraZ [Staphylococcus aureus subsp. aureus TW20]
 gi|282313971|gb|EFB44363.1| mraZ protein [Staphylococcus aureus subsp. aureus C101]
 gi|282316686|gb|EFB47060.1| mraZ protein [Staphylococcus aureus subsp. aureus C427]
 gi|282319868|gb|EFB50216.1| mraZ protein [Staphylococcus aureus subsp. aureus D139]
 gi|282322022|gb|EFB52346.1| protein MraZ [Staphylococcus aureus subsp. aureus M899]
 gi|282325356|gb|EFB55665.1| mraZ protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327531|gb|EFB57814.1| mraZ protein [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282330786|gb|EFB60300.1| mraZ protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282589182|gb|EFB94279.1| mraZ protein [Staphylococcus aureus A10102]
 gi|282594675|gb|EFB99659.1| mraZ protein [Staphylococcus aureus A9765]
 gi|282595348|gb|EFC00312.1| MraZ protein [Staphylococcus aureus subsp. aureus C160]
 gi|282764661|gb|EFC04786.1| mraZ protein [Staphylococcus aureus A8117]
 gi|283460387|gb|EFC07477.1| mraZ protein [Staphylococcus aureus subsp. aureus H19]
 gi|283470388|emb|CAQ49599.1| MraZ protein [Staphylococcus aureus subsp. aureus ST398]
 gi|283790070|gb|EFC28887.1| MraZ protein [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285816860|gb|ADC37347.1| Cell division protein MraZ [Staphylococcus aureus 04-02981]
 gi|290920606|gb|EFD97669.1| protein MraZ [Staphylococcus aureus subsp. aureus M1015]
 gi|291095992|gb|EFE26253.1| mraZ protein [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467395|gb|EFF09912.1| mraZ protein [Staphylococcus aureus subsp. aureus M809]
 gi|294824971|gb|EFG41393.1| mraZ protein [Staphylococcus aureus A9754]
 gi|294967969|gb|EFG43997.1| mraZ protein [Staphylococcus aureus A8819]
 gi|295128022|gb|EFG57656.1| mraZ protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296886919|gb|EFH25822.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297177162|gb|EFH36416.1| mraZ protein [Staphylococcus aureus A8796]
 gi|297576264|gb|EFH94980.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           MN8]
 gi|298694469|gb|ADI97691.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300886504|gb|EFK81706.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302332783|gb|ADL22976.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751001|gb|ADL65178.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340245|gb|EFM06186.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312438445|gb|ADQ77516.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312829572|emb|CBX34414.1| mraZ family protein [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315130969|gb|EFT86953.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315194064|gb|EFU24457.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315196908|gb|EFU27251.1| cell division protein MraZ [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141007|gb|EFW32854.1| protein MraZ [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143063|gb|EFW34853.1| protein MraZ [Staphylococcus aureus subsp. aureus MRSA177]
 gi|329313846|gb|AEB88259.1| Protein mraZ [Staphylococcus aureus subsp. aureus T0131]
 gi|329727132|gb|EGG63588.1| protein MraZ [Staphylococcus aureus subsp. aureus 21172]
 gi|329728823|gb|EGG65244.1| protein MraZ [Staphylococcus aureus subsp. aureus 21193]
 gi|329728936|gb|EGG65352.1| protein MraZ [Staphylococcus aureus subsp. aureus 21189]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 5/127 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ +P  FR  L +R I             +     D  +  E+K+
Sbjct: 1   MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLDEWQQIEEKM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W
Sbjct: 56  KTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIW 115

Query: 123 NPQTFRK 129
           + +T+  
Sbjct: 116 DRETWND 122


>gi|42518891|ref|NP_964821.1| cell division protein MraZ [Lactobacillus johnsonii NCC 533]
 gi|268319711|ref|YP_003293367.1| Protein MraZ [Lactobacillus johnsonii FI9785]
 gi|51316299|sp|Q74JZ0|MRAZ_LACJO RecName: Full=Protein MraZ
 gi|41583177|gb|AAS08787.1| MraZ [Lactobacillus johnsonii NCC 533]
 gi|262398086|emb|CAX67100.1| Protein MraZ [Lactobacillus johnsonii FI9785]
 gi|329667563|gb|AEB93511.1| cell division protein MraZ [Lactobacillus johnsonii DPC 6026]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  +  + I             I     +  +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRVEIGDKMIFTRGM-----EGCIFGYPIEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTKRSARKFTRLFYSGAMESEFDKQGRVNLTMTLKEHAALIKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    EE+   Y
Sbjct: 116 SAERWNDFSEEANENY 131


>gi|332670118|ref|YP_004453126.1| MraZ protein [Cellulomonas fimi ATCC 484]
 gi|332339156|gb|AEE45739.1| MraZ protein [Cellulomonas fimi ATCC 484]
          Length = 158

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 55/141 (39%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T ++D KGR+ +P  FR  LA      L   +      + +   D       ++ 
Sbjct: 16  FLGTYTPRLDDKGRLILPAKFRGQLA----PGLVMTRG-QERCLFLLPMDEFRRMHDQLR 70

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +    S QA     +   G      D +GRI +   +R + G++ +V  +G G   ++W+
Sbjct: 71  QAPVTSKQARDYLRVFLSGASDELPDKQGRISIPPVLRKYAGLDRDVAVIGAGTRVEIWD 130

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            Q +     E    Y     +
Sbjct: 131 LQAWETYLAEQEAGYADTAEE 151


>gi|86132599|ref|ZP_01051192.1| MraZ protein [Dokdonia donghaensis MED134]
 gi|85816841|gb|EAQ38026.1| MraZ protein [Dokdonia donghaensis MED134]
          Length = 163

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 60/143 (41%), Gaps = 1/143 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +     KID+KGR+ +P  F+  LA          +  F   + +           K+
Sbjct: 10  NLIGTYECKIDAKGRLMLPQAFKKQLAPILQDGFVLKRAVFQKCLELYPIAEWNVLSAKV 69

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + N F+ + ++     + G   +++D  GRIL++  +  F  +E  +      N  ++W
Sbjct: 70  NKLNRFNKKNDEFIRRFNAGVKPVEVDGTGRILVSKDLGSFAKLEKSIVVNAAFNILEIW 129

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + K  +E+  ++   L ++
Sbjct: 130 DKDLYEKAIDEAAVDFAD-LAEE 151


>gi|163790544|ref|ZP_02184973.1| hypothetical protein CAT7_08185 [Carnobacterium sp. AT7]
 gi|159874147|gb|EDP68222.1| hypothetical protein CAT7_08185 [Carnobacterium sp. AT7]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 54/136 (39%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ +P  FR+ L ++ I             +     +     E+K+
Sbjct: 1   MLMGEHKHNIDAKGRLIMPSKFRSDLGEKFILTRGL-----DGCLFGYPQESWSALEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A   +   +   I  ++D +GRI +   +R +  +E     +G     ++W
Sbjct: 56  KQLPLAKKEARAFTRFFYSAAIECELDKQGRINIPQTLREYAQLEKACHVIGVSERIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           +   + ++  ++   +
Sbjct: 116 SETRWNQVSNDAEEMF 131


>gi|260905296|ref|ZP_05913618.1| cell division protein MraZ [Brevibacterium linens BL2]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL    QK+D KGR+ +P  FR  L+      L   +      +++  +   E   ++I
Sbjct: 1   MFLGTHLQKLDDKGRLILPAKFREELS----PGLVLTRG-QENCLTLFPTTEFEAEHERI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + +A     +        + D +GRI + + +R +  ++ EV  +G GN  ++W
Sbjct: 56  QNAPKTNKEARDYQRVFLSAAFADQPDKQGRITVPNILRQYASLDREVAVIGMGNRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +  T+      ++  +  +  +
Sbjct: 116 DSPTWDNYLVGAQQAFAERENE 137


>gi|72161505|ref|YP_289162.1| cell division protein MraZ [Thermobifida fusca YX]
 gi|91207106|sp|Q47QX8|MRAZ_THEFY RecName: Full=Protein MraZ
 gi|71915237|gb|AAZ55139.1| Protein of unknown function UPF0040 [Thermobifida fusca YX]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 54/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  +R  LA      L   +      + V      E   Q +
Sbjct: 1   MFLGTHSPRLDEKGRMFLPAKYRDELA----GGLVVTKG-QERCLYVFPIREFERITQVL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GR+ +   +R + G+  +   +G     ++W
Sbjct: 56  RAAPVTAKAVRDYSRVFFASASNELPDRQGRVTIPANLRAYAGLNRDCVVIGANTRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + QT+   + E    +  +L ++
Sbjct: 116 DAQTWADYEAEQEQVFA-ELAEE 137


>gi|118618805|ref|YP_907137.1| cell division protein MraZ [Mycobacterium ulcerans Agy99]
 gi|167012259|sp|A0PTJ7|MRAZ_MYCUA RecName: Full=Protein MraZ
 gi|118570915|gb|ABL05666.1| conserved protein [Mycobacterium ulcerans Agy99]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 60/138 (43%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRSEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++    + +A      +  G      DS+GRI ++   R + G+  +   +G  +Y ++W
Sbjct: 56  SKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYAGLTKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q + + Q+     +  
Sbjct: 116 DAQAWHEYQQLHEENFSA 133


>gi|317496842|ref|ZP_07955172.1| MraZ protein [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895854|gb|EFV18006.1| MraZ protein [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGR+ +P  FR  L Q  +             + V   +  E F+ K+
Sbjct: 1   MFMGEFNHTIDAKGRLIIPSRFREELGQEFVMTKGL-----DGCLFVFPQNEWESFQGKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A + S     G    +MD +GR L+   +R F  ++ EV   G  +  ++W
Sbjct: 56  KTLPLINKDARKFSRFFMAGAAPCEMDKQGRTLIPATLREFAQMKKEVVLTGMADRIEIW 115

Query: 123 NPQTF-RKLQEESRNEYCRQLLQ 144
           + + +      E  ++    + +
Sbjct: 116 SKEKWIENNSYEDMDDIAASMQE 138


>gi|296129434|ref|YP_003636684.1| MraZ protein [Cellulomonas flavigena DSM 20109]
 gi|296021249|gb|ADG74485.1| MraZ protein [Cellulomonas flavigena DSM 20109]
          Length = 157

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 53/141 (37%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T ++D KGR+ +P  FR  LA      L   +      + V   D       ++ 
Sbjct: 15  FLGTYTPRLDDKGRLILPAKFRPQLA----GGLVMTRG-QERCLFVLPMDEFRRMHDQLR 69

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S QA     +   G      D +GRI +   +R + G++ +V  +G G   ++W+
Sbjct: 70  TAPVTSKQARDYLRVFLSGASDELPDKQGRISIPPMLRTYAGLDRDVAVIGTGTRVEIWD 129

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
              +     E    Y     +
Sbjct: 130 LAAWETYLAEQEAGYADTTEE 150


>gi|326402226|ref|YP_004282307.1| MraZ protein [Acidiphilium multivorum AIU301]
 gi|325049087|dbj|BAJ79425.1| MraZ protein [Acidiphilium multivorum AIU301]
          Length = 152

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCIT-DLYCFQDFFFPAISVGNSDLLEYFE 59
           MS+FL     ++D+KGRVSVP  FR  L +   +  L          I V  + + E   
Sbjct: 1   MSQFLGTHRNRLDAKGRVSVPAAFRAALRREGDSQGLILRPSHKHRCIEVWPAPVFEALA 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            ++   + FS   + ++  ++     L+ D EGRIL+ + +    G+ + V F+G G  F
Sbjct: 61  TRLQGLDLFSDTHDDMAAALYADAWPLEADKEGRILLPEPLVEHAGLRDSVVFMGLGRTF 120

Query: 120 QLWNP 124
           Q+W P
Sbjct: 121 QIWEP 125


>gi|269127145|ref|YP_003300515.1| MraZ protein [Thermomonospora curvata DSM 43183]
 gi|268312103|gb|ACY98477.1| MraZ protein [Thermomonospora curvata DSM 43183]
          Length = 143

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 54/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+ +P  +R  L+      L   +      + V      +   + +
Sbjct: 1   MFLGTHTPRLDEKGRLFLPAKYREELS----GGLVITKG-QERCLYVFPVAEFQRITEAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                        S +   G      D +GRI +   +R + G+E +   +G     ++W
Sbjct: 56  RTAPLTDKALRAYSRVFFAGACDEVPDKQGRITIPPALRAYAGLERDCAVIGANTRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + ++K  E     +   L ++
Sbjct: 116 DARAWQKYLEAQEPAFAD-LSEE 137


>gi|227889750|ref|ZP_04007555.1| cell division protein MraZ [Lactobacillus johnsonii ATCC 33200]
 gi|227849614|gb|EEJ59700.1| cell division protein MraZ [Lactobacillus johnsonii ATCC 33200]
          Length = 143

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSKGR+ +P  FR  +  + I             I     +  +  E K+
Sbjct: 1   MFMGEYHHNLDSKGRLIIPAKFRVEIGNKMIFTRGM-----EGCIFGYPIEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+       A + + L + G +  + D +GR+ +T  ++    +  E   VG  N  ++W
Sbjct: 56  AKLPLTKRSARKFTRLFYSGAMESEFDKQGRVNLTMTLKEHAALIKECVIVGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           + + +    EE+   Y
Sbjct: 116 SAERWNDFSEEANENY 131


>gi|119717296|ref|YP_924261.1| MraZ protein [Nocardioides sp. JS614]
 gi|206558104|sp|A1SL89|MRAZ_NOCSJ RecName: Full=Protein MraZ
 gi|119537957|gb|ABL82574.1| MraZ protein [Nocardioides sp. JS614]
          Length = 144

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 6/140 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FL   T K+D KGR+ +P  FR  LA+     L   Q      + V  +D+     +
Sbjct: 1   MN-FLGTYTPKLDEKGRLFLPAKFRDRLAE----GLVVTQG-QENCLVVWPTDVFMEEAR 54

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +          A   + ++  G     +D +GRI +   +R +  ++ EV  +G  +  +
Sbjct: 55  RAQATPMTVRGARDYARVLFAGADEGALDKQGRINIAAPLREYAALDREVVVIGVMDRIE 114

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+P  +R+    ++ ++  
Sbjct: 115 IWDPVRWREYSAGAQAKFAE 134


>gi|256390850|ref|YP_003112414.1| MraZ protein [Catenulispora acidiphila DSM 44928]
 gi|256357076|gb|ACU70573.1| MraZ protein [Catenulispora acidiphila DSM 44928]
          Length = 148

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 54/149 (36%), Gaps = 12/149 (8%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T  +D KGR+ +P  FR  LA   +             ++V  ++       ++
Sbjct: 1   MFLGTYTPSLDDKGRLILPARFREELAAGLVVTK-----GQERCLAVWTAEGFAELTAQM 55

Query: 63  AEYNP-------FSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGR 115
              +            +     +        + D++GRI++   +R + G+  E   +G 
Sbjct: 56  RNASRAGSADAAIGRSSRDYHRVFFASAYDCQPDTQGRIVIPPPLRAYAGLSRECVVIGA 115

Query: 116 GNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
               ++W+ + +    + + + Y     +
Sbjct: 116 DTRLEIWDAEAWADYLDAAESAYSASGSE 144


>gi|323706129|ref|ZP_08117698.1| MraZ protein [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534573|gb|EGB24355.1| MraZ protein [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 141

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 51/141 (36%), Gaps = 8/141 (5%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID KGRV +P  FR  L  + +             +   +       E K+  
Sbjct: 1   MGQYEHTIDQKGRVFIPAKFRDELGYKFVLTRGL-----DNCLFAYSLSEWSNIEAKLKT 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A   +     G    ++D +GR+L+ + +R    IE EV  +G  +  ++W+ 
Sbjct: 56  LPLNRKDARAFTRFFLAGATECEIDKQGRVLIPNILREHAKIEKEVIIIGVSSRVEIWSK 115

Query: 125 QTFRKLQEE---SRNEYCRQL 142
           + + +       S  +    L
Sbjct: 116 EVWMEYSNNIDVSFEDVAEHL 136


>gi|300780823|ref|ZP_07090677.1| cell division protein MraZ [Corynebacterium genitalium ATCC 33030]
 gi|300532530|gb|EFK53591.1| cell division protein MraZ [Corynebacterium genitalium ATCC 33030]
          Length = 144

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREGLADGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +        +D  GRI ++   R +  +  E   +G  ++ ++W
Sbjct: 56  AAVSRTNPKARAFIRNLAASADEQALDGSGRITLSPAHRDYANLSKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +++ K QE +   +  
Sbjct: 116 DAESWEKYQENTEAAFSA 133


>gi|111221621|ref|YP_712415.1| cell division protein MraZ [Frankia alni ACN14a]
 gi|111149153|emb|CAJ60836.1| hypothetical protein; putative coiled-coil domain [Frankia alni
           ACN14a]
          Length = 149

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 52/142 (36%), Gaps = 6/142 (4%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL + T ++D KGR+++P  FR  L       L   +      + V          + + 
Sbjct: 8   FLGSHTPRLDDKGRLTLPAKFRDELE----GGLVITKG-QERCLYVFPMAEFTRISESLR 62

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +      S +          D +GRI +   +R + G+  +    G     ++W+
Sbjct: 63  TAPVTAKALRDYSRVFFSSAADDAPDRQGRITIPAPLRTYAGLTRDCVVNGANTRVEIWD 122

Query: 124 PQTFRKLQEESRNEYCRQLLQK 145
            Q ++   E     +  +L ++
Sbjct: 123 AQRWQAYLESQEESFA-ELSEE 143


>gi|126665255|ref|ZP_01736238.1| MraZ protein [Marinobacter sp. ELB17]
 gi|126630625|gb|EBA01240.1| MraZ protein [Marinobacter sp. ELB17]
          Length = 149

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 63/144 (43%), Gaps = 2/144 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS F  +    +D+KGR+++P   R  L Q C              + +    + +    
Sbjct: 1   MSNFFGSHAINMDAKGRLAIPAKVREELIQVCGGRFILTVADADRCLRLYPQSVWDELRP 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I      S  A +L  LV G    +++DS GR+L+   +R +  +E ++  +G+G   +
Sbjct: 61  AIEALPNMSRAALRLQRLVLGNAAQMELDSAGRVLIPPTLRQYARLEKKLMLIGQGKKLE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           LW+ +++  L +   +    ++  
Sbjct: 121 LWSEESWNHLLDTPPD--AEEMTD 142


>gi|169348414|ref|ZP_02866352.1| hypothetical protein CLOSPI_00129 [Clostridium spiroforme DSM 1552]
 gi|169293883|gb|EDS76016.1| hypothetical protein CLOSPI_00129 [Clostridium spiroforme DSM 1552]
          Length = 154

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F+      ID+KGR+ +P   R      C + +   + F    +++   +  + + QK
Sbjct: 11  KMFMGEFKHNIDAKGRLIIPSKLREQ----CGSSVIVTRGF-DGCLALYTQEGWDDYYQK 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +         A     ++       + D  GRI +   +RV   +E E   VG G++ ++
Sbjct: 66  LQMLPKTKKDARNFVRIITSRASECEFDKLGRINIPSVLRVEGKLEKECIIVGVGDHVEI 125

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           WN   ++   + +++ +  ++ +
Sbjct: 126 WNESLWQDYYDMNKDNF-DEISE 147


>gi|149377271|ref|ZP_01895018.1| MraZ protein [Marinobacter algicola DG893]
 gi|149358459|gb|EDM46934.1| MraZ protein [Marinobacter algicola DG893]
          Length = 150

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 1/138 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFF-PAISVGNSDLLEYFE 59
           MS FL +    +D+KGR+++P   R  LA  C   +    +      + +      E   
Sbjct: 1   MSNFLGSHAINMDAKGRLAIPARVREELAHACSGRIVLTANADEERCLLMYPEPQWEALR 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            +I      +  A +L  L+ G    L++DS GRIL+   +R +  +E ++  +G+G   
Sbjct: 61  PQIEALPNMNKAARRLQRLLLGHATPLELDSAGRILVPPTLRSYARLEKKLMLIGQGKKL 120

Query: 120 QLWNPQTFRKLQEESRNE 137
           +LW+ + +    +ES +E
Sbjct: 121 ELWSEERWFAWLDESSDE 138


>gi|120555372|ref|YP_959723.1| MraZ protein [Marinobacter aquaeolei VT8]
 gi|206558106|sp|A1U3G7|MRAZ_MARAV RecName: Full=Protein MraZ
 gi|120325221|gb|ABM19536.1| MraZ protein [Marinobacter aquaeolei VT8]
 gi|302608130|emb|CBW44414.1| Protein involved in cell division [Marinobacter
           hydrocarbonoclasticus]
          Length = 150

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFF-PAISVGNSDLLEYFE 59
           MS FL +    +D+KGR+++P   R  LAQ C   +    +      + +      E   
Sbjct: 1   MSNFLGSHAINMDAKGRLAIPTKVREELAQLCGGRIVLTANADEEKCLLLYPEPEWEVLR 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            KI      +  A +L  L+ G    +++D+ GRIL+   +R    +E  +  VG G  +
Sbjct: 61  PKIEALPNMNKAAKRLQRLILGNAALMELDASGRILVPQTLRNHANLEKRLMLVGLGKKY 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQK 145
           +LW+ +++    + S  +   ++  +
Sbjct: 121 ELWSEESWNAYLDASAAD--EEMPPE 144


>gi|227488520|ref|ZP_03918836.1| cell division protein MraZ [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227543125|ref|ZP_03973174.1| cell division protein MraZ [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227091414|gb|EEI26726.1| cell division protein MraZ [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227181113|gb|EEI62085.1| cell division protein MraZ [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 143

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     ++++   +  E   +K 
Sbjct: 1   MFLGTYTPKMDDKGRLTLPAKFRDDLA----GGLVVTKG-QDHSLAIYPKEEFEQRARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +    +A      +       + D +GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  ARVSRTKPEARAFIRNLAASADEQRPDGQGRITLSPAHRKYAGLTKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q++   Q E+  ++     +
Sbjct: 116 DAQSWVDYQAETEADFSAAEDE 137


>gi|300774438|ref|ZP_07084301.1| cell division protein MraZ [Chryseobacterium gleum ATCC 35910]
 gi|300506253|gb|EFK37388.1| cell division protein MraZ [Chryseobacterium gleum ATCC 35910]
          Length = 165

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 59/144 (40%), Gaps = 1/144 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     KID KGR+ VP      +           +  F P + V   +  +    
Sbjct: 14  MKNFIGTYECKIDDKGRLKVPSSLIKQMENFDDKAFVVKRSVFQPCLEVYPMNAWDKLMG 73

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI + N F  +      +   G   +++D+ GR+ ++  + VF  ++ ++     G  F+
Sbjct: 74  KINKLNRFIKKNADFIRMFTAGVKTVELDNAGRLQISKDLTVFANLQKDIVITSAGELFE 133

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+   + K+   +  ++   L +
Sbjct: 134 IWDKDAYEKVIATNEADFAS-LAE 156


>gi|146295950|ref|YP_001179721.1| MraZ protein [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|167011868|sp|A4XHZ5|MRAZ_CALS8 RecName: Full=Protein MraZ
 gi|145409526|gb|ABP66530.1| MraZ protein [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 143

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D+KGRV++P  FR  L ++ I             +   +       E+K+
Sbjct: 1   MLIGEYKHVVDNKGRVTLPSKFREELGEKFILTKGL-----DNCLFGYSLKEWAVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S  A         G    ++D +GRIL+   +R +  ++ EV  +G     ++W
Sbjct: 56  KKLPLTSKDARAFLRFFFAGACECEVDKQGRILIPQNLREYANLQKEVFIIGVMTRIEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           + + +++   +   S  +  +++ +
Sbjct: 116 SEENWQREMADESLSVEKIAQKMEE 140


>gi|162148952|ref|YP_001603413.1| cell division protein MraZ [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545295|ref|YP_002277524.1| cell division protein MraZ [Gluconacetobacter diazotrophicus PAl 5]
 gi|189028621|sp|A9H0G8|MRAZ_GLUDA RecName: Full=Protein MraZ
 gi|161787529|emb|CAP57125.1| putative cell division protein MraZ [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532972|gb|ACI52909.1| protein of unknown function UPF0040 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 158

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 3/127 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQR---CITDLYCFQDFFFPAISVGNSDLLEY 57
           MS FL     ++D+KGRVS+P  FRT L  +       +       +P I    +     
Sbjct: 1   MSVFLGTHQNRLDAKGRVSIPAGFRTALRAQAAAGEALVILRPSHQYPCIEAWPTAAFAA 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
             Q +   + FS + + ++  ++     +  D EGRI++ D ++    + + V F+G G 
Sbjct: 61  LSQPLDRLDMFSDEHDDMAAALYADAYPVDADREGRIILPDTLKEHAALTDSVAFMGLGR 120

Query: 118 YFQLWNP 124
            FQ+W P
Sbjct: 121 TFQIWEP 127


>gi|110680543|ref|YP_683550.1| cell division protein MraZ [Roseobacter denitrificans OCh 114]
 gi|109456659|gb|ABG32864.1| MraZ protein, putative [Roseobacter denitrificans OCh 114]
          Length = 177

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 1   MSR-FLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGN 51
           MSR F      K+D+KGRVS+P  FR ++               +  + D     +    
Sbjct: 1   MSRRFRGESHHKVDAKGRVSIPASFRRVIEACDPNWTPGAAPELVIVYGDHRRSYLECYT 60

Query: 52  SDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVT 111
            + ++  + KIAE    S +   +  L  G  + + +D  GR+++   +R   G+ENE  
Sbjct: 61  IEAMDEVDAKIAEMPRGSPERKIMERLFQGQSVTISVDDTGRLVLPAKLRQKIGLENEAF 120

Query: 112 FVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
           F   G+ FQ+W P+T+   +          L  
Sbjct: 121 FSAAGDTFQIWKPETYETEETAKTEAILDALPD 153


>gi|325067113|ref|ZP_08125786.1| cell division protein MraZ [Actinomyces oris K20]
          Length = 143

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA      +   +      +    +   E    ++
Sbjct: 1   MFLGTHAPKLDEKGRLILPAKFREELA----GGVVLTRG-QEHCLYAFTAAEFERMYAQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      QA     ++  G      D +GRI +   +R + G++ ++  +G G   ++W
Sbjct: 56  REAPLAQKQARDYVRVMLSGADSQIPDKQGRITLPAPLRAYAGLKKDLAVIGAGARVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +++          +     +
Sbjct: 116 DSESWNTYLAAQEQVFADTAEE 137


>gi|328957119|ref|YP_004374505.1| cell division protein MraZ [Carnobacterium sp. 17-4]
 gi|328673443|gb|AEB29489.1| cell division protein MraZ [Carnobacterium sp. 17-4]
          Length = 143

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 53/136 (38%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      ID+KGR+ +P  FR+ L ++ I             +     +     E+K+
Sbjct: 1   MLLGEHKHNIDAKGRLIMPSKFRSDLGEKFILTRGL-----DGCLFGYPQESWSALEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A   +   +   +  ++D +GRI +   +R    +E     VG     ++W
Sbjct: 56  KQLPLAKKEARAFTRFFYSAAVECEIDKQGRINIPQTLREHAKLEKVCHVVGVSERIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
               + ++ +E+   +
Sbjct: 116 GETRWNQVSQEAEEMF 131


>gi|242242460|ref|ZP_04796905.1| cell division protein MraZ [Staphylococcus epidermidis W23144]
 gi|251810608|ref|ZP_04825081.1| cell division protein MraZ [Staphylococcus epidermidis BCM-HMP0060]
 gi|293366857|ref|ZP_06613533.1| cell division protein MraZ [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|242234034|gb|EES36346.1| cell division protein MraZ [Staphylococcus epidermidis W23144]
 gi|251805768|gb|EES58425.1| cell division protein MraZ [Staphylococcus epidermidis BCM-HMP0060]
 gi|291319158|gb|EFE59528.1| cell division protein MraZ [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 141

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 60/140 (42%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +     ++D+KGR+ +P  FR  L +R I             +     +  +  E+K+  
Sbjct: 1   MGEFDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLEEWQQIEEKMKT 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W+ 
Sbjct: 56  LPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLSKECTVIGVSNRIEIWDR 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
           +T+    +ES   +   + +
Sbjct: 116 ETWNDFYDESEESF-EDIAE 134


>gi|302344203|ref|YP_003808732.1| MraZ protein [Desulfarculus baarsii DSM 2075]
 gi|301640816|gb|ADK86138.1| MraZ protein [Desulfarculus baarsii DSM 2075]
          Length = 147

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 50/122 (40%), Gaps = 1/122 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFF-FPAISVGNSDLLEYFEQK 61
            F  + T  ID+KGR+++P  FR  L+      L           +     +       K
Sbjct: 1   MFTGSSTHSIDAKGRLAIPAGFRDALSVSGDDKLILTTLPNADHYLVCYPVEDWRNLADK 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I+     +     +     G      +D +GRIL+   +R   G+E++   VG  +YF++
Sbjct: 61  ISRLPELNPSVQAIKRRFFGNANECPLDKQGRILIPPRLRQKAGLESKAVLVGAQSYFEV 120

Query: 122 WN 123
           W+
Sbjct: 121 WD 122


>gi|291459282|ref|ZP_06598672.1| MraZ protein [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418536|gb|EFE92255.1| MraZ protein [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 154

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 63/142 (44%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR+ VP  FR  L +         +      +S+      +  E+K+
Sbjct: 14  MFTGEYHHNLDGKGRMIVPVRFRENLNRE----FVLTRSL-DGCLSMYAPAEWKLLEEKL 68

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     + +A +L   + G  +  ++D +GRIL+   +R   G+  +V  +G G++ +LW
Sbjct: 69  AALPMTNEKARRLKRFLLGSAVSCELDGQGRILIPQVLREKAGLRKDVCLIGVGDHAELW 128

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    + S +    + ++
Sbjct: 129 DNERWISENDFSDSAELAEDME 150


>gi|259416729|ref|ZP_05740649.1| protein MraZ [Silicibacter sp. TrichCH4B]
 gi|259348168|gb|EEW59945.1| protein MraZ [Silicibacter sp. TrichCH4B]
          Length = 285

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
            RF      K+DSKGRVS+P  FR +L               +  + D     +     +
Sbjct: 121 RRFRGESHHKVDSKGRVSIPASFRRVLEASDPNWQPGDAPELVIVYGDQRRQYLECYTME 180

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            +E  + KIA     S     L  + +G  +   +D  GR+++   +R    ++ E  F+
Sbjct: 181 AIEEVDAKIAALPRGSKGRKILERMFNGQSLPTTVDETGRLVLPAKLRQKIDLDGEAFFI 240

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+W P+T+ +++     +    L +
Sbjct: 241 ASGDTFQIWKPETYEEVEMAEAEKMMEDLPE 271



 Score = 35.3 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/75 (14%), Positives = 20/75 (26%), Gaps = 1/75 (1%)

Query: 2   SRFLSNVTQK-IDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
             F        +D  GR+ +P   R  +            D F         ++     +
Sbjct: 204 RMFNGQSLPTTVDETGRLVLPAKLRQKIDLDGEAFFIASGDTFQIWKPETYEEVEMAEAE 263

Query: 61  KIAEYNPFSIQANQL 75
           K+ E  P      + 
Sbjct: 264 KMMEDLPEDFDPLEF 278


>gi|86740112|ref|YP_480512.1| cell division protein MraZ [Frankia sp. CcI3]
 gi|123765090|sp|Q2JD59|MRAZ_FRASC RecName: Full=Protein MraZ
 gi|86566974|gb|ABD10783.1| protein of unknown function UPF0040 [Frankia sp. CcI3]
          Length = 143

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL +   ++D KGR+++P  FR  L       L   +      + V          + +
Sbjct: 1   MFLGSHAPRLDDKGRLTLPAKFRDELE----GGLVITKG-QERCLYVFPMAEFTRISESL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GRI +   +R + G+  +    G     ++W
Sbjct: 56  RTVPVTAKALRDYSRVFFSSAADDVPDRQGRITVPAPLRSYAGLMRDCVVNGANTRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q ++   E     +  +L ++
Sbjct: 116 DAQRWQAYLESQEESFA-ELSEE 137


>gi|19553367|ref|NP_601369.1| cell division protein MraZ [Corynebacterium glutamicum ATCC 13032]
 gi|62391006|ref|YP_226408.1| cell division protein MraZ [Corynebacterium glutamicum ATCC 13032]
 gi|145296129|ref|YP_001138950.1| cell division protein MraZ [Corynebacterium glutamicum R]
 gi|23821859|sp|Q8NNM6|MRAZ_CORGL RecName: Full=Protein MraZ
 gi|167011873|sp|A4QFN2|MRAZ_CORGB RecName: Full=Protein MraZ
 gi|21324937|dbj|BAB99560.1| Uncharacterized BCR [Corynebacterium glutamicum ATCC 13032]
 gi|41326345|emb|CAF20507.1| MRAZ [Corynebacterium glutamicum ATCC 13032]
 gi|140846049|dbj|BAF55048.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 143

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREDLAGGLMVTK-----GQDHSLAVYPKEEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D +GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AAVSRTNPEARAFIRNLAASADEQRPDGQGRITLSAAHRTYAGLTKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q +   QEE+   +  
Sbjct: 116 DAQAWAAYQEETEAAFSA 133


>gi|331005048|ref|ZP_08328452.1| Cell division protein MraZ [gamma proteobacterium IMCC1989]
 gi|330421103|gb|EGG95365.1| Cell division protein MraZ [gamma proteobacterium IMCC1989]
          Length = 147

 Score =  127 bits (318), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 65/135 (48%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL + +  +D+KGR+++P   R +L + C   +          + V   +  +    KI
Sbjct: 1   MFLGSHSINMDAKGRIAIPTRVRELLQEVCGGRIVVTAHTENRCLHVFPEEQWQEILPKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+  + +  LL+ G    L++D+ GR+L+   +R + G+E ++  VG+G   +LW
Sbjct: 61  ESLPSFNKVSRRAKLLLIGHASPLELDANGRVLLPPTLREYAGMEKKLMLVGQGKSLELW 120

Query: 123 NPQTFRKLQEESRNE 137
             + F +  +   ++
Sbjct: 121 CEEEFTRYIDSPIDD 135


>gi|291522689|emb|CBK80982.1| mraZ protein [Coprococcus catus GD/7]
          Length = 147

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 54/146 (36%), Gaps = 8/146 (5%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+      ID+KGRV +P  +R  L    I             + +   D    F  
Sbjct: 1   MDGFIGEYYHTIDTKGRVIIPQKYREDLGDTFILSKGL-----DGCLWIHPMDEWREFTA 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ E +    ++ Q       G    + D +GRIL+   +R +  ++ +V   G     +
Sbjct: 56  KLRELSTIDKESRQFKRFFMSGATECEFDKQGRILVPASLRKYADLQKDVVLTGMDTRIE 115

Query: 121 LWNPQTF---RKLQEESRNEYCRQLL 143
           LW+ + +     + +E        + 
Sbjct: 116 LWSAEKWDVENDMDDEDMEAVAAHMA 141


>gi|224541551|ref|ZP_03682090.1| hypothetical protein CATMIT_00721 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525518|gb|EEF94623.1| hypothetical protein CATMIT_00721 [Catenibacterium mitsuokai DSM
           15897]
          Length = 143

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  FR         D           + +   +  + + +++
Sbjct: 1   MFYGEYKHNLDTKGRLSIPAKFR-----GECGDHVYIMRGHEGCLDIYTEEGWQAYYEEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +    +      +V       + D  GRI +   +R    +E E T VG G + ++W
Sbjct: 56  KKLSNKKKEERAYLRMVTSRMNCSEFDKLGRINIPQVLRTHAHLEKECTIVGAGEHIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +    +E  +++  +L ++
Sbjct: 116 DTAKWEAFYDEYDDQF-DELSER 137


>gi|296166033|ref|ZP_06848482.1| cell division protein MraZ [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295898598|gb|EFG78155.1| cell division protein MraZ [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 143

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRGEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +  A      +  G      D++GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  SKASRSNPDARAFLRNLAAGTDEQHPDAQGRITLSADHRRYANLSKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++  Q+     +  
Sbjct: 116 DAQAWQDYQQTHEENFSA 133


>gi|148259075|ref|YP_001233202.1| cell division protein MraZ [Acidiphilium cryptum JF-5]
 gi|146400756|gb|ABQ29283.1| protein of unknown function UPF0040 [Acidiphilium cryptum JF-5]
          Length = 173

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCIT-DLYCFQDFFFPAISVGNSDLLEYFE 59
           MS+FL     ++D+KGRVSVP  FR  L +   +  L          I V  + + E   
Sbjct: 22  MSQFLGTHRNRLDAKGRVSVPAAFRAALRREGDSQGLILRPSHKHRCIEVWPAPVFEALA 81

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            ++   + FS   + ++  ++     L+ D EGRIL+ + +    G+ + V F+G G  F
Sbjct: 82  TRLQGLDLFSDTHDDMAAALYADAWPLEADKEGRILLPEPLVEHAGLRDSVVFMGLGRTF 141

Query: 120 QLWNP 124
           Q+W P
Sbjct: 142 QIWEP 146


>gi|255030438|ref|ZP_05302389.1| cell division protein MraZ [Listeria monocytogenes LO28]
          Length = 125

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 47/128 (36%), Gaps = 5/128 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NPQTFRKL 130
           +   +  +
Sbjct: 116 SKSEWDDV 123


>gi|227874386|ref|ZP_03992570.1| cell division protein MraZ [Oribacterium sinus F0268]
 gi|227839794|gb|EEJ50240.1| cell division protein MraZ [Oribacterium sinus F0268]
          Length = 141

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 66/142 (46%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+ +P  FR        ++ +  +      +S+      +  E+K+
Sbjct: 1   MFTGEYHLNLDTKGRMMIPAKFRE----DGYSEFFLTRSL-DGCLSLYAIPEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S +A +L   + G  + ++ D +GRIL+   +R    +E +V  +G G+Y ++W
Sbjct: 56  QALPMTSEKARKLKRYILGSAVSVECDKQGRILIPQVLRDKAELEKDVMLLGVGDYAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +++ +  + S  E   + ++
Sbjct: 116 SSESYEEKNDFSDTEELAKDME 137


>gi|224282632|ref|ZP_03645954.1| protein mraZ [Bifidobacterium bifidum NCIMB 41171]
 gi|310287092|ref|YP_003938350.1| Cell division protein mraZ [Bifidobacterium bifidum S17]
 gi|311063957|ref|YP_003970682.1| cell division protein [Bifidobacterium bifidum PRL2010]
 gi|313139791|ref|ZP_07801984.1| protein mraZ [Bifidobacterium bifidum NCIMB 41171]
 gi|309251028|gb|ADO52776.1| Cell division protein mraZ [Bifidobacterium bifidum S17]
 gi|310866276|gb|ADP35645.1| MraW Cell division protein [Bifidobacterium bifidum PRL2010]
 gi|313132301|gb|EFR49918.1| protein mraZ [Bifidobacterium bifidum NCIMB 41171]
          Length = 168

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P   R+ L       L   +      + +           +I
Sbjct: 25  LLLGTYTPKIDAKGRMALPAKLRSQLGA----GLVMARG-QERCVYLLPQSEFRRIAIQI 79

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +     A     +   G +    D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 80  QHTSMGDKAARDYLRVFLSGAVDQDPDKQGRVLVPQMLRDYANLGDDIVVIGVGTRAEIW 139

Query: 123 NPQTFRKLQEESRNEYCR 140
           N + + +   E    Y  
Sbjct: 140 NREAWERYLNEKEQGYAD 157


>gi|325102880|ref|YP_004272534.1| MraZ protein [Pedobacter saltans DSM 12145]
 gi|324971728|gb|ADY50712.1| MraZ protein [Pedobacter saltans DSM 12145]
          Length = 153

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS  +     K+D+KGR+ VP   +  L       L   + F    + V +    +    
Sbjct: 1   MSHLIGEFDCKLDAKGRLMVPAGLKKQLPAIDADGLVVNRGF-EKHLVVYSKAEWDKVTA 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++A+ NP+  +  +       G   L +DS GR+L+   +  + GI +EV    + N  +
Sbjct: 60  ELAQLNPYEEKNRKFVRYFTRGATELSLDSSGRVLLPKSLLEYAGIGSEVVLSCQFNKIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LW+ + + +  ++    +   L ++
Sbjct: 120 LWSKEAYEEQMDDEPENFAS-LAEE 143


>gi|119961648|ref|YP_947461.1| cell division protein MraZ [Arthrobacter aurescens TC1]
 gi|167011857|sp|A1R5E9|MRAZ_ARTAT RecName: Full=Protein MraZ
 gi|119948507|gb|ABM07418.1| putative mraZ protein [Arthrobacter aurescens TC1]
          Length = 143

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  FR  LA      L   +      I V +    E   + +
Sbjct: 1   MFLGTHSPRLDEKGRIILPAKFREELAD----GLVLTRG-QERCIYVFSQKEFERIHESM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    S QA     +   G      D +GR+ +   +R + G+  E+  +G G   ++W
Sbjct: 56  REAPLSSKQARDYIRVFLSGASDEVPDKQGRVTIPPALRAYAGLGRELAVIGAGTRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   + +   E    +  
Sbjct: 116 DADAWNEYLNEKEAAFSE 133


>gi|312132475|ref|YP_003999814.1| mraz [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773402|gb|ADQ02890.1| MraZ [Bifidobacterium longum subsp. longum BBMN68]
          Length = 173

 Score =  127 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 30  LLLGTYTPKIDAKGRIALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 84

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+L+   +R +  + ++V  +G G   +LW
Sbjct: 85  QRVSVGNKAAREYLRVFLSGAVDQQPDKQGRVLVPQMLRDYANLGSDVVVIGVGTRAELW 144

Query: 123 NPQTFRKLQEESRNEYCR 140
           N  T+     E    Y  
Sbjct: 145 NKDTWESYLAEKEEGYSD 162


>gi|302871360|ref|YP_003839996.1| MraZ protein [Caldicellulosiruptor obsidiansis OB47]
 gi|312134652|ref|YP_004001990.1| mraz protein [Caldicellulosiruptor owensensis OL]
 gi|302574219|gb|ADL42010.1| MraZ protein [Caldicellulosiruptor obsidiansis OB47]
 gi|311774703|gb|ADQ04190.1| MraZ protein [Caldicellulosiruptor owensensis OL]
          Length = 143

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 57/145 (39%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +DSKGR+ +P  FR  L +R I             +   +       E+K+
Sbjct: 1   MLIGEYKHVVDSKGRIILPSKFREELGERFILTKGL-----DNCLFGYSLKEWAVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A         G    ++D +GRIL+   +R + GI+ EV  +G     ++W
Sbjct: 56  KKLPLTSKEARTFLRFFFAGACECEVDKQGRILIPQNLREYAGIKKEVFIIGVMTRIEIW 115

Query: 123 NPQTFRKLQEESR---NEYCRQLLQ 144
           +   + K         +   +++ +
Sbjct: 116 SEDNWLKEMTNEDLSVDRIAQKMEE 140


>gi|317483062|ref|ZP_07942063.1| MraZ protein [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915468|gb|EFV36889.1| MraZ protein [Bifidobacterium sp. 12_1_47BFAA]
          Length = 173

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 30  LLLGTYTPKIDAKGRMALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 84

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+L+   +R +  + ++V  +G G   +LW
Sbjct: 85  QRVSVGNKAAREYLRVFLSGAVDQQPDKQGRVLVPQMLRDYANLGSDVVVIGVGTRAELW 144

Query: 123 NPQTFRKLQEESRNEYCR 140
           N  T+     E    Y  
Sbjct: 145 NKDTWESYLAEKEEGYSD 162


>gi|161507310|ref|YP_001577264.1| cell division protein MraZ [Lactobacillus helveticus DPC 4571]
 gi|260102638|ref|ZP_05752875.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|172048223|sp|A8YUN5|MRAZ_LACH4 RecName: Full=Protein MraZ
 gi|160348299|gb|ABX26973.1| Cell division protein MraZ [Lactobacillus helveticus DPC 4571]
 gi|260083562|gb|EEW67682.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|328468643|gb|EGF39637.1| cell division protein MraZ [Lactobacillus helveticus MTCC 5463]
          Length = 143

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 55/136 (40%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P   R  +  + +             I   + +  +  E K+
Sbjct: 1   MFMGEYHHNLDNKGRLIIPAKLRDQIENKMVFTRGM-----EGCIFGYSMEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         +   L + G +  + D +GR+  T  ++   G+  E   +G  +  ++W
Sbjct: 56  AKLPLTKRNTRKFMRLFYSGAMESEFDKQGRVNFTSTLKAHAGLIKECVIIGVSDRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
             + +   +EE+  +Y
Sbjct: 116 AKERWDSFEEEANEDY 131


>gi|227503271|ref|ZP_03933320.1| cell division protein MraZ [Corynebacterium accolens ATCC 49725]
 gi|306836500|ref|ZP_07469471.1| cell division protein MraZ [Corynebacterium accolens ATCC 49726]
 gi|227075774|gb|EEI13737.1| cell division protein MraZ [Corynebacterium accolens ATCC 49725]
 gi|304567590|gb|EFM43184.1| cell division protein MraZ [Corynebacterium accolens ATCC 49726]
          Length = 151

 Score =  126 bits (317), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 56/133 (42%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 8   MFLGTYTPKLDDKGRLTLPAKFRDELAGGLMVTK-----GQDHSLAVYPREEFAERARKA 62

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D  GRI ++   R + G+  E   VG  ++ ++W
Sbjct: 63  AAVSRTNPEARAFIRNLAASADEQRPDGHGRITLSAGHREYAGLSKECVVVGSVDFLEIW 122

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 123 DAAAWAEYQSQTE 135


>gi|108800231|ref|YP_640428.1| cell division protein MraZ [Mycobacterium sp. MCS]
 gi|119869359|ref|YP_939311.1| cell division protein MraZ [Mycobacterium sp. KMS]
 gi|126435854|ref|YP_001071545.1| cell division protein MraZ [Mycobacterium sp. JLS]
 gi|123069992|sp|Q1B6W2|MRAZ_MYCSS RecName: Full=Protein MraZ
 gi|167012256|sp|A3Q1M7|MRAZ_MYCSJ RecName: Full=Protein MraZ
 gi|167012257|sp|A1UI63|MRAZ_MYCSK RecName: Full=Protein MraZ
 gi|108770650|gb|ABG09372.1| protein of unknown function UPF0040 [Mycobacterium sp. MCS]
 gi|119695448|gb|ABL92521.1| MraZ protein [Mycobacterium sp. KMS]
 gi|126235654|gb|ABN99054.1| MraZ protein [Mycobacterium sp. JLS]
          Length = 143

 Score =  126 bits (317), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRAEFEKLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  + +A      +         D++GRI ++   R +  +  E   +G  +Y ++W
Sbjct: 56  SQASRSNPEARAFLRNLAAATDEQHPDAQGRITLSADHRRYASLSKECVVIGSVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +++ Q+     +     +
Sbjct: 116 DAAAWQEYQQAHEENFSAATDE 137


>gi|260655422|ref|ZP_05860910.1| MraZ protein [Jonquetella anthropi E3_33 E1]
 gi|260629870|gb|EEX48064.1| MraZ protein [Jonquetella anthropi E3_33 E1]
          Length = 143

 Score =  126 bits (317), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 64/142 (45%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +     ++DSKGR+ +P  FR+ L                  ++V ++D  E +  K+
Sbjct: 1   MLMGTCEHRLDSKGRLVLPAKFRSELGS-----TVVCTVGLDRCVAVYSTDGWEKYLAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +V G    L +D  GRIL+  F++ + G+  +VT VG  ++ +LW
Sbjct: 56  QTLPFAKESARRFMRVVLGSADELPVDGAGRILVGAFLKDYAGLGEQVTIVGVSDHVELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N + +   +++   ++   L +
Sbjct: 116 NSERWNAGRDDILKDF-ESLAE 136


>gi|212715549|ref|ZP_03323677.1| hypothetical protein BIFCAT_00447 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660916|gb|EEB21491.1| hypothetical protein BIFCAT_00447 [Bifidobacterium catenulatum DSM
           16992]
          Length = 171

 Score =  126 bits (317), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 28  LLLGTYTPKIDAKGRMALPAKFRSQLGS----GMVMARG-QERCVYLLPQSEFRRIALQI 82

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +  + D +GR+L+   +R +  +E+++  +G G   ++W
Sbjct: 83  QRTSMGNKAARDYLRVFLSGAVDQEPDKQGRVLVPQMLRDYANLESDIVVIGVGTRAEIW 142

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q +     E    Y  
Sbjct: 143 NKQAWEDYLAEKEQGYSD 160


>gi|220912330|ref|YP_002487639.1| cell division protein MraZ [Arthrobacter chlorophenolicus A6]
 gi|325962940|ref|YP_004240846.1| mraZ protein [Arthrobacter phenanthrenivorans Sphe3]
 gi|254813270|sp|B8HGW1|MRAZ_ARTCA RecName: Full=Protein MraZ
 gi|219859208|gb|ACL39550.1| MraZ protein [Arthrobacter chlorophenolicus A6]
 gi|323469027|gb|ADX72712.1| mraZ protein [Arthrobacter phenanthrenivorans Sphe3]
          Length = 142

 Score =  126 bits (317), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  FR  LA      L   +      I V +        +++
Sbjct: 1   MFLGTHSPRLDEKGRIILPAKFREELAS----GLVLTRG-QERCIYVFSEKEFARVHEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    S QA     +   G      D +GR+ +   +R + G+  E+  +G G+  ++W
Sbjct: 56  REAPISSKQARDYIRVFLSGASDEVPDKQGRVTIPPALREYAGLGRELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q + +   E    +  
Sbjct: 116 DAQAWNEYLAEKETAFSE 133


>gi|312128124|ref|YP_003992998.1| mraz protein [Caldicellulosiruptor hydrothermalis 108]
 gi|312794112|ref|YP_004027035.1| mraz protein [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876342|ref|ZP_07736327.1| MraZ protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311778143|gb|ADQ07629.1| MraZ protein [Caldicellulosiruptor hydrothermalis 108]
 gi|311796836|gb|EFR13180.1| MraZ protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181252|gb|ADQ41422.1| MraZ protein [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 143

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 58/145 (40%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +DSKGR+ +P  FR  L +R I             +   +       E+K+
Sbjct: 1   MLIGEYKHVVDSKGRIILPSKFREELGERFILTKGL-----DNCLFGYSLKEWAVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A         G    ++D +GR+L+   +R + GI+ EV  +G     ++W
Sbjct: 56  KKLPLTSKEARTFLRFFFAGACECEVDKQGRVLIPQNLREYAGIQKEVFIIGVMTRIEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   + K       S +   +++ +
Sbjct: 116 SEDNWLKEMTNENLSVDRIAQKMEE 140


>gi|301063224|ref|ZP_07203773.1| protein MraZ [delta proteobacterium NaphS2]
 gi|300442652|gb|EFK06868.1| protein MraZ [delta proteobacterium NaphS2]
          Length = 145

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 51/138 (36%), Gaps = 3/138 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  FR  L Q     L          +     D     E+K 
Sbjct: 1   MFRGRSKHNLDAKGRLAIPTRFREFLNQEGDDCLVVT--HKDGCLWAFTRDAWRRLEEKA 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A    F             G     +   GRI +  ++R  TG+E EV  VG+   F++W
Sbjct: 59  ANLPLFDNAGIAFLRYFISGAEECPL-KNGRITIPLYLRQVTGLEKEVMVVGQLKRFEIW 117

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +  E     +  
Sbjct: 118 DKKKWEEEFERVTEVFPE 135


>gi|23335462|ref|ZP_00120698.1| COG2001: Uncharacterized protein conserved in bacteria
           [Bifidobacterium longum DJO10A]
 gi|23465876|ref|NP_696479.1| hypothetical protein BL1315 [Bifidobacterium longum NCC2705]
 gi|189439035|ref|YP_001954116.1| hypothetical protein BLD_0172 [Bifidobacterium longum DJO10A]
 gi|227547547|ref|ZP_03977596.1| MraZ family protein [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239621158|ref|ZP_04664189.1| protein mraZ [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|296454441|ref|YP_003661584.1| MraZ protein [Bifidobacterium longum subsp. longum JDM301]
 gi|322689515|ref|YP_004209249.1| hypothetical protein BLIF_1332 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691470|ref|YP_004221040.1| hypothetical protein BLLJ_1281 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|23326578|gb|AAN25115.1| conserved hypothetical protein in upf0040 [Bifidobacterium longum
           NCC2705]
 gi|189427470|gb|ACD97618.1| Hypothetical protein BLD_0172 [Bifidobacterium longum DJO10A]
 gi|227211957|gb|EEI79853.1| MraZ family protein [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239515619|gb|EEQ55486.1| protein mraZ [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|291516660|emb|CBK70276.1| mraZ protein [Bifidobacterium longum subsp. longum F8]
 gi|296183872|gb|ADH00754.1| MraZ protein [Bifidobacterium longum subsp. longum JDM301]
 gi|320456326|dbj|BAJ66948.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320460851|dbj|BAJ71471.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 173

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 30  LLLGTYTPKIDAKGRMALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 84

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+L+   +R +  + ++V  +G G   +LW
Sbjct: 85  QRVSVGNKAAREYLRVFLSGAVDQQPDKQGRVLVPQMLRDYANLGSDVVVIGVGTRAELW 144

Query: 123 NPQTFRKLQEESRNEYCR 140
           N  T+     E    Y  
Sbjct: 145 NKDTWESYLAEKEEGYSD 162


>gi|323466810|gb|ADX70497.1| Protein mraZ [Lactobacillus helveticus H10]
          Length = 143

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 55/136 (40%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P   R  +  + +             I   + +  +  E K+
Sbjct: 1   MFMGEYHHNLDNKGRLIIPAKLRDQIENKMVFTRGM-----EGCIFGYSMEEWQKIEAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+         +   L + G +  + D +GR+  T  ++   G+  E   +G  +  ++W
Sbjct: 56  AKLPLTKGNTRKFMRLFYSGAMESEFDKQGRVNFTSTLKAHAGLIKECVIIGVSDRIEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
             + +   +EE+  +Y
Sbjct: 116 AKERWDSFEEEANEDY 131


>gi|15609303|ref|NP_216682.1| cell division protein MraZ [Mycobacterium tuberculosis H37Rv]
 gi|15841658|ref|NP_336695.1| cell division protein MraZ [Mycobacterium tuberculosis CDC1551]
 gi|31793346|ref|NP_855839.1| cell division protein MraZ [Mycobacterium bovis AF2122/97]
 gi|121638048|ref|YP_978272.1| cell division protein MraZ [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661982|ref|YP_001283505.1| cell division protein MraZ [Mycobacterium tuberculosis H37Ra]
 gi|148823375|ref|YP_001288129.1| cell division protein MraZ [Mycobacterium tuberculosis F11]
 gi|167966820|ref|ZP_02549097.1| hypothetical protein MtubH3_01625 [Mycobacterium tuberculosis
           H37Ra]
 gi|215403556|ref|ZP_03415737.1| cell division protein MraZ [Mycobacterium tuberculosis 02_1987]
 gi|215411892|ref|ZP_03420666.1| cell division protein MraZ [Mycobacterium tuberculosis 94_M4241A]
 gi|215427544|ref|ZP_03425463.1| cell division protein MraZ [Mycobacterium tuberculosis T92]
 gi|215431099|ref|ZP_03429018.1| cell division protein MraZ [Mycobacterium tuberculosis EAS054]
 gi|215446397|ref|ZP_03433149.1| cell division protein MraZ [Mycobacterium tuberculosis T85]
 gi|218753889|ref|ZP_03532685.1| cell division protein MraZ [Mycobacterium tuberculosis GM 1503]
 gi|219558146|ref|ZP_03537222.1| cell division protein MraZ [Mycobacterium tuberculosis T17]
 gi|224990542|ref|YP_002645229.1| hypothetical protein JTY_2177 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253798769|ref|YP_003031770.1| hypothetical protein TBMG_01814 [Mycobacterium tuberculosis KZN
           1435]
 gi|254232322|ref|ZP_04925649.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254364967|ref|ZP_04981013.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254551205|ref|ZP_05141652.1| cell division protein MraZ [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260187164|ref|ZP_05764638.1| cell division protein MraZ [Mycobacterium tuberculosis CPHL_A]
 gi|260201285|ref|ZP_05768776.1| cell division protein MraZ [Mycobacterium tuberculosis T46]
 gi|260205464|ref|ZP_05772955.1| cell division protein MraZ [Mycobacterium tuberculosis K85]
 gi|289443673|ref|ZP_06433417.1| mraZ protein [Mycobacterium tuberculosis T46]
 gi|289447794|ref|ZP_06437538.1| cell division protein MraZ [Mycobacterium tuberculosis CPHL_A]
 gi|289554047|ref|ZP_06443257.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289570282|ref|ZP_06450509.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289574852|ref|ZP_06455079.1| mraZ protein [Mycobacterium tuberculosis K85]
 gi|289745440|ref|ZP_06504818.1| protein mraZ [Mycobacterium tuberculosis 02_1987]
 gi|289750762|ref|ZP_06510140.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289754276|ref|ZP_06513654.1| mraZ [Mycobacterium tuberculosis EAS054]
 gi|289758288|ref|ZP_06517666.1| mraZ [Mycobacterium tuberculosis T85]
 gi|289762327|ref|ZP_06521705.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294993553|ref|ZP_06799244.1| cell division protein MraZ [Mycobacterium tuberculosis 210]
 gi|297634756|ref|ZP_06952536.1| cell division protein MraZ [Mycobacterium tuberculosis KZN 4207]
 gi|297731747|ref|ZP_06960865.1| cell division protein MraZ [Mycobacterium tuberculosis KZN R506]
 gi|298525660|ref|ZP_07013069.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306776418|ref|ZP_07414755.1| hypothetical protein TMAG_00355 [Mycobacterium tuberculosis
           SUMu001]
 gi|306780195|ref|ZP_07418532.1| hypothetical protein TMBG_00714 [Mycobacterium tuberculosis
           SUMu002]
 gi|306784942|ref|ZP_07423264.1| hypothetical protein TMCG_00262 [Mycobacterium tuberculosis
           SUMu003]
 gi|306789309|ref|ZP_07427631.1| hypothetical protein TMDG_00644 [Mycobacterium tuberculosis
           SUMu004]
 gi|306793635|ref|ZP_07431937.1| hypothetical protein TMEG_02534 [Mycobacterium tuberculosis
           SUMu005]
 gi|306798026|ref|ZP_07436328.1| hypothetical protein TMFG_01128 [Mycobacterium tuberculosis
           SUMu006]
 gi|306803906|ref|ZP_07440574.1| hypothetical protein TMHG_01356 [Mycobacterium tuberculosis
           SUMu008]
 gi|306808477|ref|ZP_07445145.1| hypothetical protein TMGG_00724 [Mycobacterium tuberculosis
           SUMu007]
 gi|306968303|ref|ZP_07480964.1| hypothetical protein TMIG_00834 [Mycobacterium tuberculosis
           SUMu009]
 gi|306972530|ref|ZP_07485191.1| hypothetical protein TMJG_00428 [Mycobacterium tuberculosis
           SUMu010]
 gi|307080237|ref|ZP_07489407.1| hypothetical protein TMKG_00428 [Mycobacterium tuberculosis
           SUMu011]
 gi|307084823|ref|ZP_07493936.1| hypothetical protein TMLG_04134 [Mycobacterium tuberculosis
           SUMu012]
 gi|313659081|ref|ZP_07815961.1| cell division protein MraZ [Mycobacterium tuberculosis KZN V2475]
 gi|54037828|sp|P65437|MRAZ_MYCBO RecName: Full=Protein MraZ
 gi|54041490|sp|P65436|MRAZ_MYCTU RecName: Full=Protein MraZ
 gi|167012254|sp|A1KKK9|MRAZ_MYCBP RecName: Full=Protein MraZ
 gi|167012258|sp|A5U4J3|MRAZ_MYCTA RecName: Full=Protein MraZ
 gi|254813286|sp|C1AQ82|MRAZ_MYCBT RecName: Full=Protein MraZ
 gi|2104312|emb|CAB08661.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13881911|gb|AAK46509.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31618938|emb|CAD97043.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121493696|emb|CAL72171.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124601381|gb|EAY60391.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134150481|gb|EBA42526.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148506134|gb|ABQ73943.1| hypothetical protein MRA_2181 [Mycobacterium tuberculosis H37Ra]
 gi|148721902|gb|ABR06527.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224773655|dbj|BAH26461.1| hypothetical protein JTY_2177 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253320272|gb|ACT24875.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289416592|gb|EFD13832.1| mraZ protein [Mycobacterium tuberculosis T46]
 gi|289420752|gb|EFD17953.1| cell division protein MraZ [Mycobacterium tuberculosis CPHL_A]
 gi|289438679|gb|EFD21172.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289539283|gb|EFD43861.1| mraZ protein [Mycobacterium tuberculosis K85]
 gi|289544036|gb|EFD47684.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289685968|gb|EFD53456.1| protein mraZ [Mycobacterium tuberculosis 02_1987]
 gi|289691349|gb|EFD58778.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289694863|gb|EFD62292.1| mraZ [Mycobacterium tuberculosis EAS054]
 gi|289709833|gb|EFD73849.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289713852|gb|EFD77864.1| mraZ [Mycobacterium tuberculosis T85]
 gi|298495454|gb|EFI30748.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215155|gb|EFO74554.1| hypothetical protein TMAG_00355 [Mycobacterium tuberculosis
           SUMu001]
 gi|308326910|gb|EFP15761.1| hypothetical protein TMBG_00714 [Mycobacterium tuberculosis
           SUMu002]
 gi|308330346|gb|EFP19197.1| hypothetical protein TMCG_00262 [Mycobacterium tuberculosis
           SUMu003]
 gi|308334179|gb|EFP23030.1| hypothetical protein TMDG_00644 [Mycobacterium tuberculosis
           SUMu004]
 gi|308337979|gb|EFP26830.1| hypothetical protein TMEG_02534 [Mycobacterium tuberculosis
           SUMu005]
 gi|308341664|gb|EFP30515.1| hypothetical protein TMFG_01128 [Mycobacterium tuberculosis
           SUMu006]
 gi|308345156|gb|EFP34007.1| hypothetical protein TMGG_00724 [Mycobacterium tuberculosis
           SUMu007]
 gi|308349458|gb|EFP38309.1| hypothetical protein TMHG_01356 [Mycobacterium tuberculosis
           SUMu008]
 gi|308354089|gb|EFP42940.1| hypothetical protein TMIG_00834 [Mycobacterium tuberculosis
           SUMu009]
 gi|308358032|gb|EFP46883.1| hypothetical protein TMJG_00428 [Mycobacterium tuberculosis
           SUMu010]
 gi|308361968|gb|EFP50819.1| hypothetical protein TMKG_00428 [Mycobacterium tuberculosis
           SUMu011]
 gi|308365609|gb|EFP54460.1| hypothetical protein TMLG_04134 [Mycobacterium tuberculosis
           SUMu012]
 gi|323719263|gb|EGB28407.1| hypothetical protein TMMG_01446 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903783|gb|EGE50716.1| mraZ [Mycobacterium tuberculosis W-148]
 gi|328458532|gb|AEB03955.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 143

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRAAFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++    + +A      +  G      DS+GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  SKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLSKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++  Q+     +  
Sbjct: 116 DAQAWQNYQQIHEENFSA 133


>gi|256425919|ref|YP_003126572.1| MraZ protein [Chitinophaga pinensis DSM 2588]
 gi|256040827|gb|ACU64371.1| MraZ protein [Chitinophaga pinensis DSM 2588]
          Length = 155

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FL      +D+KGR  +P  F+  LA+         + F    +S+      +   +
Sbjct: 1   MTGFLGEYEATLDAKGRFLLPAGFKKQLAESAGEQFVINRGF-EKCLSLYPMSEWQPIFE 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI++ N F  +  +       G    ++DS GR+L+   +  +  +E ++      N  +
Sbjct: 60  KISKLNDFDPKVREFRRYFLNGATICELDSAGRLLVPKNLMAYASLEKDIVLAAATNKIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   +++  E         L Q+
Sbjct: 120 IWDKGKYQEFFENFSPGAFSDLAQQ 144


>gi|213691741|ref|YP_002322327.1| MraZ protein [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|213523202|gb|ACJ51949.1| MraZ protein [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|320457835|dbj|BAJ68456.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 173

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 30  LLLGTYTPKIDAKGRMALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 84

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+L+   +R +  + ++V  +G G   +LW
Sbjct: 85  QRVSVGNKAAREYLRVFLSGAVDQQPDKQGRVLVPQMLRDYANLGSDVVVIGVGTRAELW 144

Query: 123 NPQTFRKLQEESRNEYCR 140
           N  T+     E    Y  
Sbjct: 145 NKDTWESYLAEKEEGYSD 162


>gi|222528775|ref|YP_002572657.1| cell division protein MraZ [Caldicellulosiruptor bescii DSM 6725]
 gi|254813269|sp|B9MQ92|MRAZ_ANATD RecName: Full=Protein MraZ
 gi|222455622|gb|ACM59884.1| MraZ protein [Caldicellulosiruptor bescii DSM 6725]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 58/145 (40%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +DSKGR+ +P  FR  L +R I             +   +       E+K+
Sbjct: 1   MLIGEYKHVVDSKGRIILPSKFREELGERFILTKGL-----DNCLFGYSLKEWGVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A         G    ++D +GR+L+   +R + GI+ EV  +G     ++W
Sbjct: 56  KKLPLTSKEARTFLRFFFAGACECEVDKQGRVLIPQNLREYAGIQKEVFIIGVMTRIEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   + K       S +   +++ +
Sbjct: 116 SENNWLKEMTNENLSVDRIAQKMEE 140


>gi|312622934|ref|YP_004024547.1| mraz protein [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203401|gb|ADQ46728.1| MraZ protein [Caldicellulosiruptor kronotskyensis 2002]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 58/145 (40%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +DSKGR+ +P  FR  L +R I             +   +       E+K+
Sbjct: 1   MLIGEYKHVVDSKGRIILPSKFREELGERFILTKGL-----DNCLFGYSLKEWAVLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S +A         G    ++D +GR+L+   +R + GI+ EV  +G     ++W
Sbjct: 56  KKLPLTSKEARTFLRFFFAGASECEVDKQGRVLIPQNLREYAGIQKEVFIIGVMTRIEIW 115

Query: 123 NPQTFRKLQEE---SRNEYCRQLLQ 144
           +   + K       S +   +++ +
Sbjct: 116 SEDNWLKEMTNENLSVDRIAQKMEE 140


>gi|222149145|ref|YP_002550102.1| cell division protein MraZ [Agrobacterium vitis S4]
 gi|221736129|gb|ACM37092.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 146

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 84/138 (60%), Positives = 109/138 (78%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLSN T +ID+KGRVSVP  FR +LA R I +LYCFQDF FPAIS+G  DLLE +E+
Sbjct: 1   MNRFLSNATNRIDTKGRVSVPAAFRAVLAAREIQELYCFQDFTFPAISIGGPDLLERYER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +I   +PFS  AN++SLLVHGGG+F+++DSEGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 61  QIVGEDPFSSVANEMSLLVHGGGVFMRLDSEGRLMVTDFIRDFTGITSEVTFVGRSDHFQ 120

Query: 121 LWNPQTFRKLQEESRNEY 138
           +W PQ F + Q  +R   
Sbjct: 121 VWQPQAFHEAQAAARKAL 138


>gi|312898968|ref|ZP_07758356.1| protein MraZ [Megasphaera micronuciformis F0359]
 gi|310620130|gb|EFQ03702.1| protein MraZ [Megasphaera micronuciformis F0359]
          Length = 144

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 53/141 (37%), Gaps = 8/141 (5%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      +D+KGRV +P  FR  L     T     +      +SV   +    F   + +
Sbjct: 1   MGEYAHSVDAKGRVIMPAKFRDELG----TSFVVTRGL-EGCLSVYTQEGWARFATGMQK 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                         + G    L+ D +GRIL+   +R +  +  +V  +G G+  ++W+ 
Sbjct: 56  LQASKENVRAFKRFLFGSAAELEFDKQGRILIPATLREYAHLVKDVIVLGTGDKIEIWSK 115

Query: 125 QTFRKLQEE---SRNEYCRQL 142
           + +    E+   +       L
Sbjct: 116 EAYAAYSEKTVPAMEAIAETL 136


>gi|41408004|ref|NP_960840.1| cell division protein MraZ [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118462602|ref|YP_881531.1| cell division protein MraZ [Mycobacterium avium 104]
 gi|254774998|ref|ZP_05216514.1| cell division protein MraZ [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|51316295|sp|Q73YP9|MRAZ_MYCPA RecName: Full=Protein MraZ
 gi|167012253|sp|A0QF43|MRAZ_MYCA1 RecName: Full=Protein MraZ
 gi|41396358|gb|AAS04223.1| hypothetical protein MAP_1906c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118163889|gb|ABK64786.1| MraZ protein [Mycobacterium avium 104]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRAEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +  A      +  G      D++GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  SKASKSNPDARAFLRNLAAGTDEQHPDAQGRITLSADHRRYASLSKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++  Q+     +  
Sbjct: 116 DAQAWQDYQQTHEENFSA 133


>gi|329944592|ref|ZP_08292732.1| protein MraZ [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530145|gb|EGF57028.1| protein MraZ [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA      +   +      +    +   E    ++
Sbjct: 1   MFLGTHAPKLDEKGRLILPAKFREELA----GGVVLTRG-QEHCLYAFTAAEFERMYAQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      QA     ++  G      D +GRI +   +R + G++ ++  +G G   ++W
Sbjct: 56  REAPLAQKQARDYVRVMLSGADSQIPDKQGRITLPAPLRAYAGLKKDLAVIGAGARVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +++          +     +
Sbjct: 116 DAESWSTYLATQEQVFADTAEE 137


>gi|183983193|ref|YP_001851484.1| hypothetical protein MMAR_3203 [Mycobacterium marinum M]
 gi|183176519|gb|ACC41629.1| conserved protein [Mycobacterium marinum M]
          Length = 151

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 60/137 (43%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ +
Sbjct: 10  FLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRSEFEQLARRAS 64

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +    + +A      +  G      DS+GRI ++   R + G+  +   +G  +Y ++W+
Sbjct: 65  KAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYAGLTKDCVVIGAVDYLEIWD 124

Query: 124 PQTFRKLQEESRNEYCR 140
            Q + + Q+     +  
Sbjct: 125 AQAWHEYQQLHEENFSA 141


>gi|38234182|ref|NP_939949.1| cell division protein MraZ [Corynebacterium diphtheriae NCTC 13129]
 gi|51316239|sp|Q6NGC0|MRAZ_CORDI RecName: Full=Protein MraZ
 gi|38200444|emb|CAE50132.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 59/142 (41%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREELAGGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D +GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AAVSRTNPEARAFIRNLAASADEQRPDGQGRITLSAAHRTYAGLSKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +   QEE+   +     +
Sbjct: 116 DAAAWAAYQEETEAAFSSAEGE 137


>gi|326771705|ref|ZP_08230990.1| MraZ protein [Actinomyces viscosus C505]
 gi|326637838|gb|EGE38739.1| MraZ protein [Actinomyces viscosus C505]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  LA      +   +      +    +   E    ++
Sbjct: 1   MFLGTHAPKLDEKGRLILPAKFREELA----GGVVLTRG-QEHCLYAFTAAEFERMYAQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      QA     ++  G      D +GRI +   +R + G++ ++  +G G   ++W
Sbjct: 56  REAPLAQKQARDYVRVMLSGADSQIPDKQGRITLPAPLRAYAGLKKDLAVIGAGARVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +++          +     +
Sbjct: 116 DSESWSTYLAAQEQVFADTAEE 137


>gi|262202918|ref|YP_003274126.1| MraZ protein [Gordonia bronchialis DSM 43247]
 gi|262086265|gb|ACY22233.1| MraZ protein [Gordonia bronchialis DSM 43247]
          Length = 146

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 6/139 (4%)

Query: 1   MS-RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59
           MS RF+   T K+D KGR+++P  FR  LA                ++SV  ++  +   
Sbjct: 1   MSVRFVGTYTPKLDDKGRLTLPARFRDALAGG-----VMVTKGQDHSLSVYRAEEFDVIA 55

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
            KI E +    +A              + D +GRI ++   R + G+  E    G  ++ 
Sbjct: 56  GKIVEASRNDPEARAFQRYFFASSEEQRPDGQGRITLSADHRSYAGLSKECVVFGSFDHL 115

Query: 120 QLWNPQTFRKLQEESRNEY 138
           ++W+   +R  Q +    +
Sbjct: 116 EIWDAAAWRDYQSQHEENF 134


>gi|83592295|ref|YP_426047.1| MraZ protein [Rhodospirillum rubrum ATCC 11170]
 gi|91207211|sp|Q2RVT5|MRAZ_RHORT RecName: Full=Protein MraZ
 gi|83575209|gb|ABC21760.1| MraZ protein [Rhodospirillum rubrum ATCC 11170]
          Length = 155

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 49/131 (37%), Gaps = 2/131 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     K+D KGRVSVP  FR +L     T +    D     I     D LE   +
Sbjct: 9   MKPFIGTYENKVDRKGRVSVPAKFRAVLQAAEYTTIVVRPDRERGCIEGYGMDRLERLSE 68

Query: 61  KIAEYNPFSIQANQLSLLV--HGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
              +      Q   L  +         L  D  GR+++   +    GI     FVG G  
Sbjct: 69  ATPDLLDEGTQTPSLERIYDILSDSEELPFDPTGRVVVPADLLAQAGIGETAVFVGLGRV 128

Query: 119 FQLWNPQTFRK 129
           FQ+WNP     
Sbjct: 129 FQIWNPTALEA 139


>gi|85858516|ref|YP_460718.1| cell division protein [Syntrophus aciditrophicus SB]
 gi|123515898|sp|Q2LR40|MRAZ_SYNAS RecName: Full=Protein MraZ
 gi|85721607|gb|ABC76550.1| cell division protein [Syntrophus aciditrophicus SB]
          Length = 148

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 51/129 (39%), Gaps = 2/129 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       ID KGRV  P   R +LA    + L   +  +   + V         E+
Sbjct: 1   MGGFRGEYYHTIDEKGRVIFPAKLREVLAADYDSRLIITK--WDGYLMVFPDKEWSIIEE 58

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+  Y     ++         G +   +D++GR+L+   +R++  +E ++   G     +
Sbjct: 59  KVRRYPLLKKESRAFQRFFMAGAVSCTIDNQGRVLIPPNLRIYAKLEKDIVLAGMLRVIE 118

Query: 121 LWNPQTFRK 129
           +W+   +  
Sbjct: 119 IWDRDLYEA 127


>gi|294101809|ref|YP_003553667.1| MraZ protein [Aminobacterium colombiense DSM 12261]
 gi|293616789|gb|ADE56943.1| MraZ protein [Aminobacterium colombiense DSM 12261]
          Length = 141

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +     K+DSKGR  +P  FR  L Q  +  +          +S+   +      +K+
Sbjct: 1   MLMGTYEHKVDSKGRTVLPAKFRQELGQCVVATIGI-----DQCVSIYPMNHWSRVLEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      ++  L  ++      L +D+ GRIL+   +R    ++++  FVG  ++ +LW
Sbjct: 56  QELPFSKSKSRGLMRVMLASAHELPIDNAGRILIPQLLRDHANLQSDALFVGVSDHIELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q + +   +        + ++
Sbjct: 116 DKQLWDEYSLQVMEALPA-IAEE 137


>gi|240168226|ref|ZP_04746885.1| cell division protein MraZ [Mycobacterium kansasii ATCC 12478]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDSLA----GGLMVTKS-QDHSLAVYPRAEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++    + +A      +  G      D +GRI ++   R + G+  +   +G  +Y ++W
Sbjct: 56  SKAPRSNPEARAFLRNLAAGTDEQHPDGQGRITLSADHRRYAGLSKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q +   Q+     +  
Sbjct: 116 DAQAWHDYQQLHEENFSA 133


>gi|225019364|ref|ZP_03708556.1| hypothetical protein CLOSTMETH_03317 [Clostridium methylpentosum
           DSM 5476]
 gi|224947995|gb|EEG29204.1| hypothetical protein CLOSTMETH_03317 [Clostridium methylpentosum
           DSM 5476]
          Length = 139

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 53/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +   +  +D+KGR++ P   R  L    I             + V + +     E+ I
Sbjct: 1   MLIGEYSHTVDTKGRINFPSKLRDDLGDSFIVTRGL-----DNCLYVYSMEEWLELEKSI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +   L      G   ++ D +GRI +   +R + GI+  V  VG  ++ ++W
Sbjct: 56  KQLPRAKRR--DLEHFFFAGASEVQPDKQGRIGIVPKLREYAGIDKNVVVVGASDHVEIW 113

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +  +      E     + +
Sbjct: 114 DSAAWESVSSSISAEAIADTMDE 136


>gi|254819737|ref|ZP_05224738.1| cell division protein MraZ [Mycobacterium intracellulare ATCC
           13950]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRAEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  +  A      +  G      D++GRI ++   R +  +  E   +G  +Y ++W
Sbjct: 56  SKASRSNPDARAFLRNLAAGTDEQHPDAQGRITLSADHRRYASLSKECVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++  Q+     +  
Sbjct: 116 DAQAWQDYQQTHEENFSA 133


>gi|51316476|sp|Q8G4R1|MRAZ_BIFLO RecName: Full=Protein MraZ
          Length = 150

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 7   LLLGTYTPKIDAKGRMALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 61

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+L+   +R +  + ++V  +G G   +LW
Sbjct: 62  QRVSVGNKAAREYLRVFLSGAVDQQPDKQGRVLVPQMLRDYANLGSDVVVIGVGTRAELW 121

Query: 123 NPQTFRKLQEESRNEYCR 140
           N  T+     E    Y  
Sbjct: 122 NKDTWESYLAEKEEGYSD 139


>gi|239907972|ref|YP_002954713.1| protein MraZ [Desulfovibrio magneticus RS-1]
 gi|259509652|sp|C4XK87|MRAZ_DESMR RecName: Full=Protein MraZ
 gi|239797838|dbj|BAH76827.1| protein MraZ [Desulfovibrio magneticus RS-1]
          Length = 152

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 56/140 (40%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +  + +D KGR+ +P  FR  + +          + F  AIS       E  E   
Sbjct: 1   MFRGHSNRSLDPKGRLMLPPEFREEIFRLVPDGRVMLTNNFDGAISGYPMPEWEAVEASF 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              N        +      G   + +D +GRIL+  ++R + G++ E+   G G  F++W
Sbjct: 61  RAGNTLMPGFRDIERFFIAGATEVTVDKQGRILIPPYLRTYAGLDKEMVLAGVGTKFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQL 142
           +   F +   ++   +   +
Sbjct: 121 DQGRFEERLRQTAANFNAHM 140


>gi|116670122|ref|YP_831055.1| cell division protein MraZ [Arthrobacter sp. FB24]
 gi|167011858|sp|A0JV85|MRAZ_ARTS2 RecName: Full=Protein MraZ
 gi|116610231|gb|ABK02955.1| MraZ protein [Arthrobacter sp. FB24]
          Length = 142

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  FR  LA      L   +      I V +        +++
Sbjct: 1   MFLGTHSPRLDEKGRIILPAKFREELAS----GLVLTRG-QERCIYVFSEREFGRIHEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    S Q      +   G      D +GR+ +   +R + G+  E+  +G G+  ++W
Sbjct: 56  REAPISSKQTRDYIRVFLSGASDEVPDKQGRVTIPPALRAYAGLGRELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q + +   E    +  
Sbjct: 116 DAQAWNEYLAEKETSFSE 133


>gi|319938120|ref|ZP_08012518.1| mraZ protein [Coprobacillus sp. 29_1]
 gi|319806641|gb|EFW03290.1| mraZ protein [Coprobacillus sp. 29_1]
          Length = 143

 Score =  125 bits (315), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 51/136 (37%), Gaps = 5/136 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR+S+P   R         +           +++   +  E +  ++
Sbjct: 1   MFFGEFRHNIDAKGRLSIPAKMRNQ-----CGECVYVTRGNDGCLALYTQEGWEAYYHEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                          LV       + D  GRI +   +R    +E E   VG G++ ++W
Sbjct: 56  QSLPQKKKSTRIFIRLVTSRASECEFDKLGRINIPLVLRQEGNLEKECVIVGVGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEY 138
           +   + +  +++++ +
Sbjct: 116 SQSAWNQFYDDNKDSF 131


>gi|325286917|ref|YP_004262707.1| Protein mraZ [Cellulophaga lytica DSM 7489]
 gi|324322371|gb|ADY29836.1| Protein mraZ [Cellulophaga lytica DSM 7489]
          Length = 154

 Score =  125 bits (315), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F+     K D KGRV VP   ++ +A          +  F P + +   +      +
Sbjct: 1   MVNFIGTYECKADVKGRVMVPSALKSQMASVLNKGFVIKRSVFQPCLELYPMEEWNLLME 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ + N F  + N        G   +++D+ GR+L+   +     I  +V      N  +
Sbjct: 61  KMNKKNRFKKKNNDFIRRFSAGVKIVELDATGRLLIPKNLVEIANITKDVVLSSAINIIE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+  ++ K+ EE    +   L ++
Sbjct: 121 IWDKDSYEKVIEEDAENFAD-LAEE 144


>gi|94987538|ref|YP_595471.1| cell division protein MraZ [Lawsonia intracellularis PHE/MN1-00]
 gi|94731787|emb|CAJ55150.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 149

 Score =  125 bits (315), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 64/141 (45%), Gaps = 1/141 (0%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F     + IDSKGRV +P  +R  L +      +     +   I        +  E+K +
Sbjct: 3   FRGQSYRNIDSKGRVILPPGYRETLEEYSSEGSFVLT-TYDNCIVGYPEPQWKEIEEKFS 61

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +    S +      L  GG     +D +GR+ ++     +  +++E+  +G+G +F++W+
Sbjct: 62  KLRNSSKKLRDFRRLFLGGAEKQSLDLQGRVRISRAHIEYAKLDHEIVVLGQGEHFEIWD 121

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
              F+ + E+  ++   +L++
Sbjct: 122 QNRFKAVLEQDFDDVADELVE 142


>gi|160915590|ref|ZP_02077801.1| hypothetical protein EUBDOL_01600 [Eubacterium dolichum DSM 3991]
 gi|158432710|gb|EDP10999.1| hypothetical protein EUBDOL_01600 [Eubacterium dolichum DSM 3991]
          Length = 143

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 55/145 (37%), Gaps = 8/145 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+KGR+ +P  FR  L +  +             +++   +      +++
Sbjct: 1   MFMGEYAHNLDAKGRIIIPAKFREELGEEVVVTRGM-----DCCLNIYTKEQWNTLLEQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +       A +    +      +++D++GRI +   +     +E E   VG  NY ++W
Sbjct: 56  TKLPSTKADARKFVRAMGAKTAHVEIDAQGRIKLPLNLIALAHLEKECMVVGVLNYVEIW 115

Query: 123 NPQTFRKLQEESRNEY---CRQLLQ 144
               +  +  ES   +      L +
Sbjct: 116 AKDKYEAMDAESNEAFETIAESLTE 140


>gi|182418000|ref|ZP_02949306.1| MraZ protein [Clostridium butyricum 5521]
 gi|237667824|ref|ZP_04527808.1| MraZ protein [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182378171|gb|EDT75706.1| MraZ protein [Clostridium butyricum 5521]
 gi|237656172|gb|EEP53728.1| MraZ protein [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 142

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 47/130 (36%), Gaps = 5/130 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSK R+ VP   R  L           +      +     +  +  E K+
Sbjct: 1   MFIGEYQHSLDSKNRIIVPAKLREGLG----NKFVITKGL-DGCLYAYPLEEWKILEDKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   +++D + R L+   ++ +  IE ++  +G  +  ++W
Sbjct: 56  KTLPLTNKDARTFVRFFFSGACEVELDKQFRGLIPQNLKEYAKIEKDIVSIGVLSRVEIW 115

Query: 123 NPQTFRKLQE 132
           + + +    +
Sbjct: 116 SKEMWENYND 125


>gi|271964365|ref|YP_003338561.1| cell division protein MraZ [Streptosporangium roseum DSM 43021]
 gi|270507540|gb|ACZ85818.1| cell division protein MraZ [Streptosporangium roseum DSM 43021]
          Length = 143

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D KGR+ +P  +R  LA+     L   +      + V   +  +   + +
Sbjct: 1   MFLGTHHPRLDDKGRLFLPAKYREELAE----GLVITKG-QERCLYVFPVEEFQRITEAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +      S +          D +GR+ +   +R +  +  + T +G     ++W
Sbjct: 56  RTAPVTAKAVRDYSRVFFASASDEVADKQGRVTIPQALREYASLRRDCTVIGANTRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +     +    +   L ++
Sbjct: 116 DAHAWDTYLADQEQAFAD-LSEE 137


>gi|291457556|ref|ZP_06596946.1| MraZ protein [Bifidobacterium breve DSM 20213]
 gi|291380609|gb|EFE88127.1| MraZ protein [Bifidobacterium breve DSM 20213]
          Length = 173

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGRV++P  FR+ L Q     L   +      + +   D       +I
Sbjct: 30  LLLGTYTPKIDAKGRVALPAKFRSQLGQ----GLVMARG-QERCVYLLPFDEFRRIASQI 84

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +  + D +GR+++   +R +  + +++  +G G   +LW
Sbjct: 85  QRTSVGNKAAREYLRVFLSGAVDQEPDKQGRVVVPQMLRDYANLGSDIVVIGVGTRAELW 144

Query: 123 NPQTFRKLQEESRNEYCR 140
           N   +     +    Y  
Sbjct: 145 NKDAWESYLAQKEEGYSD 162


>gi|229827495|ref|ZP_04453564.1| hypothetical protein GCWU000182_02884 [Abiotrophia defectiva ATCC
           49176]
 gi|229788433|gb|EEP24547.1| hypothetical protein GCWU000182_02884 [Abiotrophia defectiva ATCC
           49176]
          Length = 144

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 55/144 (38%), Gaps = 8/144 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D+KGR+ VP  FR  L ++ I             + +   +  E F  ++
Sbjct: 1   MFTGSYEHTVDAKGRLIVPSKFREELGEKFIITFGL-----DGCLYMYPMNKWEDFVNQL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +        +  L        +  ++D +GR L+   +R    IE  V  VG     ++W
Sbjct: 56  STL-RGDKDSRALQRYFLASAVESEIDKQGRTLLPATLREKVNIEKNVMIVGMMGKIEIW 114

Query: 123 NPQTFRKLQEE--SRNEYCRQLLQ 144
           + + +     E    NE   +L +
Sbjct: 115 DKELWDNNNAEFGDINEIAERLAE 138


>gi|163761064|ref|ZP_02168141.1| MraZ protein [Hoeflea phototrophica DFL-43]
 gi|162281615|gb|EDQ31909.1| MraZ protein [Hoeflea phototrophica DFL-43]
          Length = 142

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 110/137 (80%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+RFLS+ T +ID+KGRVSVP +FR +LA+  + +LY +QDF FPAIS+   D+LE FE+
Sbjct: 1   MNRFLSHATNRIDAKGRVSVPSMFRAVLARSGVEELYVWQDFVFPAISMAGPDVLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +PFS++AN++SLL+HGGG+F+K+D EGR+L+TDFIR FTGI ++VTF GRG++FQ
Sbjct: 61  MIGSQDPFSLEANKMSLLIHGGGVFMKLDGEGRLLVTDFIRDFTGITDQVTFAGRGDHFQ 120

Query: 121 LWNPQTFRKLQEESRNE 137
           LW P  F ++Q ++R +
Sbjct: 121 LWAPAAFEEMQSQARKD 137


>gi|154488901|ref|ZP_02029750.1| hypothetical protein BIFADO_02210 [Bifidobacterium adolescentis
           L2-32]
 gi|154083038|gb|EDN82083.1| hypothetical protein BIFADO_02210 [Bifidobacterium adolescentis
           L2-32]
          Length = 171

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 28  LLLGTYTPKIDAKGRMALPAKFRSQLGS----GMVMARG-QERCVYLLPQSEFRRIAVQI 82

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +  + D +GR+L+   +R +  +++++  +G G   ++W
Sbjct: 83  QRTSMGNKAARDYLRVFLSGAVDQEPDKQGRVLVPQMLRDYANLDSDIVVIGVGTRAEIW 142

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q +     +    Y  
Sbjct: 143 NRQAWEDYLADKEQGYSD 160


>gi|269956075|ref|YP_003325864.1| MraZ protein [Xylanimonas cellulosilytica DSM 15894]
 gi|269304756|gb|ACZ30306.1| MraZ protein [Xylanimonas cellulosilytica DSM 15894]
          Length = 155

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T ++D KGR+ +P  FR  LA      L   +      + +   D      +++
Sbjct: 12  LLLGTYTPRLDEKGRLILPAKFRARLAS----GLVMTRG-QERCLFLMPMDEFSRMYEQV 66

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S QA     ++  G      D +GR+ +   +R + G++ +V  +G G   ++W
Sbjct: 67  RQAPVTSRQARDYLRVLLSGASDEMPDKQGRVSIPPVLREYAGLDRDVAVIGAGTRVEVW 126

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     E  + Y  
Sbjct: 127 DRAAWEAYLAEQESAYSD 144


>gi|183602415|ref|ZP_02963781.1| protein mraZ [Bifidobacterium animalis subsp. lactis HN019]
 gi|219683270|ref|YP_002469653.1| protein MraZ [Bifidobacterium animalis subsp. lactis AD011]
 gi|241191231|ref|YP_002968625.1| protein mraZ [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241196637|ref|YP_002970192.1| protein mraZ [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|183218334|gb|EDT88979.1| protein mraZ [Bifidobacterium animalis subsp. lactis HN019]
 gi|219620920|gb|ACL29077.1| protein MraZ [Bifidobacterium animalis subsp. lactis AD011]
 gi|240249623|gb|ACS46563.1| protein mraZ [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240251191|gb|ACS48130.1| protein mraZ [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|295794224|gb|ADG33759.1| protein mraZ [Bifidobacterium animalis subsp. lactis V9]
          Length = 161

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L     KID+KGR+++P   R  L +     +   +      + +           +I
Sbjct: 18  LLLGTYNPKIDAKGRMAIPAKMRAQLGE----GMVMARG-QERCVYLLPQSEFRRIAAQI 72

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A Q   +   G +    D +GR+++   +R +  + +++  +G G   ++W
Sbjct: 73  QRVSVGNKAARQYLRVFLSGAVDQDTDKQGRVVVPQMLREYADLGDDIVVIGVGTRAEIW 132

Query: 123 NPQTFRKLQEESRNEYCR 140
           N + + +   ++  EY  
Sbjct: 133 NRKAWEQYLSDNEPEYSD 150


>gi|260578097|ref|ZP_05846018.1| cell division protein MraZ [Corynebacterium jeikeium ATCC 43734]
 gi|258603736|gb|EEW16992.1| cell division protein MraZ [Corynebacterium jeikeium ATCC 43734]
          Length = 143

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  L +  +            +++V          +K 
Sbjct: 1   MFFGTFTPKLDDKGRLTLPAKFREELGEGLMVVK-----GQDRSLAVYPKAEFLVRAKKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE +  + +A      +        +DS+GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AEASRTNPKARAFVRNLAASADEQNLDSQGRISVSAMHRDYAGLTKECVVIGNVDFIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +++     E   ++  
Sbjct: 116 DAESWADYSAEHEEDFSD 133


>gi|327399189|ref|YP_004340058.1| Protein mraZ [Hippea maritima DSM 10411]
 gi|327181818|gb|AEA33999.1| Protein mraZ [Hippea maritima DSM 10411]
          Length = 147

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 55/130 (42%), Gaps = 2/130 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGRV +P  F+ +L  +  + L      F   I     D+ E  E+K 
Sbjct: 1   MFRGRFEYALDDKGRVKIPPRFKEVLKDKHQSSLVLT--VFDECIYAYPYDVWEELEKKA 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A +   +       + +D +GRIL+   +R    I+ +V  +G  ++ ++W
Sbjct: 59  VNLPLTNKAARRFKRMFFSSAQDVSIDKQGRILIPSVLRDDAQIDKDVVILGNLDHIEIW 118

Query: 123 NPQTFRKLQE 132
           + Q + +  +
Sbjct: 119 SKQRWDEESK 128


>gi|313905186|ref|ZP_07838554.1| MraZ protein [Eubacterium cellulosolvens 6]
 gi|313469939|gb|EFR65273.1| MraZ protein [Eubacterium cellulosolvens 6]
          Length = 144

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGRV +P  FR  L ++ +             +++      +  EQK+
Sbjct: 1   MFKGEFNHTIDSKGRVIIPSKFRDELGEKFVLTRGM-----DRCLAIYPQSAWDILEQKL 55

Query: 63  AEYNPFSIQANQ-LSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           A     S    + +   +  G    ++D +GRIL+   +R + G+  +V   G  +Y ++
Sbjct: 56  ATLPLTSSADARNIVRFLVNGATDCELDKQGRILVPSTLREYAGLTKDVILAGTLSYIEV 115

Query: 122 WNPQTF 127
           W+ + +
Sbjct: 116 WDKKRW 121


>gi|187934815|ref|YP_001886638.1| cell division protein MraZ [Clostridium botulinum B str. Eklund
           17B]
 gi|226709965|sp|B2TS31|MRAZ_CLOBB RecName: Full=Protein MraZ
 gi|187722968|gb|ACD24189.1| MraZ protein [Clostridium botulinum B str. Eklund 17B]
          Length = 142

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 52/143 (36%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSK R+ VP   R  L +  +             I     +     E K+
Sbjct: 1   MFIGEYQHSLDSKNRMIVPAKLREDLGEMFVITKGL-----DGCIYAYTINEWRILENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   + +D +GR L+   ++ + GIE ++  +G  +  ++W
Sbjct: 56  KTLPLTNKDARAFVRFFFSGACIVDLDKQGRGLIPQNLKEYAGIEKDIVSIGVLSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    E   +     + +K
Sbjct: 116 SREKWINYNESDID--YDLIAEK 136


>gi|83589685|ref|YP_429694.1| cell division protein MraZ [Moorella thermoacetica ATCC 39073]
 gi|91207196|sp|Q2RK88|MRAZ_MOOTA RecName: Full=Protein MraZ
 gi|83572599|gb|ABC19151.1| Protein of unknown function UPF0040 [Moorella thermoacetica ATCC
           39073]
          Length = 143

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 54/143 (37%), Gaps = 6/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P  FR  L           +      + V         EQK+
Sbjct: 1   MFMGEYHHTIDDKGRLIIPARFREELG----VKFVITKGL-DNCLFVYPMQGWAEMEQKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A         G    ++D +GRIL+   +R +  ++ EV  VG     ++W
Sbjct: 56  RSLPFTRADARAFVRFFFSGATECELDRQGRILLPGNLREYARLDKEVVVVGVSTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   + +   E+ ++Y   L +K
Sbjct: 116 SRSRWEEYCRETSDQY-EALAEK 137


>gi|117928209|ref|YP_872760.1| cell division protein MraZ [Acidothermus cellulolyticus 11B]
 gi|206558133|sp|A0LTL4|MRAZ_ACIC1 RecName: Full=Protein MraZ
 gi|117648672|gb|ABK52774.1| MraZ protein [Acidothermus cellulolyticus 11B]
          Length = 144

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 50/142 (35%), Gaps = 6/142 (4%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F+     ++D KGR+ +P  FR  LA      L   +      + V          + + 
Sbjct: 3   FMGTHYPRLDEKGRLFLPAKFRDELAD----GLVITKG-QERCLYVFPVAEFMRITEALR 57

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +        ++         D +GR+ +   +R + G+  +   +G     ++W+
Sbjct: 58  SAPIGAKAVRDYGRILFASAYDQVPDKQGRLTIPPNLREYAGLTRDCVVIGANTRVEIWD 117

Query: 124 PQTFRKLQEESRNEYCRQLLQK 145
            Q + +        +  +L Q+
Sbjct: 118 AQAWEEYLRAQEPAFA-ELSQE 138


>gi|17935988|ref|NP_532778.1| cell division protein MraZ [Agrobacterium tumefaciens str. C58]
 gi|20138933|sp|P58768|MRAZ_AGRT5 RecName: Full=Protein MraZ
 gi|17740564|gb|AAL43094.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 146

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 107/135 (79%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLSNVT +ID+KGRVSVP  FR++LA+R I +LYC QDF FPAISVG  DLLE +E+
Sbjct: 1   MDRFLSNVTNRIDAKGRVSVPSPFRSVLARRDIQELYCLQDFAFPAISVGGPDLLERYER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  + FS +AN +SLLVHGGG+F+K+D EGR+++TDF+R FTGI  EVTFVGR ++FQ
Sbjct: 61  QIASMDAFSPEANAMSLLVHGGGVFMKLDQEGRLMVTDFVREFTGISTEVTFVGRADHFQ 120

Query: 121 LWNPQTFRKLQEESR 135
           LW P  F   Q E+R
Sbjct: 121 LWQPNAFLAAQAEAR 135


>gi|257068255|ref|YP_003154510.1| mraZ protein [Brachybacterium faecium DSM 4810]
 gi|256559073|gb|ACU84920.1| mraZ protein [Brachybacterium faecium DSM 4810]
          Length = 143

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 50/138 (36%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+  P  FR  LA      L   +      I+V          ++ 
Sbjct: 1   MFLGTFTPKLDEKGRLIFPAKFRDELAS----GLVMTRG-QEHCIAVYPLMEFRQKLEEA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +      ++  G   +  D +GRI +   +R + G++ E   +G  +  ++W
Sbjct: 56  RRAPTTDRRTRDYLRVLLSGAEDVIPDKQGRITIPGHLRTYAGLDRECAVIGALDRLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
               +    E+    +  
Sbjct: 116 ALPAWEAYLEQKEEGFAE 133


>gi|328906988|gb|EGG26754.1| protein MraZ [Propionibacterium sp. P08]
          Length = 142

 Score =  125 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR  +P  FR  L       L   +      +++  ++      ++I
Sbjct: 1   MFLGTHTPKLDEKGRFFLPAKFRDELDD----GLVITRG-QDRCLAIYPTETFVEMTREI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +    +      ++  G      D +GR+++   +R + G+  E+  VG     ++W
Sbjct: 56  AKGSVSVKKVRDYQRMLAAGASDTAPDKQGRVMIPPMLRRYAGLNKEIVVVGAITRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + K  E     +     +
Sbjct: 116 DATEWEKYSETQEEAFADMNEE 137


>gi|226307048|ref|YP_002767008.1| conserved hypothetical protein MraZ [Rhodococcus erythropolis PR4]
 gi|229490447|ref|ZP_04384288.1| MraZ protein [Rhodococcus erythropolis SK121]
 gi|259509661|sp|C1A0Y4|MRAZ_RHOE4 RecName: Full=Protein MraZ
 gi|226186165|dbj|BAH34269.1| conserved hypothetical protein MraZ [Rhodococcus erythropolis PR4]
 gi|229322737|gb|EEN88517.1| MraZ protein [Rhodococcus erythropolis SK121]
          Length = 143

 Score =  125 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     ++++   D      +K 
Sbjct: 1   MFLGTFTPKLDDKGRLTLPAKFRDELA----GGLMITKS-QDHSLAIYPRDEFVKLARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A        A      +  G      D++GRI ++   R +  +  E    G  +Y ++W
Sbjct: 56  AAAPRNDPAARAYVRALAAGTDEQHADAQGRITLSADHRRYANLSKECVVTGSVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + +   ++  +Y +   +
Sbjct: 116 DLAAWERYLGDNEEDYSQATGE 137


>gi|262184488|ref|ZP_06043909.1| MraZ protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 144

 Score =  125 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 54/133 (40%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREELAGGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +  A      +       + D  GRI ++   R +  +  E   VG  ++ ++W
Sbjct: 56  AAVSRTNPDARAFIRNLAASADEQRPDGHGRITLSAGHREYANLTKECVVVGSVDFLEIW 115

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 116 DAAAWAEYQAQTE 128


>gi|254468424|ref|ZP_05081830.1| mraZ protein [beta proteobacterium KB13]
 gi|207087234|gb|EDZ64517.1| mraZ protein [beta proteobacterium KB13]
          Length = 147

 Score =  125 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 2/136 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D K R++VP  FR  L ++  + +          + + N       E+K+
Sbjct: 1   MFRGSSIVALDDKFRLAVPKKFRDKLFEQNSSLVV--TAHPDKCLVLYNLLSWVAIEKKL 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              + F  + + L  L+ G    +  D  GRIL++  +R F GI+ E+  +G+G++F++W
Sbjct: 59  MSLSSFDPKISTLQRLLVGYADEVDPDKTGRILLSASLREFAGIQQEIIILGQGSHFEIW 118

Query: 123 NPQTFRKLQEESRNEY 138
           +  T+ K    +    
Sbjct: 119 DKSTWSKKINSTVKNL 134


>gi|296117528|ref|ZP_06836112.1| MraZ protein [Corynebacterium ammoniagenes DSM 20306]
 gi|295969259|gb|EFG82500.1| MraZ protein [Corynebacterium ammoniagenes DSM 20306]
          Length = 144

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 55/133 (41%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDELAGGLMVTK-----GQDHSLAVYPREEFAERARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D  GRI ++   R +  +  E   +G  ++ ++W
Sbjct: 56  AAVSRTNPEARAFIRNLAASADEQRPDGSGRITLSAAHRKYANLSKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 116 DAAAWAEYQSQTE 128


>gi|323356559|ref|YP_004222955.1| hypothetical protein MTES_0111 [Microbacterium testaceum StLB037]
 gi|323272930|dbj|BAJ73075.1| uncharacterized protein conserved in bacteria [Microbacterium
           testaceum StLB037]
          Length = 143

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T K+D KGRV +P  FR  L                  + V +++  E   ++I
Sbjct: 1   MLLGTHTPKLDDKGRVILPAKFRDDLGAG-----VVITRGQDRCLYVFSTEEFERVHERI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    + QA     +   G    K DS+ RI +   +R + G+  E+   G G + ++W
Sbjct: 56  REAPLSNKQARDFLRMFLSGASAEKPDSQNRITVPPALRTYAGLGRELVVTGVGAHAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +    E +   Y     +
Sbjct: 116 DAEAWNTYAESNEETYAEMEQE 137


>gi|169629084|ref|YP_001702733.1| cell division protein MraZ [Mycobacterium abscessus ATCC 19977]
 gi|226709994|sp|B1MP28|MRAZ_MYCA9 RecName: Full=Protein MraZ
 gi|169241051|emb|CAM62079.1| Protein MraZ [Mycobacterium abscessus]
          Length = 143

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 58/137 (42%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA      L   +     +++V      E   +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKS-QDHSLAVYPRAEFEQLARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +         D++GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  AAASRSNPEARAFLRNLAAATDEQHPDAQGRITLSADHRRYADLSKDCVVIGSVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYC 139
           +   +++  EE    + 
Sbjct: 116 DAAKWQQYLEEHEENFS 132


>gi|294506453|ref|YP_003570511.1| protein MraZ [Salinibacter ruber M8]
 gi|294342781|emb|CBH23559.1| protein MraZ [Salinibacter ruber M8]
          Length = 188

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 60/141 (42%), Gaps = 2/141 (1%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +DSKGRV++P   R  L+          + F    I +   D     E++I 
Sbjct: 46  FKGQAEYSVDSKGRVAIPAKMRKSLSPAANETFTITRGFED-CIFLYPMDEWSDIEEEID 104

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E + +  +      L+      + +D +GRI + + +  F G+++    +G  ++ ++W+
Sbjct: 105 ELSMYDREVRNFVRLIMRWASEVSLDGQGRISIPNPLIDFAGLDDSALILGAFDHIEIWD 164

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
           P  F     E  ++Y   L +
Sbjct: 165 PAQFDGYLNEQPDDY-ETLAE 184


>gi|289177347|gb|ADC84593.1| MraZ [Bifidobacterium animalis subsp. lactis BB-12]
          Length = 181

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L     KID+KGR+++P   R  L +     +   +      + +           +I
Sbjct: 38  LLLGTYNPKIDAKGRMAIPAKMRAQLGE----GMVMARG-QERCVYLLPQSEFRRIAAQI 92

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A Q   +   G +    D +GR+++   +R +  + +++  +G G   ++W
Sbjct: 93  QRVSVGNKAARQYLRVFLSGAVDQDTDKQGRVVVPQMLREYADLGDDIVVIGVGTRAEIW 152

Query: 123 NPQTFRKLQEESRNEYCR 140
           N + + +   ++  EY  
Sbjct: 153 NRKAWEQYLSDNEPEYSD 170


>gi|320527514|ref|ZP_08028694.1| protein MraZ [Solobacterium moorei F0204]
 gi|320132071|gb|EFW24621.1| protein MraZ [Solobacterium moorei F0204]
          Length = 155

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 55/147 (37%), Gaps = 8/147 (5%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +D K R+ +P  +R  L  +     +         ++    +       
Sbjct: 10  MVMFTGEYRHNLDPKNRLIIPSKYRDQLTTKIYITEWM-----DGCLAAFAENEWNELVS 64

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ +    + +A      + G      +D++GRIL+  F     G E     VG  ++F+
Sbjct: 65  KLNKLPITNKKARAFVRSILGKSDECGVDNQGRILLPQFQISDRGFEKACVIVGASDHFE 124

Query: 121 LWNPQTFRKLQEESR---NEYCRQLLQ 144
           +W  + F +  EES     ++   L +
Sbjct: 125 IWPEKVFEQYNEESMGELEDFAEDLTE 151


>gi|150026103|ref|YP_001296929.1| protein MraZ [Flavobacterium psychrophilum JIP02/86]
 gi|167012243|sp|A6H1A3|MRAZ_FLAPJ RecName: Full=Protein MraZ
 gi|149772644|emb|CAL44127.1| Protein MraZ [Flavobacterium psychrophilum JIP02/86]
          Length = 157

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+  +     K+DSKGR+ +P   +  L           +  F   + +      +   Q
Sbjct: 1   MNTIVGTYECKVDSKGRLMMPNPLKKQLNVSLQEGFVLKRSVFQQCLELYPMKEWDLMMQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI + N F  + N        G   +++D+ GR+L+   + VF  +  ++      N  +
Sbjct: 61  KINKLNRFVKKNNDFIRRFTAGVRIIEIDATGRLLIPKDLAVFASVTKDIVLSSAVNIIE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   + K  ++S  ++   L ++
Sbjct: 121 IWDKDLYEKAIDDSVGDFAD-LAEE 144


>gi|83816078|ref|YP_444695.1| mraZ protein [Salinibacter ruber DSM 13855]
 gi|83757472|gb|ABC45585.1| mraZ protein [Salinibacter ruber DSM 13855]
          Length = 158

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 60/141 (42%), Gaps = 2/141 (1%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +DSKGRV++P   R  L+          + F    I +   D     E++I 
Sbjct: 16  FKGQAEYSVDSKGRVAIPAKMRKSLSPAANETFTITRGFED-CIFLYPMDEWADIEEEID 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E + +  +      L+      + +D +GRI + + +  F G+++    +G  ++ ++W+
Sbjct: 75  ELSMYDREVRNFVRLIMRWASEVSLDGQGRISIPNPLIDFAGLDDSALILGAFDHIEIWD 134

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
           P  F     E  ++Y   L +
Sbjct: 135 PAQFDGYLNEQPDDY-ETLAE 154


>gi|261855062|ref|YP_003262345.1| MraZ protein [Halothiobacillus neapolitanus c2]
 gi|261835531|gb|ACX95298.1| MraZ protein [Halothiobacillus neapolitanus c2]
          Length = 149

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 1/130 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR+++P   R   A      +    D     + +         E +I
Sbjct: 1   MFKGITNLNLDGKGRLAMPTRHRAAFAAEE-GQMVMTIDAQERCLLIYPLATWLIIEPQI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                F+ QAN++  ++ G    L +DS GRIL+   +R    ++ EV  VG+G   +LW
Sbjct: 60  DALPSFNAQANRVKRMLIGHATELTLDSAGRILVPTELRNHAELDKEVVLVGQGKKLELW 119

Query: 123 NPQTFRKLQE 132
           +   +    E
Sbjct: 120 SQPNWAAQTE 129


>gi|116750881|ref|YP_847568.1| MraZ protein [Syntrophobacter fumaroxidans MPOB]
 gi|167012282|sp|A0LNY1|MRAZ_SYNFM RecName: Full=Protein MraZ
 gi|116699945|gb|ABK19133.1| MraZ protein [Syntrophobacter fumaroxidans MPOB]
          Length = 150

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 54/137 (39%), Gaps = 2/137 (1%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F      ++D+KGR+ +P  FR +L       L   +      +     +  E  E K  
Sbjct: 6   FRGQSIHRLDAKGRLRIPTKFREVLQNHYTDALVITRMGE--CLLAYPPEEWEKIENKAR 63

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E++    +               + D++GRIL+  F+R    +  +V   G    F++WN
Sbjct: 64  EFSQVQPEHRAFMRYFISSAEECEFDNQGRILIPPFLREEANLTQDVLLAGVLTNFEIWN 123

Query: 124 PQTFRKLQEESRNEYCR 140
             T+    +  ++ Y +
Sbjct: 124 KSTWDAHIKLDKDSYQK 140


>gi|68535816|ref|YP_250521.1| cell division protein MraZ [Corynebacterium jeikeium K411]
 gi|91207190|sp|Q4JWA4|MRAZ_CORJK RecName: Full=Protein MraZ
 gi|68263415|emb|CAI36903.1| MraZ protein [Corynebacterium jeikeium K411]
          Length = 143

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  L +  +            +++V          +K 
Sbjct: 1   MFFGTFTPKLDDKGRLTLPAKFREELGEGLMVVK-----GQDRSLAVYPKAEFLVRAKKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE +  + +A      +        +DS+GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AEASRTNPKARAFVRNLAASADEQNLDSQGRISVSVMHRDYAGLTKECVVIGNVDFIEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +++     E   ++  
Sbjct: 116 DAESWADYSAEHEEDFSD 133


>gi|54023725|ref|YP_117967.1| cell division protein MraZ [Nocardia farcinica IFM 10152]
 gi|90103497|sp|Q5YYY8|MRAZ_NOCFA RecName: Full=Protein MraZ
 gi|54015233|dbj|BAD56603.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 143

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T ++D KGR+++P  FR  LA   +            +++V   +      ++ 
Sbjct: 1   MFLGTYTPRLDDKGRLTLPAKFRDDLAGGLMVTK-----GQDHSLAVYPKEEFTALARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + QA      +  G    + D++GRI ++   R +  +  +   +G  ++ ++W
Sbjct: 56  AAASRSNPQARAFVRALAAGTDEQRPDAQGRITLSADHRRYANLSRDCVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +     E   +Y +   +
Sbjct: 116 DKQAWESYLAEHEEDYAQARDE 137


>gi|313885069|ref|ZP_07818821.1| protein MraZ [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619760|gb|EFR31197.1| protein MraZ [Eremococcus coleocola ACS-139-V-Col8]
          Length = 143

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ +P  FR  L +R I             +    S   E  + K+
Sbjct: 1   MLIGEYKHNIDNKGRLIMPAKFRPDLGERFIVTRGL-----DGCLFGFPSKQWEDLQAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++       A   +   +     +++D +GRI + + +  F  IE E   +G  N  ++W
Sbjct: 56  SQLPLAKKDARAFTRFFYSAATEVELDKQGRINLPENLITFAKIEKECRVIGVSNRIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + +    +   +   + +
Sbjct: 116 SSAKWDEFANIAEENF-EMIAE 136


>gi|71909119|ref|YP_286706.1| cell division protein MraZ [Dechloromonas aromatica RCB]
 gi|91207191|sp|Q47A95|MRAZ_DECAR RecName: Full=Protein MraZ
 gi|71848740|gb|AAZ48236.1| Protein of unknown function UPF0040 [Dechloromonas aromatica RCB]
          Length = 148

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 56/140 (40%), Gaps = 1/140 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P   R  L       L          + +  S   +    +I
Sbjct: 1   MFEGAAALNLDAKGRLAIPARHRDALLAASEGSLVLT-AHPHRCLLLYPSPAWQPIRDQI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +    +A  +  ++ G     + DS GRIL+   +R +   E  V  VG G +F++W
Sbjct: 60  LKASSLDPRAASIKRVLVGNARTEEPDSAGRILIAPELREYAKFEKTVYLVGMGTHFEIW 119

Query: 123 NPQTFRKLQEESRNEYCRQL 142
           +   +++  + +       L
Sbjct: 120 SEAGWKQQNDLAAEALSGDL 139


>gi|119026128|ref|YP_909973.1| protein mraZ [Bifidobacterium adolescentis ATCC 15703]
 gi|118765712|dbj|BAF39891.1| protein mraZ [Bifidobacterium adolescentis ATCC 15703]
          Length = 171

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 28  LLLGTYTPKIDAKGRMALPAKFRSQLGS----GMVMARG-QERCVYLLPQSEFRRIAVQI 82

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +  + D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 83  QRTSMGNKAARDYLRVFLSGAVDQEPDKQGRVLVPQMLRDYANLGSDIVVIGVGTRAEIW 142

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q +     +    Y  
Sbjct: 143 NRQAWEDYLADKEQGYSD 160


>gi|312140151|ref|YP_004007487.1| mraz protein [Rhodococcus equi 103S]
 gi|325676967|ref|ZP_08156639.1| cell division protein MraZ [Rhodococcus equi ATCC 33707]
 gi|311889490|emb|CBH48807.1| MraZ protein [Rhodococcus equi 103S]
 gi|325552267|gb|EGD21957.1| cell division protein MraZ [Rhodococcus equi ATCC 33707]
          Length = 143

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      ++ 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTK-----GQDHSLAVYPREEFTAVARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + QA      +  G      D +GRI ++   R + G+  +   +G+  + ++W
Sbjct: 56  AAASRTNPQARAFVRGLASGTDEQHPDGQGRITLSADHRRYAGLSKDCVVIGQIEFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +     E    Y +   +
Sbjct: 116 DARAWESYLAEHEESYSQARDE 137


>gi|227504683|ref|ZP_03934732.1| cell division protein MraZ [Corynebacterium striatum ATCC 6940]
 gi|227198693|gb|EEI78741.1| cell division protein MraZ [Corynebacterium striatum ATCC 6940]
          Length = 144

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 54/133 (40%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREDLAGGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +  A      +       + D  GRI ++   R +  +  E   VG  ++ ++W
Sbjct: 56  AAVSRTNPDARAFIRNLAASADEQRPDGHGRITLSAAHREYANLSKECVVVGSVDFLEIW 115

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 116 DAAAWAEYQAQTE 128


>gi|188588710|ref|YP_001921595.1| cell division protein MraZ [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251779683|ref|ZP_04822603.1| MraZ protein [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|226709964|sp|B2V4W1|MRAZ_CLOBA RecName: Full=Protein MraZ
 gi|188498991|gb|ACD52127.1| MraZ protein [Clostridium botulinum E3 str. Alaska E43]
 gi|243083998|gb|EES49888.1| MraZ protein [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 142

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +DSK R+ VP   R  L ++ +             I     +     E K+
Sbjct: 1   MFIGEYQHSLDSKNRMIVPVKLREDLGEKFVITKGL-----DGCIYAYTINEWGILENKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   +++D +GR L+   ++ + GIE ++  +G  +  ++W
Sbjct: 56  KTLPLTNRDARAFVRFFFSGACIVELDKQGRGLIPQNLKEYAGIEKDIVSIGVLSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    E   +     + +K
Sbjct: 116 SREKWSNYNESDID--YDLIAEK 136


>gi|291542209|emb|CBL15319.1| mraZ protein [Ruminococcus bromii L2-63]
          Length = 139

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 53/135 (39%), Gaps = 6/135 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR+ +P  FR  L +      Y  + F    I V +S+      +KI
Sbjct: 1   MFSGMTNHSIDAKGRIVLPAKFREQLGE----TYYLARGFGNKCIQVMSSEQFNAMCEKI 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    +  +    +   + +  +++GR+++   +R F  IE +   +G  N  ++W
Sbjct: 57  LALPAN--LSMAVQYTFNATAVEVTPNAQGRVIIPQSLREFAEIEGDAVVIGMTNRLEIW 114

Query: 123 NPQTFRKLQEESRNE 137
           + + +          
Sbjct: 115 SKKNYEDYVASQNEN 129


>gi|298293109|ref|YP_003695048.1| MraZ domain protein [Starkeya novella DSM 506]
 gi|296929620|gb|ADH90429.1| MraZ domain protein [Starkeya novella DSM 506]
          Length = 159

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 77/137 (56%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RF+S    ++DSKGR+S+P  +R ++A+  +  LYC      PA+  G + L+   + 
Sbjct: 1   MDRFVSTYAMRLDSKGRMSIPAPYRALIARDGLEHLYCHPALDLPALQAGGARLMAGIDA 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I  Y P+S    +L+  ++G    +K+D EGR+++++ ++    I++E   VG G+ F+
Sbjct: 61  LIERYPPYSEAREELAGALYGAIEMIKLDPEGRVMLSEGLKAHAQIKDEAVLVGLGDSFR 120

Query: 121 LWNPQTFRKLQEESRNE 137
           +W P  FR    E+  +
Sbjct: 121 IWEPSRFRAHLAEANAK 137


>gi|319782839|ref|YP_004142315.1| MraZ domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168727|gb|ADV12265.1| MraZ domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 152

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 89/140 (63%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLSN   +ID+KGRVSVP  FR ++ +R  ++LY  +    PA+ VG  DLL+ +EQ
Sbjct: 1   MDRFLSNTVSRIDAKGRVSVPAHFRAVVQKRGYSELYALRCLDLPAMDVGGLDLLDRYEQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PF   A+ +S   HG G FLK+D +GRI M+DF+R  TGI  EV FVGRGN+FQ
Sbjct: 61  RIALEDPFLQTADDMSFFCHGDGTFLKLDQDGRITMSDFLREHTGISAEVAFVGRGNFFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P        ++R    +
Sbjct: 121 IWEPGRLAAYGAQARARLLQ 140


>gi|255325353|ref|ZP_05366459.1| MraZ protein [Corynebacterium tuberculostearicum SK141]
 gi|311741519|ref|ZP_07715343.1| cell division protein MraZ [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|255297918|gb|EET77229.1| MraZ protein [Corynebacterium tuberculostearicum SK141]
 gi|311303689|gb|EFQ79768.1| cell division protein MraZ [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 144

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 55/133 (41%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDELAGGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +       + D  GRI ++   R +  +  E   VG  ++ ++W
Sbjct: 56  AAVSRTNPEARAFIRNLAASADEQRPDGHGRITLSAGHREYANLSKECVVVGSVDFLEIW 115

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 116 DAAAWAEYQSQTE 128


>gi|184201137|ref|YP_001855344.1| cell division protein MraZ [Kocuria rhizophila DC2201]
 gi|226709988|sp|B2GJQ7|MRAZ_KOCRD RecName: Full=Protein MraZ
 gi|183581367|dbj|BAG29838.1| MraZ protein [Kocuria rhizophila DC2201]
          Length = 143

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D K R+ +P  FR  LA+     L   +      + V +++      +++
Sbjct: 1   MFLGTYEPRLDDKARLILPAKFRAELAE----GLVLTRG-QERCLYVFSAEEFARVHEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S QA     +   G      D +GRI +   +R + G++ E+  +G G+  ++W
Sbjct: 56  RSAPLSSKQARDYIRVFLSGASDEVPDKQGRITIPASLRSYAGLDRELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +++  +E    +  
Sbjct: 116 DAAAWQQYLQEKEAAFSE 133


>gi|148273049|ref|YP_001222610.1| cell division protein MraZ [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|170781759|ref|YP_001710091.1| cell division protein MraZ [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|167011871|sp|A5CS60|MRAZ_CLAM3 RecName: Full=Protein MraZ
 gi|189028612|sp|B0RI48|MRAZ_CLAMS RecName: Full=Protein MraZ
 gi|147830979|emb|CAN01924.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|169156327|emb|CAQ01475.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 143

 Score =  123 bits (310), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  FR  L       +   +      I V  +   E    ++
Sbjct: 1   MFLGTHSPRLDDKGRLILPAKFRDELE----GGVVMTRG-QDRCIYVFTTREFEELHDRM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S QA     +   G      D + RI +   +R + G++ E+  +G G+  ++W
Sbjct: 56  RQAPLASKQARDYMRVFLSGANAETPDKQHRITIPQALRTYAGLDRELAVIGAGSRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +  T+ +    + + +     +
Sbjct: 116 DAGTWDEYLTANESAFADTAEE 137


>gi|295092969|emb|CBK82060.1| mraZ protein [Coprococcus sp. ART55/1]
          Length = 150

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 63/147 (42%), Gaps = 7/147 (4%)

Query: 1   MSRFL-SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59
           MSR L      K+D+KGR+ +P   R+ L +  +             + V      E F 
Sbjct: 1   MSRCLSGEYEHKLDAKGRLIMPLKLRSELGESFMVTKGI-----DCCLYVYGMTEWEEFV 55

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +K+ +    +  A         G +  + D++GRIL++   R +  I+ +V  +G G   
Sbjct: 56  EKLNKLPMTNRTARAFKRGFLAGAVKCEPDAQGRILLSPKQREYAHIDKDVYVIGNGEKA 115

Query: 120 QLWNPQTFRKLQEESRNEY-CRQLLQK 145
           ++W+ + +   +  S N+    +L  +
Sbjct: 116 EIWSKEEWDGPENMSDNQASMDELADE 142


>gi|293402028|ref|ZP_06646167.1| MraZ protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304420|gb|EFE45670.1| MraZ protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 141

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 56/143 (39%), Gaps = 8/143 (5%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID KGR+ +P  FR  L       L   +      +S+   +  +   +++ +
Sbjct: 1   MGEYAHNIDKKGRIIIPAKFREELGD----TLIITRGL-DGCLSIYTKEQWQLIYEQLMK 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A     ++       ++D++GRIL+   +     +  E   +G  N+ ++W+ 
Sbjct: 56  LPSTKKDARMFVRMMTSKAAECEIDAQGRILIPSSLIKLADLTKECRIIGAANHVEIWSK 115

Query: 125 QTFRKLQEE---SRNEYCRQLLQ 144
           + +  L E+   +  E    L +
Sbjct: 116 ERWEPLDEDGDAAFEEIAENLTE 138


>gi|227833500|ref|YP_002835207.1| MraZ protein [Corynebacterium aurimucosum ATCC 700975]
 gi|227454516|gb|ACP33269.1| MraZ protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 186

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 54/133 (40%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 43  MFLGTYTPKLDDKGRLTLPAKFREELAGGLMVTK-----GQDHSLAVYPREEFAARARKA 97

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  +  A      +       + D  GRI ++   R +  +  E   VG  ++ ++W
Sbjct: 98  AAVSRTNPDARAFIRNLAASADEQRPDGHGRITLSAGHREYANLTKECVVVGSVDFLEIW 157

Query: 123 NPQTFRKLQEESR 135
           +   + + Q ++ 
Sbjct: 158 DAAAWAEYQAQTE 170


>gi|158522806|ref|YP_001530676.1| MraZ protein [Desulfococcus oleovorans Hxd3]
 gi|254813275|sp|A8ZXX2|MRAZ_DESOH RecName: Full=Protein MraZ
 gi|158511632|gb|ABW68599.1| MraZ protein [Desulfococcus oleovorans Hxd3]
          Length = 146

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 4/142 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F      +ID KGR+ +P  FR ++             FF   +     +     E K+
Sbjct: 1   MFRGTSYHRIDPKGRIVIPSRFRDLIGADG----TAMITFFEGGLYAYTLEEWSKIEAKM 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   Q  +      G     + D + R+L+   +R   G+E E+  +G  ++F++W
Sbjct: 57  VMLEKKGNQMRRFRRFFIGRASECQPDKQWRLLIPPELRQDAGLEEEIVLIGISDHFEIW 116

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + + +    ++   +  Q
Sbjct: 117 SRAKWEEQKNLHEDDMNDEDFQ 138


>gi|323144057|ref|ZP_08078701.1| protein MraZ [Succinatimonas hippei YIT 12066]
 gi|322416170|gb|EFY06860.1| protein MraZ [Succinatimonas hippei YIT 12066]
          Length = 160

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 55/142 (38%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D KGR++VP  +R IL   C  +    +  F P + +      E     +
Sbjct: 6   LLCGTSEIALDDKGRLAVPARYREILKDECCGECVITRSLFDPCLWLYPKTEWEIAAAAL 65

Query: 63  AEYNP-FSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +            L  L+ G  +++KMD + RIL+   +R    I  +   +G  N F+L
Sbjct: 66  SSLPSLTDELCRSLQRLLLGSAVYVKMDGQSRILLPQELRSAGSISKKAVLIGMQNKFEL 125

Query: 122 WNPQTFRKLQEESRNEYCRQLL 143
           W+ +  ++ +         +  
Sbjct: 126 WSEEILQQQRSRDIQMIADERA 147


>gi|167043611|gb|ABZ08305.1| putative domain of unknown function UPF0040 family protein
           [uncultured marine microorganism HF4000_APKG2M17]
          Length = 147

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 56/145 (38%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F       +D KGR+++P   R  L+          + F    I     D  +  E 
Sbjct: 1   MAGFKGQAEYSVDVKGRIAIPAKMRAALSPDAQGTFVLTKGF-EKCIYAYPQDNWKLKEA 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           + +  N  +  A  L  ++      + +D +GRI +   +  + GI  +   +G  +  +
Sbjct: 60  EYSALNINNRNARHLVRMILMWAEEVSLDGQGRISLPKPLSEYAGIGEKALIIGAMDRIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LW+P  F     E   +    L ++
Sbjct: 120 LWDPAAFENYLTEQSID-QETLAEQ 143


>gi|167754607|ref|ZP_02426734.1| hypothetical protein CLORAM_00109 [Clostridium ramosum DSM 1402]
 gi|167705439|gb|EDS20018.1| hypothetical protein CLORAM_00109 [Clostridium ramosum DSM 1402]
          Length = 141

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 58/140 (41%), Gaps = 6/140 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      ID+KGR+ +P   R      C   +   + F    +++   +    + QK+  
Sbjct: 1   MGEFRHNIDAKGRLIIPSKLREQ----CGESVVITRGF-DGCLALYTQEGWNDYYQKLQT 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                 +A     ++       + D  GR+ + + +R+   +E E   VG G++ ++WN 
Sbjct: 56  LPKTKREARNFVRIITSRASECEFDKLGRVNIPNVLRIEGKLEKECIIVGVGDHVEIWNQ 115

Query: 125 QTFRKLQEESRNEYCRQLLQ 144
             +    + +++ +  ++ +
Sbjct: 116 NIWDDYYDANKDNF-DEISE 134


>gi|269795583|ref|YP_003315038.1| mraZ protein [Sanguibacter keddieii DSM 10542]
 gi|269097768|gb|ACZ22204.1| mraZ protein [Sanguibacter keddieii DSM 10542]
          Length = 154

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 55/143 (38%), Gaps = 5/143 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S  L   T ++D KGR+ +P  FR  LA      L   +      + +   D      ++
Sbjct: 10  SLLLGTYTPRLDDKGRLLLPAKFRGQLA----PGLVMTRG-QERCLFLLPMDEFRRMYEQ 64

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I +    S QA     +   G      D +GRI +   +R + G++ EV  +G G   ++
Sbjct: 65  IRQAPVTSKQARDYLRVFLSGASDEMPDKQGRISIPSTLREYAGLDREVAVIGAGTRVEI 124

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           W+   +     E    Y     +
Sbjct: 125 WDAAAWETYLAEQVAGYSDTAEE 147


>gi|294085910|ref|YP_003552670.1| hypothetical protein SAR116_2343 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665485|gb|ADE40586.1| protein of unknown function UPF0040 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 160

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 2/138 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  FLS    +ID KGR+SVP  FR +L +R    LY ++    P +    S+ +     
Sbjct: 1   MDLFLSTFEHRIDKKGRLSVPAPFRAVLERRDDP-LYIYKSLTEPCLEGCGSERIGQIVD 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            I   +  S +   L   +      +K+DSEGRI+++     F  ++    + G G  FQ
Sbjct: 60  AIDTMDSLSEEVATLQ-TMLSSAQEMKLDSEGRIMLSADFIAFAALDESALYAGIGRSFQ 118

Query: 121 LWNPQTFRKLQEESRNEY 138
           +W P  +R  + ++RN  
Sbjct: 119 IWLPDRYRNRETDARNRA 136


>gi|209963955|ref|YP_002296870.1| cell division protein MraZ [Rhodospirillum centenum SW]
 gi|209957421|gb|ACI98057.1| cell division protein MraZ [Rhodospirillum centenum SW]
          Length = 163

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 69/139 (49%), Gaps = 3/139 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQ---RCITDLYCFQDFFFPAISVGNSDLLEY 57
           M+ FLS    K+D KGRVSVP  FRT L         +L  F+     A+   + D LE 
Sbjct: 1   MALFLSTYVNKVDKKGRVSVPAPFRTSLGHVTGGGPVELIVFRSLQANALDACSIDFLEQ 60

Query: 58  FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
               +   +      + +   V GG + L++D EGRI++ +    F GI   ++FVGR  
Sbjct: 61  LSLALDNPDMPEDLRDTIETTVFGGSVRLQIDPEGRIIIPEPYLEFAGIGESISFVGRRK 120

Query: 118 YFQLWNPQTFRKLQEESRN 136
            FQLW+P  F   + +SR+
Sbjct: 121 TFQLWDPAAFAAHEAQSRD 139


>gi|237785334|ref|YP_002906039.1| cell division protein MraZ [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259509648|sp|C4LI41|MRAZ_CORK4 RecName: Full=Protein MraZ
 gi|237758246|gb|ACR17496.1| MraZ protein [Corynebacterium kroppenstedtii DSM 44385]
          Length = 143

 Score =  123 bits (309), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 59/137 (43%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  LA+  +            ++++   ++     +K 
Sbjct: 1   MFFGTFTPKMDDKGRLTLPAKFRDELAEGLMVTK-----GQDHSLAIYPRNVFLERARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +        +D  GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AAASRTNPEARAFVRNLAASADEQSVDGHGRITISPDHRRYAGLSKECVVIGSVDFVEIW 115

Query: 123 NPQTFRKLQEESRNEYC 139
           N +++ + Q E    Y 
Sbjct: 116 NAESWNQYQAEHEESYA 132


>gi|254518687|ref|ZP_05130743.1| cell division protein MraZ [Clostridium sp. 7_2_43FAA]
 gi|226912436|gb|EEH97637.1| cell division protein MraZ [Clostridium sp. 7_2_43FAA]
          Length = 142

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 53/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+K R+ VP   R  L    +             +     +     E K+
Sbjct: 1   MFIGEYQHAIDAKNRMIVPVKLREGLGNNFVITKGL-----DGCLYAYPMEEWRALEVKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +  A         G   +++D +GR L+   ++ +  IE E+  +G     ++W
Sbjct: 56  KSLPLTNKDARAFVRFFFSGACEVEVDKQGRGLIPQNLKEYACIEKEIVSIGVLTRVEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
             + +++   ES  ++   + +K
Sbjct: 116 GKEKWQEY-NESDIDF-DSIAEK 136


>gi|114704931|ref|ZP_01437839.1| hypothetical protein FP2506_08341 [Fulvimarina pelagi HTCC2506]
 gi|114539716|gb|EAU42836.1| hypothetical protein FP2506_08341 [Fulvimarina pelagi HTCC2506]
          Length = 154

 Score =  123 bits (308), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 90/137 (65%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLS+ T  +D+KGR+SVP  +R +LA R I DL+  +D + P +++G S+L+ +FE 
Sbjct: 1   MDRFLSHFTHGVDTKGRISVPAAYRQVLASRGIRDLFTMRDLYLPVMNIGGSELMSHFES 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+   +PFS +  +L++L +G G +LK DSEGRI++ D IR  TGI ++ TFVG G  FQ
Sbjct: 61  KMETLDPFSQEYQELAILAYGDGTYLKTDSEGRIVINDLIRDHTGITDKATFVGVGKMFQ 120

Query: 121 LWNPQTFRKLQEESRNE 137
           LW P+ F +     R  
Sbjct: 121 LWRPEDFEEKLAALRER 137


>gi|260881845|ref|ZP_05405353.2| MraZ protein [Mitsuokella multacida DSM 20544]
 gi|260847817|gb|EEX67824.1| MraZ protein [Mitsuokella multacida DSM 20544]
          Length = 145

 Score =  123 bits (308), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 50/147 (34%), Gaps = 10/147 (6%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGRV +P  FR  L           +      + +      E    K+
Sbjct: 1   MFMGEYAHTIDAKGRVILPADFRQELG----VSFVITKGL-DKCLFLYGQQAWEELAAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIE--NEVTFVGRGNYFQ 120
                   +A  +      G   L+ D +GR L+   +R +  I     V   G  N  +
Sbjct: 56  RALPLAKPEARAIVRFFFSGARTLECDKQGRFLVPANLRAYADITLRQSVVLTGADNRIE 115

Query: 121 LWNPQTFRKLQEESRNE---YCRQLLQ 144
           +W+   + +  EE   +       L +
Sbjct: 116 VWSKDQWSRYNEEVEPDVTAIAASLAE 142


>gi|218886066|ref|YP_002435387.1| cell division protein MraZ [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226709969|sp|B8DP87|MRAZ_DESVM RecName: Full=Protein MraZ
 gi|218757020|gb|ACL07919.1| MraZ protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 149

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 60/142 (42%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F     + +D KGR+ +P  FR IL  R          F    +        E FE+K 
Sbjct: 2   LFRGRSHRSLDPKGRLMLPPDFRDILMSRAEGGKLVLTSFDD-CVMGYPLPDWEDFERKF 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +     S +      LV G    +++D +GR+ ++     + GI  +V  +G+G+ F++W
Sbjct: 61  STLKNPSRKMRDFRRLVIGSAELMELDGQGRVRISRSHMDYAGITKDVVLLGQGSRFEIW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   F  +  +  ++   +L  
Sbjct: 121 DQGRFDGIVTQDFDDVAAELAD 142


>gi|227548904|ref|ZP_03978953.1| cell division protein MraZ [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079032|gb|EEI16995.1| cell division protein MraZ [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 144

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 57/133 (42%), Gaps = 5/133 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFREDLADGLMVTK-----GQDHSLAVYPREEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +        +D  GRI ++   R +  +  E   +G  ++ ++W
Sbjct: 56  AAASRTNPKARAFIRNLAASADEQTLDGSGRITLSPAHREYAHLSKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESR 135
           + +++   Q+E+ 
Sbjct: 116 DAESWANYQQETE 128


>gi|282854267|ref|ZP_06263604.1| protein MraZ [Propionibacterium acnes J139]
 gi|289426271|ref|ZP_06428017.1| protein MraZ [Propionibacterium acnes SK187]
 gi|289426898|ref|ZP_06428624.1| protein MraZ [Propionibacterium acnes J165]
 gi|295130324|ref|YP_003580987.1| protein MraZ [Propionibacterium acnes SK137]
 gi|90103498|sp|Q6A9R1|MRAZ_PROAC RecName: Full=Protein MraZ
 gi|282583720|gb|EFB89100.1| protein MraZ [Propionibacterium acnes J139]
 gi|289153436|gb|EFD02151.1| protein MraZ [Propionibacterium acnes SK187]
 gi|289159987|gb|EFD08165.1| protein MraZ [Propionibacterium acnes J165]
 gi|291376104|gb|ADD99958.1| protein MraZ [Propionibacterium acnes SK137]
 gi|313764744|gb|EFS36108.1| protein MraZ [Propionibacterium acnes HL013PA1]
 gi|313772506|gb|EFS38472.1| protein MraZ [Propionibacterium acnes HL074PA1]
 gi|313791794|gb|EFS39905.1| protein MraZ [Propionibacterium acnes HL110PA1]
 gi|313802119|gb|EFS43351.1| protein MraZ [Propionibacterium acnes HL110PA2]
 gi|313807236|gb|EFS45723.1| protein MraZ [Propionibacterium acnes HL087PA2]
 gi|313809742|gb|EFS47463.1| protein MraZ [Propionibacterium acnes HL083PA1]
 gi|313813216|gb|EFS50930.1| protein MraZ [Propionibacterium acnes HL025PA1]
 gi|313815809|gb|EFS53523.1| protein MraZ [Propionibacterium acnes HL059PA1]
 gi|313818282|gb|EFS55996.1| protein MraZ [Propionibacterium acnes HL046PA2]
 gi|313820044|gb|EFS57758.1| protein MraZ [Propionibacterium acnes HL036PA1]
 gi|313823147|gb|EFS60861.1| protein MraZ [Propionibacterium acnes HL036PA2]
 gi|313825576|gb|EFS63290.1| protein MraZ [Propionibacterium acnes HL063PA1]
 gi|313827815|gb|EFS65529.1| protein MraZ [Propionibacterium acnes HL063PA2]
 gi|313830651|gb|EFS68365.1| protein MraZ [Propionibacterium acnes HL007PA1]
 gi|313833871|gb|EFS71585.1| protein MraZ [Propionibacterium acnes HL056PA1]
 gi|313838451|gb|EFS76165.1| protein MraZ [Propionibacterium acnes HL086PA1]
 gi|314915235|gb|EFS79066.1| protein MraZ [Propionibacterium acnes HL005PA4]
 gi|314918536|gb|EFS82367.1| protein MraZ [Propionibacterium acnes HL050PA1]
 gi|314919799|gb|EFS83630.1| protein MraZ [Propionibacterium acnes HL050PA3]
 gi|314923255|gb|EFS87086.1| protein MraZ [Propionibacterium acnes HL001PA1]
 gi|314925466|gb|EFS89297.1| protein MraZ [Propionibacterium acnes HL036PA3]
 gi|314931814|gb|EFS95645.1| protein MraZ [Propionibacterium acnes HL067PA1]
 gi|314955970|gb|EFT00368.1| protein MraZ [Propionibacterium acnes HL027PA1]
 gi|314958365|gb|EFT02468.1| protein MraZ [Propionibacterium acnes HL002PA1]
 gi|314960283|gb|EFT04385.1| protein MraZ [Propionibacterium acnes HL002PA2]
 gi|314963092|gb|EFT07192.1| protein MraZ [Propionibacterium acnes HL082PA1]
 gi|314967022|gb|EFT11121.1| protein MraZ [Propionibacterium acnes HL082PA2]
 gi|314968073|gb|EFT12172.1| protein MraZ [Propionibacterium acnes HL037PA1]
 gi|314973653|gb|EFT17749.1| protein MraZ [Propionibacterium acnes HL053PA1]
 gi|314976246|gb|EFT20341.1| protein MraZ [Propionibacterium acnes HL045PA1]
 gi|314978269|gb|EFT22363.1| protein MraZ [Propionibacterium acnes HL072PA2]
 gi|314980978|gb|EFT25072.1| protein MraZ [Propionibacterium acnes HL110PA3]
 gi|314983545|gb|EFT27637.1| protein MraZ [Propionibacterium acnes HL005PA1]
 gi|314987733|gb|EFT31824.1| protein MraZ [Propionibacterium acnes HL005PA2]
 gi|314990212|gb|EFT34303.1| protein MraZ [Propionibacterium acnes HL005PA3]
 gi|315077556|gb|EFT49614.1| protein MraZ [Propionibacterium acnes HL053PA2]
 gi|315080340|gb|EFT52316.1| protein MraZ [Propionibacterium acnes HL078PA1]
 gi|315084599|gb|EFT56575.1| protein MraZ [Propionibacterium acnes HL027PA2]
 gi|315085935|gb|EFT57911.1| protein MraZ [Propionibacterium acnes HL002PA3]
 gi|315088647|gb|EFT60623.1| protein MraZ [Propionibacterium acnes HL072PA1]
 gi|315091637|gb|EFT63613.1| protein MraZ [Propionibacterium acnes HL110PA4]
 gi|315093057|gb|EFT65033.1| protein MraZ [Propionibacterium acnes HL060PA1]
 gi|315096273|gb|EFT68249.1| protein MraZ [Propionibacterium acnes HL038PA1]
 gi|315098256|gb|EFT70232.1| protein MraZ [Propionibacterium acnes HL059PA2]
 gi|315101053|gb|EFT73029.1| protein MraZ [Propionibacterium acnes HL046PA1]
 gi|315103169|gb|EFT75145.1| protein MraZ [Propionibacterium acnes HL050PA2]
 gi|315107069|gb|EFT79045.1| protein MraZ [Propionibacterium acnes HL030PA1]
 gi|315108245|gb|EFT80221.1| protein MraZ [Propionibacterium acnes HL030PA2]
 gi|327325909|gb|EGE67699.1| MraZ protein [Propionibacterium acnes HL096PA2]
 gi|327327842|gb|EGE69618.1| MraZ protein [Propionibacterium acnes HL103PA1]
 gi|327330607|gb|EGE72353.1| MraZ protein [Propionibacterium acnes HL097PA1]
 gi|327332218|gb|EGE73955.1| MraZ protein [Propionibacterium acnes HL096PA3]
 gi|327442840|gb|EGE89494.1| protein MraZ [Propionibacterium acnes HL013PA2]
 gi|327446211|gb|EGE92865.1| protein MraZ [Propionibacterium acnes HL043PA2]
 gi|327447806|gb|EGE94460.1| protein MraZ [Propionibacterium acnes HL043PA1]
 gi|327451062|gb|EGE97716.1| protein MraZ [Propionibacterium acnes HL087PA3]
 gi|327452856|gb|EGE99510.1| protein MraZ [Propionibacterium acnes HL092PA1]
 gi|327453583|gb|EGF00238.1| protein MraZ [Propionibacterium acnes HL083PA2]
 gi|328753095|gb|EGF66711.1| protein MraZ [Propionibacterium acnes HL087PA1]
 gi|328753750|gb|EGF67366.1| protein MraZ [Propionibacterium acnes HL020PA1]
 gi|328759160|gb|EGF72776.1| protein MraZ [Propionibacterium acnes HL025PA2]
 gi|328760594|gb|EGF74162.1| MraZ protein [Propionibacterium acnes HL099PA1]
          Length = 142

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 55/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR  +P  FR  L       L   +      +++  ++      ++I
Sbjct: 1   MFLGTHTPKLDEKGRFFLPAKFRDELDD----GLVITRG-QDRCLAIYPTETFVEMTREI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+ +    +      ++  G      D +GR+++   +R +  +  E+  VG     ++W
Sbjct: 56  AKGSVSVKKVRDYQRMLAAGASDTAPDKQGRVMIPPMLRRYAALNKEIVVVGAITRVEVW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + K  E     +     +
Sbjct: 116 DATEWEKYSEAQEEAFADMNEE 137


>gi|224368375|ref|YP_002602538.1| MraZ [Desulfobacterium autotrophicum HRM2]
 gi|259509651|sp|C0Q8N4|MRAZ_DESAH RecName: Full=Protein MraZ
 gi|223691091|gb|ACN14374.1| MraZ [Desulfobacterium autotrophicum HRM2]
          Length = 146

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 4/126 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F ++    ID KGR+ VP  FR  +       +         A+     +  +  E+KI
Sbjct: 1   MFRASSFHTIDPKGRIIVPARFRDDIRAGGADGVMV--SILDKALYAYTFNEWQAIEKKI 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  S    +      G       D +GRIL+   IR + G+E E+  VG  ++F++W
Sbjct: 59  --LSAKSEPMRRFKRFFLGNACECLCDKQGRILIPPSIRAYAGLEKEIVLVGMLDHFEIW 116

Query: 123 NPQTFR 128
           + + + 
Sbjct: 117 SREQWD 122


>gi|227824962|ref|ZP_03989794.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226905461|gb|EEH91379.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 145

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 58/139 (41%), Gaps = 5/139 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           +  +      +D+KGR+ VP   R+ L +  +             I V   D  +  +Q 
Sbjct: 5   AMLMGEYEHSVDAKGRLFVPAKLRSELGKTFVITKGV-----DGCIDVYPMDAWDRLQQS 59

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            A+      +A  +S  + G  + ++ D +GRIL+   +R F  IE   T +G G   ++
Sbjct: 60  FAQQTLPKKKARDVSRFLFGNSMEVEPDKQGRILLPQTLRKFAQIEGLATIIGTGTKAEI 119

Query: 122 WNPQTFRKLQEESRNEYCR 140
           W+ + +     E  ++   
Sbjct: 120 WDTKRYEAYSSEVESDVAA 138


>gi|260462081|ref|ZP_05810325.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031941|gb|EEW33208.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 152

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 90/140 (64%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLSN   +ID+KGRVSVP  FR ++ +R  ++LY  +    PA+ VG  DLL+ +EQ
Sbjct: 1   MDRFLSNTVSRIDAKGRVSVPAHFRAVVQKRGYSELYALRCLDLPAMDVGGLDLLDRYEQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  NPF   A+ +S   HG G FLK+D +GRI MTDFIR  TGI  EVTFVGRGN+FQ
Sbjct: 61  RIALENPFLQTADDMSFFCHGDGAFLKLDQDGRITMTDFIREHTGISAEVTFVGRGNFFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P        ++R    +
Sbjct: 121 IWEPGRLAAYGAQARARLLQ 140


>gi|313837466|gb|EFS75180.1| protein MraZ [Propionibacterium acnes HL037PA2]
 gi|314929324|gb|EFS93155.1| protein MraZ [Propionibacterium acnes HL044PA1]
 gi|314971673|gb|EFT15771.1| protein MraZ [Propionibacterium acnes HL037PA3]
          Length = 160

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 56/141 (39%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T K+D KGR  +P  FR  L       L   +      +++  ++      ++IA
Sbjct: 20  FLGTHTPKLDEKGRFFLPAKFRDELDD----GLVITRG-QDRCLAIYPTETFVEMTREIA 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           + +    +      ++  G      D +GR+++   +R + G+  E+  VG     ++W+
Sbjct: 75  KGSVSVKKVRDYQRMLAAGASDTAPDKQGRVMIPPMLRRYAGLNKEIVVVGAITRVEVWD 134

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
              + K  E     +     +
Sbjct: 135 ATEWEKYSETQEEAFADMNEE 155


>gi|15827425|ref|NP_301688.1| cell division protein MraZ [Mycobacterium leprae TN]
 gi|221229902|ref|YP_002503318.1| cell division protein MraZ [Mycobacterium leprae Br4923]
 gi|6648044|sp|O69561|MRAZ_MYCLE RecName: Full=Protein MraZ
 gi|254813287|sp|B8ZQP1|MRAZ_MYCLB RecName: Full=Protein MraZ
 gi|3080482|emb|CAA18677.1| hypothetical protein MLCB268.11c [Mycobacterium leprae]
 gi|13092975|emb|CAC31286.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219933009|emb|CAR71000.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 143

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  L    +  L   +     +++V      E   ++ 
Sbjct: 1   MFLGTHTPKLDDKGRLTLPAKFRDAL----VGGLMVTKS-QDHSLAVYPRAEFEQLARRA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +  + +A      +  G      D +GRI ++   R +  +  +   +G  +Y ++W
Sbjct: 56  SKMSRSNPEARAFLRNLAAGTDEQHPDMQGRITLSADHRRYANLSKDCVVIGAVDYLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q +   Q+     +  
Sbjct: 116 DAQAWHDYQQTHEENFSA 133


>gi|312880227|ref|ZP_07740027.1| MraZ protein [Aminomonas paucivorans DSM 12260]
 gi|310783518|gb|EFQ23916.1| MraZ protein [Aminomonas paucivorans DSM 12260]
          Length = 146

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 58/145 (40%), Gaps = 6/145 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M   +     ++DSKGR+ +P  FR  L  + +  +          +++ +        +
Sbjct: 4   MGVLVGTFDHRMDSKGRMVLPARFREELGNQVVATIGI-----DRCVALYSLPNWHRLLE 58

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+        +      ++      +  DS GRIL+  F+R    I+ EV  +G G++ +
Sbjct: 59  KLQNLPMSKGRTRDFLRVLLASATEMDFDSMGRILLPQFLRQHGDIKQEVAVIGVGDHLE 118

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   +   + E        + ++
Sbjct: 119 IWDSSNWTIHRGEILEALPS-IAEE 142


>gi|218679273|ref|ZP_03527170.1| cell division protein MraZ [Rhizobium etli CIAT 894]
          Length = 149

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 112/137 (81%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR + +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 5   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNVQELYCFQDFVFPAISVGGPDLLERFER 64

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGGIF+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 65  QIAAEDPFSPDANEMSLLIHGGGIFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 124

Query: 121 LWNPQTFRKLQEESRNE 137
           LW PQ F   Q  +R E
Sbjct: 125 LWQPQAFVAAQAHARGE 141


>gi|171742508|ref|ZP_02918315.1| hypothetical protein BIFDEN_01620 [Bifidobacterium dentium ATCC
           27678]
 gi|171278122|gb|EDT45783.1| hypothetical protein BIFDEN_01620 [Bifidobacterium dentium ATCC
           27678]
          Length = 179

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 36  LLLGTYTPKIDAKGRMALPAKFRSQLG----PGMVMARG-QERCVYLLPQMEFRRIAMQI 90

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +    D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 91  QRTSMGNKAAREYLRVFLSGAVDQDPDKQGRVLVPQMLRDYANLGSDIVVIGVGTRAEIW 150

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q + +   +    Y  
Sbjct: 151 NRQAWEEYLADKEQGYSD 168


>gi|222151000|ref|YP_002560153.1| hypothetical protein MCCL_0750 [Macrococcus caseolyticus JCSC5402]
 gi|254813284|sp|B9EB46|MRAZ_MACCJ RecName: Full=Protein MraZ
 gi|222120122|dbj|BAH17457.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 143

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 51/128 (39%), Gaps = 5/128 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+     ++D+KGR+ VP  FR  L +  +             +           E+K+
Sbjct: 1   MFMGEFQHQLDAKGRMIVPAKFREELTEHFVITRGL-----DKCLFGYTLTEWAAIEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A +   +   G + ++MD +GRI +   +  + G+  E T +G  +  ++W
Sbjct: 56  KALPLTRRDARKFMRMFFSGAVEVEMDKQGRINIPKHLMEYAGLSKEATVIGVSSRIEIW 115

Query: 123 NPQTFRKL 130
           + + +   
Sbjct: 116 DRKLWSDF 123


>gi|323440950|gb|EGA98657.1| cell division protein MraZ [Staphylococcus aureus O11]
 gi|323442267|gb|EGA99897.1| cell division protein MraZ [Staphylococcus aureus O46]
          Length = 141

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 54/125 (43%), Gaps = 5/125 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +     ++D+KGR+ +P  FR  L +R I             +     D  +  E+K+  
Sbjct: 1   MGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGL-----DKCLFGYTLDEWQQIEEKMKT 55

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                  A +   +   G + +++D +GRI +   +R +  +  E T +G  N  ++W+ 
Sbjct: 56  LPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDR 115

Query: 125 QTFRK 129
           +T+  
Sbjct: 116 ETWND 120


>gi|227497581|ref|ZP_03927804.1| cell division protein MraZ [Actinomyces urogenitalis DSM 15434]
 gi|226832950|gb|EEH65333.1| cell division protein MraZ [Actinomyces urogenitalis DSM 15434]
          Length = 146

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 54/141 (38%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL     ++D KGR+ +P  FR  LA      +   +      +    +   E    ++ 
Sbjct: 5   FLGTHAPRLDDKGRLILPAKFREELA----GGVVLTRG-QEHCLYAFTTAEFERMYAQLR 59

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E      QA     ++  G      D +GRI +   +R + G+  ++  +G G   ++W+
Sbjct: 60  EAPLAQKQARDYIRVMLSGADSQIPDKQGRITLPAPLRAYAGLSKDLAVIGAGARVEIWD 119

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            Q ++   E     +     +
Sbjct: 120 AQAWQTYLEAQEQVFADTAEE 140


>gi|254994048|ref|ZP_05276238.1| cell division protein MraZ [Listeria monocytogenes FSL J2-064]
          Length = 117

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 45/122 (36%), Gaps = 5/122 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ VP  FR +L    +             +     +  +  E+K+
Sbjct: 1   MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGL-----DKCLFAYPQEEWKKLEEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                    A   +     G    ++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  QTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETVIIGVSSRIEIW 115

Query: 123 NP 124
           + 
Sbjct: 116 SK 117


>gi|332704510|ref|ZP_08424598.1| Protein mraZ [Desulfovibrio africanus str. Walvis Bay]
 gi|332554659|gb|EGJ51703.1| Protein mraZ [Desulfovibrio africanus str. Walvis Bay]
          Length = 149

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 1/129 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F     + ID+KGR+ +P  FR  +            + +  AIS       E  E K+
Sbjct: 1   MFRGRSLRNIDAKGRLMIPPEFRDQVIAAAPEGKLVLTN-YDEAISCYPLSAWEEIELKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++     ++         GG   + +DS+GRIL+   +R + G++ E+  VG G  F++W
Sbjct: 60  SQLKNPPLKVRTFLRFFLGGAQEVTLDSQGRILVPPTLREYAGLDKELYLVGMGVKFEIW 119

Query: 123 NPQTFRKLQ 131
           +     +  
Sbjct: 120 DKSRHDEQI 128


>gi|283456405|ref|YP_003360969.1| mraZ Cell division protein mraZ [Bifidobacterium dentium Bd1]
 gi|306822421|ref|ZP_07455799.1| cell division protein MraZ [Bifidobacterium dentium ATCC 27679]
 gi|309802484|ref|ZP_07696590.1| protein MraZ [Bifidobacterium dentium JCVIHMP022]
 gi|283103039|gb|ADB10145.1| mraZ Cell division protein mraZ [Bifidobacterium dentium Bd1]
 gi|304553966|gb|EFM41875.1| cell division protein MraZ [Bifidobacterium dentium ATCC 27679]
 gi|308220884|gb|EFO77190.1| protein MraZ [Bifidobacterium dentium JCVIHMP022]
          Length = 171

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P  FR+ L       +   +      + +           +I
Sbjct: 28  LLLGTYTPKIDAKGRMALPAKFRSQLG----PGMVMARG-QERCVYLLPQMEFRRIAMQI 82

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G +    D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 83  QRTSMGNKAAREYLRVFLSGAVDQDPDKQGRVLVPQMLRDYANLGSDIVVIGVGTRAEIW 142

Query: 123 NPQTFRKLQEESRNEYCR 140
           N Q + +   +    Y  
Sbjct: 143 NRQAWEEYLADKEQGYSD 160


>gi|118594402|ref|ZP_01551749.1| hypothetical protein MB2181_02000 [Methylophilales bacterium
           HTCC2181]
 gi|118440180|gb|EAV46807.1| hypothetical protein MB2181_02000 [Methylophilales bacterium
           HTCC2181]
          Length = 148

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 67/143 (46%), Gaps = 1/143 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            +       +D K RV++P  +R +L       +          + +      E  + K+
Sbjct: 1   MYRGATLLNLDGKSRVAIPTKYREVLMHESSGSIVIT-AHPHGCLLLYPKSAWEPIQNKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +++ F  +++ L  L+ G    + +D+ GR+L++  +R ++ I+  +  VG+G++F+LW
Sbjct: 60  MKFSSFDKKSSGLQRLLVGYAEDVNIDASGRLLISSELRTYSNIDKTLMLVGQGSHFELW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + + K   +       +L ++
Sbjct: 120 SQELWEKEINQININETNELPEE 142


>gi|317132993|ref|YP_004092307.1| MraZ protein [Ethanoligenens harbinense YUAN-3]
 gi|315470972|gb|ADU27576.1| MraZ protein [Ethanoligenens harbinense YUAN-3]
          Length = 139

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGRV +P   R  L +  I             + V +       E +I
Sbjct: 1   MLIGKYQHNIDAKGRVFIPARLREDLGEHFILTKGL-----ENCLYVYSETEWGVLEARI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                      QL      G   ++ D +GRI++   +R + G+E+E   +G     ++W
Sbjct: 56  RALPFSK--GRQLQRFFFAGACDVEADKQGRIVLPADLRAYAGLEHEAVIIGASTRAEIW 113

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    E    E   Q +++
Sbjct: 114 DSKRWETACEAITPETVEQAMEE 136


>gi|303246298|ref|ZP_07332578.1| MraZ protein [Desulfovibrio fructosovorans JJ]
 gi|302492361|gb|EFL52233.1| MraZ protein [Desulfovibrio fructosovorans JJ]
          Length = 168

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 58/143 (40%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S F  +  + +D KGR+ +P  +R  + +          + F  A++       E  E  
Sbjct: 16  SVFRGHSYRSLDPKGRLMLPPEYREEVLRLVPEGRIMLTNNFDGAVTGYPMPAWEEVEAS 75

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
               N    +   L      G + + +D +GRIL+  ++R F  ++ E+   G G  F++
Sbjct: 76  FQAGNKLDPRIRDLERFYISGAMEVSLDKQGRILIPPYLRTFAQLDKELVLAGVGEKFEI 135

Query: 122 WNPQTFRKLQEESRNEYCRQLLQ 144
           WN   F + + +    +   L  
Sbjct: 136 WNQAAFEERRRQVGLRFDADLAD 158


>gi|227538293|ref|ZP_03968342.1| cell division protein MraZ [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300774257|ref|ZP_07084124.1| cell division protein MraZ [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227241808|gb|EEI91823.1| cell division protein MraZ [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300758936|gb|EFK55765.1| cell division protein MraZ [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 157

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 58/145 (40%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+  +     K+D+KGR+ +P   +  L       L   + F    +     +       
Sbjct: 1   MNHLIGEFECKLDTKGRMVLPAALKRQLPHVERDGLVVNRGF-EKHLVFYTREEWNTITA 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+++ N F+ ++         G   L +D+ GR+L+   +  +  I  EV    + N  +
Sbjct: 60  KLSKLNQFNEKSRMFVRAFTRGATELTLDASGRVLLPKGLLEYANIGAEVVLACQFNKIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+ + +  L  +   +    L ++
Sbjct: 120 VWSKEGYEALMNDGLGDDFAALAEE 144


>gi|217967642|ref|YP_002353148.1| MraZ protein [Dictyoglomus turgidum DSM 6724]
 gi|226709971|sp|B8E089|MRAZ_DICTD RecName: Full=Protein MraZ
 gi|217336741|gb|ACK42534.1| MraZ protein [Dictyoglomus turgidum DSM 6724]
          Length = 146

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 65/144 (45%), Gaps = 6/144 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ VP  FR +L +      Y  + F    +++        F + I
Sbjct: 1   MFVGEYYHSLDEKGRLIVPNNFRQLLGE----TFYLTRGF-ERCLNIYTITDWNNFSEII 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           + ++P      +L      G + +  D  GRIL+  F+  +  +  +V  +G G + ++W
Sbjct: 56  SSFSPTDDLMRRLCRFWFSGSVQVTTDKLGRILIPSFLIDYAELYKDVVIIGAGRHIEIW 115

Query: 123 NPQTFRKL-QEESRNEYCRQLLQK 145
             + + +  +EE+  E  +++ +K
Sbjct: 116 AKERWEEFNKEENILESMKEINEK 139


>gi|229817310|ref|ZP_04447592.1| hypothetical protein BIFANG_02571 [Bifidobacterium angulatum DSM
           20098]
 gi|229785099|gb|EEP21213.1| hypothetical protein BIFANG_02571 [Bifidobacterium angulatum DSM
           20098]
          Length = 181

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L   T KID+KGR+++P   R+         L   +      + +           +I
Sbjct: 38  LLLGTYTPKIDAKGRMALPAKMRSQFG----NGLVMARG-QEHCVYLLPGMEFRRIAMQI 92

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A +   +   G      D +GR+L+   +R +  + +++  +G G   ++W
Sbjct: 93  QRTSMVNKAAREYLRVFLSGASDQTPDRQGRVLVPQILRDYADLGDDIVVIGVGTRAEIW 152

Query: 123 NPQTFRKLQEESRNEYCR 140
           N + + +    +   Y  
Sbjct: 153 NRRAWEEYLANTEQNYAD 170


>gi|229822999|ref|ZP_04449069.1| hypothetical protein GCWU000282_00292 [Catonella morbi ATCC 51271]
 gi|229787812|gb|EEP23926.1| hypothetical protein GCWU000282_00292 [Catonella morbi ATCC 51271]
          Length = 154

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 57/141 (40%), Gaps = 6/141 (4%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            +      ID+KGR+++P  FR  L  + +             +     +     E+K+ 
Sbjct: 13  LIGEFQHNIDAKGRLTMPAKFRPELGGQFVVTRGL-----DGCLFGYPMENWALQEEKLK 67

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           + N     A Q +   +     +++D +GRI +   +  +  I+ E   +G  +  ++W+
Sbjct: 68  KLNLMKKDARQFARFFYSAATEVEIDKQGRINLPQTLLDYAKIDKECRVIGVSDRIEIWS 127

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            + + +   ++   Y   + +
Sbjct: 128 SERWDEFVGDAEENY-EAIAE 147


>gi|163752985|ref|ZP_02160109.1| mraZ protein [Kordia algicida OT-1]
 gi|161326717|gb|EDP98042.1| mraZ protein [Kordia algicida OT-1]
          Length = 155

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M   +     K+D+KGR+ VP   +  L+          +  F   + +          Q
Sbjct: 1   MINLIGTYECKVDAKGRMLVPADLKKQLSPILQEGFVIKEGLFGSCLELHPMSEWNVVTQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+ + N F  +          G   +++D+ GR+L+   + VF GI+ E+      N  +
Sbjct: 61  KLNKLNRFKKKNVDFIRRFSKGVRMVEIDAAGRLLIPKDLVVFAGIKKEIVLSSAINIVE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+ + +    ++S  +    L ++
Sbjct: 121 IWDKEQYNTATDDSAVDIGD-LAEE 144


>gi|291544486|emb|CBL17595.1| mraZ protein [Ruminococcus sp. 18P13]
          Length = 138

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 5   LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE 64
           +      +D+KGRVS P   R IL +      Y  +      ++V   +  E    K+A+
Sbjct: 1   MGEYLHNMDAKGRVSFPTKLREILGE----TFYVTKTIDKHCLTVYPQEEWEKLSNKVAQ 56

Query: 65  YNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124
                    +   ++  G   L  D +GR+L+   +R + G++ +V  +G  N  ++W+ 
Sbjct: 57  LPQAKSANIR--RVLFSGAGELNPDKQGRVLIPQHLREYAGLDKDVMVIGACNVAEIWDK 114

Query: 125 QTFRKL 130
             +   
Sbjct: 115 AAWDDF 120


>gi|206900302|ref|YP_002250980.1| MraZ protein [Dictyoglomus thermophilum H-6-12]
 gi|226709970|sp|B5YEM2|MRAZ_DICT6 RecName: Full=Protein MraZ
 gi|206739405|gb|ACI18463.1| MraZ protein [Dictyoglomus thermophilum H-6-12]
          Length = 146

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 59/142 (41%), Gaps = 7/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR+ +P  FR +L +      Y  + F    +++        F Q I
Sbjct: 1   MFVGEYYHSLDEKGRLIIPNDFRQLLGE----TFYLTRGF-ERCLNIYTITDWNNFSQII 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           + ++P      +L      G I +  D  GRIL+  F+  +  +  EV  +G G + ++W
Sbjct: 56  SSFSPTDNLMRKLCRFWFSGSIQVTTDKLGRILIPSFLIEYAELSKEVVIIGAGKHIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             + + +  +E        + +
Sbjct: 116 AKEKWEEFNKE--ENILENMNE 135


>gi|114777871|ref|ZP_01452802.1| hypothetical protein SPV1_00445 [Mariprofundus ferrooxydans PV-1]
 gi|114551862|gb|EAU54402.1| hypothetical protein SPV1_00445 [Mariprofundus ferrooxydans PV-1]
          Length = 142

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 49/133 (36%), Gaps = 3/133 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILA-QRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
            F    +  +D KGRVSVP  FR +L        +   +    P +    +      +  
Sbjct: 1   MFQGEFSNNMDDKGRVSVPAAFRDVLNTCHADGKIVITRSHNTPCLIAYPTREWNRLQAA 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           I +      +       V         D +GR+L+   +R    +   V F G G  F++
Sbjct: 61  IKDMPANLKRN--FIRAVITPSQVFTPDKQGRVLLAGVLREHASLSRSVHFAGTGETFEI 118

Query: 122 WNPQTFRKLQEES 134
           W+ +++ K  E  
Sbjct: 119 WDKESWDKQLEAD 131


>gi|332675166|gb|AEE71982.1| cell division protein MraZ [Propionibacterium acnes 266]
          Length = 160

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 55/141 (39%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T K+D KGR  +P  FR  L       L   +      +++  ++      ++IA
Sbjct: 20  FLGTHTPKLDEKGRFFLPAKFRDELDD----GLVITRG-QDRCLAIYPTETFVEMTREIA 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           + +    +      ++  G      D +GR+++   +R +  +  E+  VG     ++W+
Sbjct: 75  KGSVSVKKVRDYQRMLAAGASDTAPDKQGRVMIPPMLRRYAALNKEIVVVGAITRVEVWD 134

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
              + K  E     +     +
Sbjct: 135 ATEWEKYSEAQEEAFADMNEE 155


>gi|269792474|ref|YP_003317378.1| MraZ protein [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100109|gb|ACZ19096.1| MraZ protein [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 141

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 60/138 (43%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +     ++DSKGRV +P  FR  L +  I  +        P +S+      E    ++
Sbjct: 1   MLVGTHEHRVDSKGRVVLPSRFREGLGEELIATVGI-----DPCVSIYGLGGWEGLFNRL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +        L  L+    + ++ DS GR+L+  ++R    I  +V  +G G++ ++W
Sbjct: 56  SSLSSSRASHRDLKRLLMASAVQVEPDSMGRLLVPSYLREHAKITRDVYIIGVGDHVEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + + +    +E   
Sbjct: 116 DREEWDRRRARLMDELPS 133


>gi|317506605|ref|ZP_07964397.1| MraZ protein [Segniliparus rugosus ATCC BAA-974]
 gi|316255114|gb|EFV14392.1| MraZ protein [Segniliparus rugosus ATCC BAA-974]
          Length = 147

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 65/139 (46%), Gaps = 5/139 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + FL   T ++D KGR+++P  FR  LA      L   +     +++V   D      +K
Sbjct: 4   AMFLGTYTPRLDDKGRLTLPAKFREALA----GGLVVTKGP-DRSLAVYPRDHFADLARK 58

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            A  +  + QA         G    + D++GR++++   R + G+  +    G  ++ ++
Sbjct: 59  AAAASRSNPQARAFVRSFAAGADEQRPDAQGRVVLSSDHRNYAGLARDCVVNGAIDFLEI 118

Query: 122 WNPQTFRKLQEESRNEYCR 140
           W+ QT+++  EE+   Y +
Sbjct: 119 WDAQTWQQYAEENEESYVQ 137


>gi|288574843|ref|ZP_06393200.1| MraZ protein [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570584|gb|EFC92141.1| MraZ protein [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 140

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL +   KID KGR+ +P  FR +L    +  +          ++V   D  + F  + 
Sbjct: 1   MFLGSYDHKIDDKGRMILPSRFRNVLGSPIVCTVGI-----ERCMAVYPLDSWQTFVARF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E      ++     ++      +  D  GRIL++  +R +  ++ +V+ +G  ++ ++W
Sbjct: 56  DELPFSKEKSRNFKRVLFSMADEITPDKTGRILISPSLRCYGELKEDVSVIGVEDHIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +   +     +  + + +
Sbjct: 116 DRARWNDRRSTLLGDLGKMIEE 137


>gi|111018110|ref|YP_701082.1| cell division protein MraZ [Rhodococcus jostii RHA1]
 gi|123340962|sp|Q0SHR2|MRAZ_RHOSR RecName: Full=Protein MraZ
 gi|110817640|gb|ABG92924.1| possible protein MraZ [Rhodococcus jostii RHA1]
          Length = 143

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDEKGRLTLPAKFRDALAGGLMVTK-----GQDHSLAVYPREEFTALARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +    +A      +  G      D++GRI ++   R + G+  +   +G  ++ ++W
Sbjct: 56  AAASRSDPEARAFVRGLAAGTDEQHADAQGRITLSADHRRYAGLSKDCVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++   E +   Y +
Sbjct: 116 DAQAWQTYVEANEENYSQ 133


>gi|328952339|ref|YP_004369673.1| Protein mraZ [Desulfobacca acetoxidans DSM 11109]
 gi|328452663|gb|AEB08492.1| Protein mraZ [Desulfobacca acetoxidans DSM 11109]
          Length = 144

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 56/143 (39%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D KGR+++P  +R IL +R    L          +        E  EQ++
Sbjct: 1   MFRGRFFHVMDDKGRITIPPRYREILQERTDRHLIVTN--LDGYLIAFPQSEWEVIEQRL 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++ +           L   G     +D +GRIL+   +R +  ++ +V   G    F++W
Sbjct: 59  SQLSFLRKDFRAFQRLFVSGASECPLDRQGRILLPPSLREYAKLDKDVVLAGAVRCFEIW 118

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + Q + +           ++ ++
Sbjct: 119 DRQLWDQEMTRIEAMDSDEVRKE 141


>gi|114327102|ref|YP_744259.1| cell division protein MraZ [Granulibacter bethesdensis CGDNIH1]
 gi|114315276|gb|ABI61336.1| cell division protein mraZ [Granulibacter bethesdensis CGDNIH1]
          Length = 174

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 2/126 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQ--RCITDLYCFQDFFFPAISVGNSDLLEYF 58
           MS FL     ++D+KGRVSVP  FR  L         +        P I      + +  
Sbjct: 19  MSHFLGTHQNRLDAKGRVSVPAPFRAALRAFGEGNGQIILRPSHTHPCIEAWPLPVFQTL 78

Query: 59  EQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
              + + + FS   + L+  ++     +  D EGRI++ D +    G+ + V F+G G  
Sbjct: 79  ATPLDQLDMFSETHDDLAAALYADAFPVDADKEGRIILLDSLTAHAGLTDSVVFMGLGRT 138

Query: 119 FQLWNP 124
           FQ+W P
Sbjct: 139 FQIWEP 144


>gi|169831602|ref|YP_001717584.1| MraZ protein [Candidatus Desulforudis audaxviator MP104C]
 gi|169638446|gb|ACA59952.1| MraZ protein [Candidatus Desulforudis audaxviator MP104C]
          Length = 174

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 54/129 (41%), Gaps = 5/129 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F+      +D+KGR+ +P  FR  L    I             + + +    E  E+K+ 
Sbjct: 31  FIGEYLHTLDNKGRLFIPARFREGLGSSFIATKGL-----DRCLFLYSRPEWELMEKKLR 85

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +      +A   + L   G   L+ D +GR+L+   +R +  +E +V  +G  +  ++W 
Sbjct: 86  KLPFARAEARAFTRLFFSGAAELEADKQGRVLLPAALRDYAQLEKDVMVLGVSSRVEIWA 145

Query: 124 PQTFRKLQE 132
            + + +   
Sbjct: 146 REEWERYSS 154


>gi|50842236|ref|YP_055463.1| hypothetical protein PPA0749 [Propionibacterium acnes KPA171202]
 gi|50839838|gb|AAT82505.1| conserved protein [Propionibacterium acnes KPA171202]
          Length = 160

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 55/141 (39%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL   T K+D KGR  +P  FR  L       L   +      +++  ++      ++IA
Sbjct: 20  FLGTHTPKLDEKGRFFLPAKFRDELDD----GLVITRG-QDRCLAIYPTETFVEMTREIA 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           + +    +      ++  G      D +GR+++   +R +  +  E+  VG     ++W+
Sbjct: 75  KGSVSVKKVRDYQRMLAAGASDTAPDKQGRVMIPPMLRRYAALNKEIVVVGAITRVEVWD 134

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
              + K  E     +     +
Sbjct: 135 ATEWEKYSEAQEEAFADMNEE 155


>gi|256832297|ref|YP_003161024.1| MraZ protein [Jonesia denitrificans DSM 20603]
 gi|256685828|gb|ACV08721.1| MraZ protein [Jonesia denitrificans DSM 20603]
          Length = 150

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+ +P  FR   +      L   +      + +   +      + +
Sbjct: 7   LFLGTYTPKLDDKGRLILPSKFRGQFSS----GLVMTRG-QERCLFLLPMEEFRRMYEHL 61

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S QA     +   G      D +GR+ +   +R + G++ EV  +G G+  ++W
Sbjct: 62  RQAPVTSRQARDYMRVFLSGASDEMPDKQGRVSIPTPLRTYAGLDREVAVIGAGSRVEIW 121

Query: 123 NPQTFRKLQEESRNEYCR 140
           + +T+    EE    Y +
Sbjct: 122 DARTWEDYLEEKEEGYSQ 139


>gi|226360239|ref|YP_002778017.1| cell division protein MraZ [Rhodococcus opacus B4]
 gi|254813288|sp|C1AU64|MRAZ_RHOOB RecName: Full=Protein MraZ
 gi|226238724|dbj|BAH49072.1| MraZ protein [Rhodococcus opacus B4]
          Length = 143

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  LA   +            +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTK-----GQDHSLAVYPREEFTALARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +    +A      +  G      D++GRI ++   R + G+  +   +G  ++ ++W
Sbjct: 56  AAASRSDPEARAFVRGLAAGTDEQHADAQGRITLSADHRRYAGLSKDCVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++   E +   Y +
Sbjct: 116 DAQAWQTYVEANEENYSQ 133


>gi|163846347|ref|YP_001634391.1| MraZ protein [Chloroflexus aurantiacus J-10-fl]
 gi|222524112|ref|YP_002568583.1| MraZ protein [Chloroflexus sp. Y-400-fl]
 gi|163667636|gb|ABY34002.1| MraZ protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447991|gb|ACM52257.1| MraZ protein [Chloroflexus sp. Y-400-fl]
          Length = 143

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 68/145 (46%), Gaps = 7/145 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL +    ID KGR+++P  FR  LA      +   + F    + +          +++
Sbjct: 1   MFLGSYEHTIDEKGRLAIPARFRADLA----GGMVVTRGF-DRCLLIFPLPYWNDLTRRV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +     A  L  L+       +MD +GRIL+   +R   G+ ++V  VG   + ++W
Sbjct: 56  SALSLVDEDARMLRRLLFASASEQEMDRQGRILLPQNLREAGGLTDQVLLVGLDAFIEVW 115

Query: 123 NPQTFRKLQE--ESRNEYCRQLLQK 145
            P+ +R++Q+  ES+  +  + ++K
Sbjct: 116 APERWREVQQRLESQGPHFDEQMRK 140


>gi|320533239|ref|ZP_08033946.1| protein MraZ [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134544|gb|EFW26785.1| protein MraZ [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 156

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 54/141 (38%), Gaps = 5/141 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FL     K+D KGR+ +P  FR  LA      +   +      +    +   E    ++ 
Sbjct: 15  FLGTHAPKLDEKGRLILPAKFREELA----GGVVLTRG-QEHCLYAFTAAEFERMYAQLR 69

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E      QA     ++  G      D +GRI +   +R + G++ ++  +G G   ++W+
Sbjct: 70  EAPLAQKQARDYVRVMLSGADSQIPDKQGRITLPAPLRAYAGLKKDLAVIGAGARVEIWD 129

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            +++          +     +
Sbjct: 130 AESWSTYLVAQEQVFADTAEE 150


>gi|289522915|ref|ZP_06439769.1| MraZ protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503939|gb|EFD25103.1| MraZ protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 146

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 64/137 (46%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +     ++DSKGR+ +P  FR  + ++ +  +          IS+ + D  E   +K+
Sbjct: 5   MMIGTYEHRLDSKGRLVLPSRFRQEMGEQLVASVGV-----ERCISLYSKDEWEKLLEKL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A     +       + +DS GRIL+   ++    +E EV+ +G G++ ++W
Sbjct: 60  QKMPFSQSKARDFLRVFLATAHEITLDSAGRILLPQMLKSHAYLETEVSIIGVGDHLEIW 119

Query: 123 NPQTFRKLQEESRNEYC 139
           + +T+ K +++  +   
Sbjct: 120 DRETWNKYRQDILSNLS 136


>gi|34499807|ref|NP_904022.1| hypothetical protein CV_4352 [Chromobacterium violaceum ATCC 12472]
 gi|51316328|sp|Q7NPZ0|MRAZ_CHRVO RecName: Full=Protein MraZ
 gi|34105657|gb|AAQ62011.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 148

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 58/146 (39%), Gaps = 5/146 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +DSKGR+++P   R  L       L    +     + +         E ++
Sbjct: 1   MIGGVSILSLDSKGRLAIPAKHRETLLSAFGHKLVVTLESQDH-LLLYPEPNWRPVEARL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   LV G    L+MDS GR+L+   +R  T ++ +V  VG GN F+LW
Sbjct: 60  LALPTGNPTLKRYQRLVLGHAETLEMDSAGRVLLPARLRELTALDKDVALVGMGNRFELW 119

Query: 123 NPQTFRKLQEES----RNEYCRQLLQ 144
           N + +     ++    + +  + L  
Sbjct: 120 NAEEWDSQTADALAIDQADLAQHLGD 145


>gi|237654093|ref|YP_002890407.1| cell division protein MraZ [Thauera sp. MZ1T]
 gi|237625340|gb|ACR02030.1| MraZ protein [Thauera sp. MZ1T]
          Length = 147

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 53/130 (40%), Gaps = 2/130 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F   V   +D+KGR+++P   R  LA                   V            +
Sbjct: 1   MFQGAVALNLDAKGRLAIPARHRDALAVD--NGQVVLTAHPHGCCLVYPVPAWNPIRDHV 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   QA  L  L+ G      +D+ GR+L+   +R F  +E +V  VG+G +F+LW
Sbjct: 59  LRAPSLDPQAAMLKRLLVGFAQEETLDAAGRVLVAPSLRKFAALEKQVWLVGQGAHFELW 118

Query: 123 NPQTFRKLQE 132
           + + + K Q+
Sbjct: 119 SDERWEKQQQ 128


>gi|163841238|ref|YP_001625643.1| cell division protein MraZ [Renibacterium salmoninarum ATCC 33209]
 gi|189028629|sp|A9WRE7|MRAZ_RENSM RecName: Full=Protein MraZ
 gi|162954714|gb|ABY24229.1| cell division protein [Renibacterium salmoninarum ATCC 33209]
          Length = 143

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   + ++D KGR+ +P  FR  L       L   +      I V +    E   +++
Sbjct: 1   MFLGTHSPRLDEKGRLILPAKFRDELG----NGLVFTRG-QERCIYVFSQREFERVHEQM 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    S QA     +   G      D +GR+ +   +R + G++ E+  +G G+  ++W
Sbjct: 56  RDAPISSRQARDYIRVFLSGASDEMPDKQGRVTIPAALRAYAGLDRELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
               + +  EE  N +  
Sbjct: 116 GATAWAEYLEEKENAFSD 133


>gi|257092217|ref|YP_003165858.1| cell division protein MraZ [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044741|gb|ACV33929.1| MraZ protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 148

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 59/130 (45%), Gaps = 1/130 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR++VP   R  L       L          + +      E    K+
Sbjct: 1   MFQGAAALSLDAKGRIAVPARHREPLVSASEGRLVLT-AHPHRCLLLYPETAWEPIRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  + ++  +  L+ G     +MD+ GR+L+   +R F  ++ +V  VG+G++F++W
Sbjct: 60  LAASSLNPRSALIKRLLVGHAREEEMDATGRLLIAPELRQFAQLDKQVWLVGQGSHFEIW 119

Query: 123 NPQTFRKLQE 132
           +   +++ QE
Sbjct: 120 SDAGWQQQQE 129


>gi|160896908|ref|YP_001562490.1| cell division protein MraZ [Delftia acidovorans SPH-1]
 gi|226709968|sp|A9BUJ7|MRAZ_DELAS RecName: Full=Protein MraZ
 gi|160362492|gb|ABX34105.1| MraZ protein [Delftia acidovorans SPH-1]
          Length = 142

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR+SVP   R  L       +   +      + +        F ++I
Sbjct: 1   MFQGASSLNLDGKGRLSVPTRHRDALVAMAQGQVTLTKHP-HGCLMLFPRTEWLQFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    +    ++     G  + + MD+ GR+L++  +R   G+  EV  +G GN+F+LW
Sbjct: 60  AQLPMSAQWWKRI---FLGNAMDVDMDATGRVLVSPELREAVGLTKEVVLLGMGNHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           +  T+   + ++  E
Sbjct: 117 DKATYEAHEAKAMQE 131


>gi|163751815|ref|ZP_02159031.1| hypothetical protein KT99_18080 [Shewanella benthica KT99]
 gi|161328300|gb|EDP99461.1| hypothetical protein KT99_18080 [Shewanella benthica KT99]
          Length = 152

 Score =  121 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 55/139 (39%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+++P  +R  L       L    DF    + +   D     E K+
Sbjct: 1   MFRGASAINLDTKGRIAIPKRYRESLRAEYNGQLVITVDFQSSCLLLYPLDEWNKIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  L+ G      +D   R+L+   +R +  ++     VG+ N F+LW
Sbjct: 61  LLLSDTQASERAMKRLLLGYAHECDLDGNARLLLPLPLRQYANLDKHAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   + +  E+SR     +
Sbjct: 121 DEAAWLQQIEQSRETIRSE 139


>gi|295398680|ref|ZP_06808704.1| cell division protein MraZ [Aerococcus viridans ATCC 11563]
 gi|294973115|gb|EFG48918.1| cell division protein MraZ [Aerococcus viridans ATCC 11563]
          Length = 143

 Score =  121 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 48/125 (38%), Gaps = 5/125 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR+ +P   R  L  + +             +     D  E  ++K+
Sbjct: 1   MLMGEFQHNIDAKGRIIIPAKLREDLGAKFVITRGL-----DGCVFGYPLDNWEKIQEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +A   +   +     +++D +GRI +   +  +  +E E   +G  +  ++W
Sbjct: 56  KQLPLAKKEARAFTRFFYSAAAEVEIDKQGRINVPSTLVDYANLEKECLVLGVSDRIEIW 115

Query: 123 NPQTF 127
           +   +
Sbjct: 116 SKARW 120


>gi|85703618|ref|ZP_01034722.1| MraZ, putative [Roseovarius sp. 217]
 gi|85672546|gb|EAQ27403.1| MraZ, putative [Roseovarius sp. 217]
          Length = 167

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 62/149 (41%), Gaps = 8/149 (5%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDLL 55
           F      K+D KGRVS+P +FR ++               +  + D     +     + +
Sbjct: 5   FRGESLHKVDGKGRVSIPALFRRVIEASDPNWTDGLNPELIIVYGDHRRRYLECYTIEAM 64

Query: 56  EYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGR 115
           +  + KI      S++   L  + HG      +D  GR+++   +R    +E+E  F+  
Sbjct: 65  QEVDDKINALPRGSMERKMLQRMFHGQSFPTSVDETGRLVLPAKLRKKIELEDEAFFIAA 124

Query: 116 GNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
           G+ FQ+W P+T+   +      +  +  +
Sbjct: 125 GDTFQIWKPETYDADELSKTENWLEEFPE 153


>gi|298245976|ref|ZP_06969782.1| MraZ protein [Ktedonobacter racemifer DSM 44963]
 gi|297553457|gb|EFH87322.1| MraZ protein [Ktedonobacter racemifer DSM 44963]
          Length = 135

 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 6/135 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      IDSKGR++VP  FR  L +  +             +S+      E    ++
Sbjct: 1   MFLGEYEHTIDSKGRMAVPARFRVQLDRGAVIGKGMGA-----CLSIYTMARWEEKSNEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S +       ++     +++D +GRI++   +R +  +E EVT VG  ++ ++W
Sbjct: 56  TA-GKSSEELRDFERRIYPSASEVELDGQGRIVLPAKLRAYARLETEVTVVGVRDHIEIW 114

Query: 123 NPQTFRKLQEESRNE 137
           N  T++  QE    E
Sbjct: 115 NRGTWQAYQERLDAE 129


>gi|311748597|ref|ZP_07722382.1| MraZ protein [Algoriphagus sp. PR1]
 gi|126577121|gb|EAZ81369.1| MraZ protein [Algoriphagus sp. PR1]
          Length = 144

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 60/143 (41%), Gaps = 2/143 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F S+   K+D KGR+++P   +  +     T L   +      +++         E +I
Sbjct: 1   MFNSHYDCKLDPKGRLALPAKIKAAIPDANGTGL-MLRMAEDHCLALYPMVEYRKLENQI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              N  + +   L        + +++DS GR+L+    + +  +E EV   G G+  ++W
Sbjct: 60  KSLNINNPEQRALQRAFFNTVVDVELDSAGRLLIPKTFQAYASLEKEVVVAGNGSRIEIW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           NP+   K       +    L++K
Sbjct: 120 NPENHAKHVIPDPADLSA-LMEK 141


>gi|301632887|ref|XP_002945511.1| PREDICTED: protein mraZ-like, partial [Xenopus (Silurana)
           tropicalis]
          Length = 209

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S F    +  +D+KGR+SVP   R  L Q+    L   +      + V      E F ++
Sbjct: 67  SVFQGASSLSLDAKGRLSVPTRHRDALTQQAGGQLTLTKHP-DGCLMVFPRPAWEEFRER 125

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           IA+    +    ++     G  + ++MD  GR L++  +R    +  +   +G GN+F+L
Sbjct: 126 IAKLPMSAQWWKRI---FLGNAMDVEMDGTGRFLVSPELREAASLTKDAVLLGMGNHFEL 182

Query: 122 WNPQTFRKLQEESRN 136
           W+  ++   +  +  
Sbjct: 183 WDKASYDAKEAAAMQ 197


>gi|121595970|ref|YP_987866.1| cell division protein MraZ [Acidovorax sp. JS42]
 gi|222112158|ref|YP_002554422.1| cell division protein mraz [Acidovorax ebreus TPSY]
 gi|167011852|sp|A1WC15|MRAZ_ACISJ RecName: Full=Protein MraZ
 gi|254813276|sp|B9MFS1|MRAZ_ACIET RecName: Full=Protein MraZ
 gi|120608050|gb|ABM43790.1| MraZ protein [Acidovorax sp. JS42]
 gi|221731602|gb|ACM34422.1| MraZ protein [Acidovorax ebreus TPSY]
          Length = 142

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 60/134 (44%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R  L  +    L   +      + V      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDALTAQAGGQLTLTKHP-DGCLMVFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    +    ++     G  + ++MD  GR+L++  +R   G+  +   +G GN+F+LW
Sbjct: 60  AQLPMSAQWWKRI---FLGNAMDVEMDGTGRVLVSPELREAAGLSKDAILLGMGNHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   +  +  
Sbjct: 117 DKATYEAKEAAAMQ 130


>gi|78356080|ref|YP_387529.1| cell division protein MraZ [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|91207193|sp|Q313R2|MRAZ_DESDG RecName: Full=Protein MraZ
 gi|78218485|gb|ABB37834.1| Protein of unknown function UPF0040 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 149

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 2/144 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS F     + +D KGR+ +P   R  L             F    +     +  E FE 
Sbjct: 1   MS-FKGRSYRSLDPKGRLMLPPEVRDALLAVSPEGRVSLTTF-DGCLVAYTPEDWEKFEA 58

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
             A     S +      LV GG   L +D +GR+ ++     + GI  +V  VG+G+ F+
Sbjct: 59  GFARIKNPSRKMRDFRRLVIGGVEELCVDKQGRVKLSRAHMEYAGITKKVVIVGQGSRFE 118

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQ 144
           +W+ +    +  +   +   +L +
Sbjct: 119 IWSEEELEAVIGQDFGDVTDELAE 142


>gi|315023520|gb|EFT36524.1| mraZ protein [Riemerella anatipestifer RA-YM]
          Length = 153

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 64/145 (44%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F      KID KGR+ +P     +L++    D    +  F   + V      E   +
Sbjct: 1   MNYFFETYECKIDDKGRIKLPSALAKLLSETHGKDFVIKRAVFQKCLEVYPVSTWEALME 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++ + N F  +      +   G   +++D   R+ +   ++ F G+E E+   G G++F+
Sbjct: 61  RLNKLNRFVKKNVDFIRVFTAGVKAVEVDKSDRVQIPKDLKDFAGMEKEIVISGVGDFFE 120

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+ +++ +       ++   L ++
Sbjct: 121 IWDKKSYEENIVMKEEDFAS-LAEE 144


>gi|283769660|ref|ZP_06342556.1| protein MraZ [Bulleidia extructa W1219]
 gi|283103928|gb|EFC05314.1| protein MraZ [Bulleidia extructa W1219]
          Length = 145

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 55/147 (37%), Gaps = 8/147 (5%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M  F       +D+K R+ +P  +R  L  +     +         ++    +  E   +
Sbjct: 1   MRLFTGEYRHHLDAKNRLMIPAKYRDQLTPKIYVTEWL-----DGCLAAFAQEEWEALVE 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+      + +       + G      +DS+GRIL+  F     G E     VG  N+F+
Sbjct: 56  KLNGLPITNAKVRAFVRRITGKADECALDSQGRILLPQFQLRDEGFEKACVVVGASNHFE 115

Query: 121 LWNPQTFRKLQE---ESRNEYCRQLLQ 144
           +W  + + +  +   ++   +   L +
Sbjct: 116 IWPEKKYDEYSQIGGDNFENFAEDLTE 142


>gi|119897166|ref|YP_932379.1| cell division protein MraZ [Azoarcus sp. BH72]
 gi|167011859|sp|A1K3T7|MRAZ_AZOSB RecName: Full=Protein MraZ
 gi|119669579|emb|CAL93492.1| protein mraZ [Azoarcus sp. BH72]
          Length = 147

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 2/130 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F   V   +D+KGR+++P   R  L       +          + V      E   +KI
Sbjct: 1   MFQGAVALSLDAKGRLAIPARHRDALTPDGAPLVMTV--HPHRCLLVYPLTAWEPIREKI 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                          ++ G      +D+ GR+L+   +R F  ++ +V  VG+G +F+LW
Sbjct: 59  TSLPGMDQATLSFKRMLVGFAQEETLDAAGRVLVAQSLRQFAALDKQVWLVGQGTHFELW 118

Query: 123 NPQTFRKLQE 132
           +   ++K QE
Sbjct: 119 SDAGWQKQQE 128


>gi|284931423|gb|ADC31361.1| cell division protein MraZ [Mycoplasma gallisepticum str. F]
          Length = 142

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 59/142 (41%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+ N    ID KGR+S+P   R+++                  + +  +   E +  K 
Sbjct: 1   MFIGNYQHNIDPKGRLSIPSKLRSLIQDS-----VVLSRGLDGCLELRTNQEFENYANKF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +    Q      L+    + +++DS  RIL+    +    +  EV  +G G++ +LW
Sbjct: 56  LSQSNNKQQNRNYKRLLFANSLTVEIDSANRILIPANFKKMANLNKEVVIIGMGDHIELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + +  E + +++  +L +
Sbjct: 116 DVNAYEQFNEANFDKF-NELAE 136


>gi|119478645|ref|ZP_01618548.1| hypothetical protein GP2143_10927 [marine gamma proteobacterium
           HTCC2143]
 gi|119448422|gb|EAW29673.1| hypothetical protein GP2143_10927 [marine gamma proteobacterium
           HTCC2143]
          Length = 149

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 58/136 (42%), Gaps = 1/136 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L +    +D+KGR+++P   R  L   C   +          + +      +    +I
Sbjct: 1   MHLGSNAINMDAKGRLAIPAKVRDALLSECDGRIVVTAHTEERCLLIYPEQQWQLLLPQI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDS-EGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
                 + +A ++  ++ G    +++D   GRIL+   +R + G+E ++  VG+G   +L
Sbjct: 61  ESLPNINRKAAKMQRVLLGYATNMEIDESHGRILLPPTLREYAGLEKKLMMVGQGKKLEL 120

Query: 122 WNPQTFRKLQEESRNE 137
           W+   +      + ++
Sbjct: 121 WSEDEWLNYLRGNDDD 136


>gi|167772170|ref|ZP_02444223.1| hypothetical protein ANACOL_03545 [Anaerotruncus colihominis DSM
           17241]
 gi|167665968|gb|EDS10098.1| hypothetical protein ANACOL_03545 [Anaerotruncus colihominis DSM
           17241]
          Length = 139

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 50/130 (38%), Gaps = 7/130 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +D+KGRV+ P   R  L  R +             + V + +  E    K+
Sbjct: 1   MLTGQYAHNLDAKGRVNFPARLREELGDRFVVTRGL-----DNCLFVYSMEEWERLAAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E          L+     G   ++ D +GR+++   +R + G+E +VT  G  N  ++W
Sbjct: 56  RELPISKSAP--LNRFFFAGAAEVEPDRQGRVVLPAHLREYAGLERDVTIAGVSNRAEIW 113

Query: 123 NPQTFRKLQE 132
           +   +    E
Sbjct: 114 DTARWEAQNE 123


>gi|303258245|ref|ZP_07344252.1| MraZ protein [Burkholderiales bacterium 1_1_47]
 gi|302858998|gb|EFL82082.1| MraZ protein [Burkholderiales bacterium 1_1_47]
          Length = 142

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 4/141 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D+KGR+SVP  +R  LAQ C   +   +     A+    +      E K 
Sbjct: 1   MFQGSPHINLDAKGRLSVPSRYREALAQLCSGQMTFTRHPDGCALLYPRNVW----ETKR 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E       A     +V G  + + MD+ GR+L+   +R   G+  E+  VG G++F+LW
Sbjct: 57  TELMALPYSARVFQRIVMGSAVDVDMDASGRLLVPAELRKACGLSKEIVLVGLGSHFELW 116

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           + +   + + ++  E    + 
Sbjct: 117 DAEKLAESEAKAMTENLSDIA 137


>gi|255068189|ref|ZP_05320044.1| MraZ protein [Neisseria sicca ATCC 29256]
 gi|255047531|gb|EET42995.1| MraZ protein [Neisseria sicca ATCC 29256]
          Length = 151

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR+++P  FR IL +     +    D     +    ++  +  EQ +
Sbjct: 1   MFGGAHELSIDSKGRLAIPAKFRDILLRHYTPSIVVTLDSRQKLLMYPEAEWAKVAEQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     E +VT VGR N  +LW
Sbjct: 61  HLKTAGNPMLQRYQNLLLHNADTLEWDSAGRVLIPANLRKRVDFEKDVTLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
               +     ++ ++   +L 
Sbjct: 121 GRDQWEAEMTQALDDDPEELA 141


>gi|91200076|emb|CAJ73119.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 146

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 50/129 (38%), Gaps = 1/129 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+K R+++P   R  + +      +         + +      +    KI
Sbjct: 1   MFTGEYRHTIDTKNRLAIPASLRESINEEVEGKGFYITRGLDTCLFMYTPKEWQGVVSKI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKM-DSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            + +  + +A Q   L       + + D +GRIL+  +++    I+  V  VG  N  ++
Sbjct: 61  EQSSFTNKKARQFQRLFFSKAQHITVTDPQGRILIPQYLKEIANIQKNVVIVGVNNRIEI 120

Query: 122 WNPQTFRKL 130
           W+ + +   
Sbjct: 121 WDEKNWSDF 129


>gi|288958914|ref|YP_003449255.1| MraZ protein [Azospirillum sp. B510]
 gi|288911222|dbj|BAI72711.1| MraZ protein [Azospirillum sp. B510]
          Length = 165

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 1/142 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRC-ITDLYCFQDFFFPAISVGNSDLLEYFE 59
           M+ FLS    K+D KGRVS+P  FR  LA+      +Y +      A+   + D L+   
Sbjct: 1   MAVFLSTYVNKVDRKGRVSIPAQFRQSLAKTSAPNTVYLWPSLNHQALEGADQDYLDVLS 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           + +   +  + + + +   + G  I +  D+EGRI++   +  F GI  E  F+GR   F
Sbjct: 61  ESLESPDLDADERDMIETFIFGKLIPVSSDAEGRIVLPRELAEFAGITEEAAFIGRRKTF 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQ 141
           Q+W P+  +  +   R +  R+
Sbjct: 121 QIWEPEALKAHEAALREQVVRK 142


>gi|294660428|ref|NP_853183.2| cell division protein MraZ [Mycoplasma gallisepticum str. R(low)]
 gi|51316320|sp|Q7NB78|MRAZ_MYCGA RecName: Full=Protein MraZ
 gi|284812087|gb|AAP56751.2| cell division protein MraZ [Mycoplasma gallisepticum str. R(low)]
 gi|284930665|gb|ADC30604.1| cell division protein MraZ [Mycoplasma gallisepticum str. R(high)]
          Length = 142

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 59/142 (41%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+ N    ID KGR+S+P   R+++                  + +  +   E +  K 
Sbjct: 1   MFIGNYQHNIDPKGRLSIPSKLRSLIQDS-----VVLSRGLDGCLELRTNQEFENYANKF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +    Q      L+    + +++DS  RIL+    +    +  EV  +G G++ +LW
Sbjct: 56  LSQSNNKQQNRNYKRLLFANSLTVEIDSANRILIPANFKKMANLSKEVVIIGMGDHIELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   + +  E + +++  +L +
Sbjct: 116 DINAYEQFNEANFDKF-NELAE 136


>gi|313206539|ref|YP_004045716.1| mraz protein [Riemerella anatipestifer DSM 15868]
 gi|312445855|gb|ADQ82210.1| MraZ protein [Riemerella anatipestifer DSM 15868]
 gi|325336012|gb|ADZ12286.1| MraZ [Riemerella anatipestifer RA-GD]
          Length = 166

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 64/145 (44%), Gaps = 1/145 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F      KID KGR+ +P     +L++    D    +  F   + V      E   +
Sbjct: 14  MNYFFETYECKIDDKGRIKLPSALAKLLSETHGKDFVIKRAVFQKCLEVYPVSTWEALME 73

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++ + N F  +      +   G   +++D   R+ +   ++ F G+E E+   G G++F+
Sbjct: 74  RLNKLNRFVKKNVDFIRVFTAGVKAVEVDKSDRVQIPKDLKDFAGMEKEIVISGVGDFFE 133

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+ +++ +       ++   L ++
Sbjct: 134 IWDKKSYEENIVMKEEDFAS-LAEE 157


>gi|224826069|ref|ZP_03699172.1| MraZ protein [Lutiella nitroferrum 2002]
 gi|224601706|gb|EEG07886.1| MraZ protein [Lutiella nitroferrum 2002]
          Length = 148

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
                    +DSKGR+++P   R  L     + L    +     + +         E ++
Sbjct: 1   MIGGVNVVSLDSKGRLAIPARHRETLLSTFGSKLVVTLEARDH-LLLYPEPNWRPVEARL 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   LV G    L MDS GRIL++  +R    ++ +V  VG GN F+LW
Sbjct: 60  LALPSGNPMLKRYQKLVLGHAELLDMDSAGRILLSPRLRGLVNLDKDVALVGMGNRFELW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     ++ +    +L Q
Sbjct: 120 DAADWDDQTSDALDIDPAELSQ 141


>gi|172040894|ref|YP_001800608.1| cell division protein MraZ [Corynebacterium urealyticum DSM 7109]
 gi|226709966|sp|B1VHD3|MRAZ_CORU7 RecName: Full=Protein MraZ
 gi|171852198|emb|CAQ05174.1| MraZ protein [Corynebacterium urealyticum DSM 7109]
          Length = 143

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  L    +            ++++   +      +K 
Sbjct: 1   MFFGTFTPKLDDKGRLTLPAKFREELKDGLMVVK-----GQDHSLAIYPREEFLLRARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + QA      +        +DS+GRI ++   R + G++ E   +G  ++ ++W
Sbjct: 56  AAASRSNPQARAFVRNLAASADEQDLDSQGRISVSAAHREYAGLKKECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q + +       ++  
Sbjct: 116 DAQAWEEYSAAHEADFAA 133


>gi|153006712|ref|YP_001381037.1| hypothetical protein Anae109_3874 [Anaeromyxobacter sp. Fw109-5]
 gi|167011856|sp|A7HH57|MRAZ_ANADF RecName: Full=Protein MraZ
 gi|152030285|gb|ABS28053.1| protein of unknown function UPF0040 [Anaeromyxobacter sp. Fw109-5]
          Length = 145

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 55/131 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR S+P  FR  LA      +   Q   + A+      +     +K+
Sbjct: 1   MFFGTFNHAIDAKGRTSLPVKFRESLAAAGEPRIVLMQYPHWRAVQALPQSVWNELVKKV 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +P   +  +  L        + +D+ GR+L+   +R + G++ +V +VG G    L+
Sbjct: 61  MDASPLDARTQRSVLKFVSSAHEVDLDANGRVLVPPALREWAGLQKDVVWVGMGRTIHLY 120

Query: 123 NPQTFRKLQEE 133
           +   +     E
Sbjct: 121 DKAAYETQVAE 131


>gi|261365121|ref|ZP_05978004.1| MraZ protein [Neisseria mucosa ATCC 25996]
 gi|288566553|gb|EFC88113.1| MraZ protein [Neisseria mucosa ATCC 25996]
          Length = 151

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR+++P  FR IL +     +    D     +    ++  +  EQ +
Sbjct: 1   MFGGAHELSIDSKGRLAIPAKFRDILLRHYTPSIVVTLDSREKLLMYPEAEWAKVVEQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GRIL+   +R     E +VT VGR N  +LW
Sbjct: 61  RLKTAGNQMLQRYQNLLLHNADTLEWDSAGRILIPANLRKRVDFEKDVTLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
               +     ++ ++   +L 
Sbjct: 121 GRDQWEAEMTQALDDDPEELA 141


>gi|260424624|ref|ZP_05732704.2| MraZ protein [Dialister invisus DSM 15470]
 gi|260402585|gb|EEW96132.1| MraZ protein [Dialister invisus DSM 15470]
          Length = 154

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 7/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+S  +  IDSKGR+ +P  FR  L        +         + +   +       K 
Sbjct: 12  MFMSEYSHSIDSKGRMILPAKFREELGD-----HFVLAPGLDSCLCIYTMEHWNNLISKF 66

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +       ++   + G G  ++ D +GRIL+   +R    ++     +G G+  ++W
Sbjct: 67  EQMSATHQNVRKVKRYLIGKGSEMECDKQGRILIPAHLRKLADLKKNARIIGAGSTIEIW 126

Query: 123 NPQTFRK--LQEESRNEYCRQL 142
           +P+   +   +EES  +    L
Sbjct: 127 DPELLDRDLNEEESITDLAESL 148


>gi|255262870|ref|ZP_05342212.1| protein MraZ [Thalassiobium sp. R2A62]
 gi|255105205|gb|EET47879.1| protein MraZ [Thalassiobium sp. R2A62]
          Length = 166

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
            RF     QK+DSKGR+S+P  FR +L               +  + D    ++     +
Sbjct: 3   RRFRGEFHQKVDSKGRMSIPASFRRVLEAGDPEWADGLNPQLVVLYGDHLRDSLHCYTIE 62

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
                E  I      S +   LS  + G  +   MD +GR+++    R   G++ +V F+
Sbjct: 63  AFMEIEDDILSLPRGSDERRYLSRTILGQSLTTDMDKDGRLVLPKRQRDKIGLDEQVFFI 122

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G++FQ+W P+T+  ++     E  +    
Sbjct: 123 AAGDHFQIWKPETYDDVEAGVVPEALKGQAD 153


>gi|262037274|ref|ZP_06010754.1| protein MraZ [Leptotrichia goodfellowii F0264]
 gi|261748702|gb|EEY36061.1| protein MraZ [Leptotrichia goodfellowii F0264]
          Length = 141

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 53/131 (40%), Gaps = 4/131 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   + K+D+KGR+ +P  FR  L +    +    +      I +   +  E+  +K+
Sbjct: 1   MFMGEFSCKVDNKGRLMLPVKFREQLGE---GEFVITRGL-DNCIDLFPIEEWEHRMEKL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +         +      L +DS+GR+ +   +     I    T +G  ++ ++W
Sbjct: 57  KQLKTTNSNHRAYQRFILSAATKLTLDSQGRLNLPSSLIGHAEISKNATVMGSDDHIEIW 116

Query: 123 NPQTFRKLQEE 133
           + + +     +
Sbjct: 117 SEEKWNDYINQ 127


>gi|159045016|ref|YP_001533810.1| cell division protein MraZ [Dinoroseobacter shibae DFL 12]
 gi|157912776|gb|ABV94209.1| protein mraZ [Dinoroseobacter shibae DFL 12]
          Length = 170

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/151 (23%), Positives = 57/151 (37%), Gaps = 9/151 (5%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSD 53
             F      K+DSKGRVS+P  FR +L               +  + D     +      
Sbjct: 3   RMFRGESVHKVDSKGRVSIPANFRRVLEDNDPRWTAGGNPELVIVYGDHRQNYLECYTMA 62

Query: 54  LLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFV 113
            +   + KIA     S     L  L  G      +D  GR+++   +R   G+E E  F+
Sbjct: 63  AMAEVDAKIARLPRGSKPRRMLETLFTGQAHETSVDETGRLVLPAKLRAKIGLEGEAHFL 122

Query: 114 GRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
             G+ FQ+ +P+ +     E    +   L +
Sbjct: 123 ATGDTFQILSPEGYAAKMGE-MGSWLDDLDE 152


>gi|254292760|ref|YP_003058783.1| hypothetical protein Hbal_0384 [Hirschia baltica ATCC 49814]
 gi|254041291|gb|ACT58086.1| protein of unknown function UPF0040 [Hirschia baltica ATCC 49814]
          Length = 159

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 56/139 (40%), Gaps = 1/139 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FLS    KID+K RVSVP  FR  L       ++         +  G+  L+    + I
Sbjct: 1   MFLSTYESKIDAKNRVSVPASFRKALGGDDFICVWPSFGKSKNCLEGGSKKLVNSLYKSI 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSE-GRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            +  P   +   L   + G    L+ D   GR+++        GI  EV FVG G  F++
Sbjct: 61  RKMKPMDPRRQALEYGILGECKELQFDGAGGRVVLPQKFVDAAGITGEVAFVGLGERFEI 120

Query: 122 WNPQTFRKLQEESRNEYCR 140
           W+ +   + + E       
Sbjct: 121 WSKERLEEKRAEFMELAAE 139


>gi|294677905|ref|YP_003578520.1| protein MraZ [Rhodobacter capsulatus SB 1003]
 gi|294476725|gb|ADE86113.1| protein MraZ [Rhodobacter capsulatus SB 1003]
          Length = 164

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 59/150 (39%), Gaps = 8/150 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDL 54
            F+   T K+DSKGRVS+P +FR  L +             +  +       + V +   
Sbjct: 4   MFIGEYTFKVDSKGRVSIPALFRRELEEGDPEAAVTKRPRLVIVYGADTQKMLQVHSFAG 63

Query: 55  LEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVG 114
            +     I            L   V       ++D +GR+++   +R    +  +  F G
Sbjct: 64  FQKLAAAINARPYSDPSRAILQRFVLNKAHPTEIDPDGRLVLPAQLRERFQLTGDAYFAG 123

Query: 115 RGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144
            G  F++WNP+TF  + +    +   ++ +
Sbjct: 124 MGETFEIWNPETFAAVDQARLEKLMAEMGE 153


>gi|56476235|ref|YP_157824.1| cell division protein MraZ [Aromatoleum aromaticum EbN1]
 gi|68565442|sp|Q5P6Y8|MRAZ_AZOSE RecName: Full=Protein MraZ
 gi|56312278|emb|CAI06923.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 147

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 2/130 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F   +   +D+KGR+++P   R  L       +          + V      E    +I
Sbjct: 1   MFQGAIALSLDAKGRLAIPARHRDALVPDGAPLVI--TAHPHKCLLVYPLSAWEPIRDRI 58

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A    F  + +    L+ G      +D+ GR+L+   +R +  +E +V  VG+G +F+LW
Sbjct: 59  AAMPGFDPRTSAFKRLLVGFAQEEGLDAAGRVLLAGSLRQWAQLEKQVWLVGQGAHFELW 118

Query: 123 NPQTFRKLQE 132
           +   ++  QE
Sbjct: 119 SDAGWQAQQE 128


>gi|297569459|ref|YP_003690803.1| MraZ protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296925374|gb|ADH86184.1| MraZ protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 59/137 (43%), Gaps = 2/137 (1%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D KGR+S+   FR +L ++    L      +   +        E  E  + 
Sbjct: 14  FRGRSDHILDGKGRLSIATRFRDVLRKQYDERLMVMP--WKTCLKAYPLPTWEELEVSLM 71

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                  Q  ++   + GG +   +D +GRIL+   +R   G++ +V   G  +YF++W+
Sbjct: 72  AQGKKHPQQLKMMRYMIGGVVECALDRQGRILLPPNLREECGLQKDVVVNGMISYFEIWD 131

Query: 124 PQTFRKLQEESRNEYCR 140
            +T+ ++   +  ++  
Sbjct: 132 KETWEQVSRPTSEQFAE 148


>gi|197124206|ref|YP_002136157.1| hypothetical protein AnaeK_3817 [Anaeromyxobacter sp. K]
 gi|220918986|ref|YP_002494290.1| protein of unknown function UPF0040 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|226709952|sp|B4UER1|MRAZ_ANASK RecName: Full=Protein MraZ
 gi|254813268|sp|B8J7P4|MRAZ_ANAD2 RecName: Full=Protein MraZ
 gi|196174055|gb|ACG75028.1| protein of unknown function UPF0040 [Anaeromyxobacter sp. K]
 gi|219956840|gb|ACL67224.1| protein of unknown function UPF0040 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 145

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 54/130 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR S+P  FR  LA      +   Q   + A+      +     +K+
Sbjct: 1   MFFGTFNHAIDAKGRTSLPAKFREALAAAGEPRIVLMQYPHWRAVQALPQSVWNELVKKV 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E +P   +  +  L        + +D  GR+L+   +R + G++ +V +VG G    L+
Sbjct: 61  MEASPLDARWQRNVLKFVSSAHEVDLDVHGRVLVPPPLREWAGLQKDVVWVGMGRTIHLY 120

Query: 123 NPQTFRKLQE 132
           +   + +   
Sbjct: 121 DRAAYDEQMS 130


>gi|170728861|ref|YP_001762887.1| cell division protein MraZ [Shewanella woodyi ATCC 51908]
 gi|226710014|sp|B1KKY6|MRAZ_SHEWM RecName: Full=Protein MraZ
 gi|169814208|gb|ACA88792.1| MraZ protein [Shewanella woodyi ATCC 51908]
          Length = 152

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 56/139 (40%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGRV++P  +R  L     + L    D     + +   D     E K+
Sbjct: 1   MFRGASAINLDTKGRVAIPKRYREPLHVEYNSQLVITVDIQSACLLLYPLDEWSKIEAKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +        +  ++ G     ++D  GR+L+   +R +  +      VG+ N F+LW
Sbjct: 61  LLLSDTLPAERAMKRMLLGYAHECELDGNGRLLLPLPLRQYANLGKRAMLVGQLNKFELW 120

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           +   ++   E+SR     +
Sbjct: 121 DETAWQHQIEQSRETIQDE 139


>gi|86160179|ref|YP_466964.1| hypothetical protein Adeh_3761 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|123496851|sp|Q2IG19|MRAZ_ANADE RecName: Full=Protein MraZ
 gi|85776690|gb|ABC83527.1| protein of unknown function UPF0040 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 144

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 54/130 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR S+P  FR  LA      +   Q   + A+      +     +K+
Sbjct: 1   MFFGTFNHAIDAKGRTSLPAKFREALAAAGEPRIVLMQYPHWRAVQALPQSVWNELVKKV 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E +P   +  +  L        + +D  GR+L+   +R + G++ +V +VG G    L+
Sbjct: 61  MEASPLDARWQRNVLKFVSSAHEVDLDVHGRVLVPPPLREWAGLQKDVVWVGMGRTIHLY 120

Query: 123 NPQTFRKLQE 132
           +   + +   
Sbjct: 121 DRAAYDEQMS 130


>gi|258542961|ref|YP_003188394.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-01]
 gi|256634039|dbj|BAI00015.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-01]
 gi|256637099|dbj|BAI03068.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-03]
 gi|256640151|dbj|BAI06113.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-07]
 gi|256643208|dbj|BAI09163.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-22]
 gi|256646263|dbj|BAI12211.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-26]
 gi|256649316|dbj|BAI15257.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-32]
 gi|256652302|dbj|BAI18236.1| cell division protein MraZ [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655360|dbj|BAI21287.1| cell division protein MraZ [Acetobacter pasteurianus IFO 3283-12]
          Length = 212

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 5/139 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITD---LYCFQDFFFPAISVGNSDLLEYFEQ 60
           FL     + D+KGR+S+P  FR++L  +       +        P +    +       +
Sbjct: 55  FLGTHENRFDAKGRISIPAGFRSVLKTQQTEGDALMILRPSHTLPCVEAWPAVAFARLTE 114

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENE--VTFVGRGNY 118
            +   + FS + + L+  ++     +  D EGRI++ DF+R   G+       F+G G  
Sbjct: 115 PLDRLDMFSDEHDDLAAALYADAYPIDPDREGRIILPDFLREHAGLTASPTAAFMGVGRI 174

Query: 119 FQLWNPQTFRKLQEESRNE 137
           FQ+W PQ  ++ + E+R  
Sbjct: 175 FQIWEPQAAQQRRAEARQR 193


>gi|261337511|ref|ZP_05965395.1| MraZ protein [Bifidobacterium gallicum DSM 20093]
 gi|270277910|gb|EFA23764.1| MraZ protein [Bifidobacterium gallicum DSM 20093]
          Length = 174

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L     KID+KGR+++P  FR  L +     +   +      I +           +I
Sbjct: 31  LLLGTYNPKIDAKGRLALPAKFRGQLGE----GMVMARG-QERCIYLLPQAEFRRIAVQI 85

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
              +  +  A     +   G +    D +GRIL+   +R +  + ++V  +G G   ++W
Sbjct: 86  QRTSMGNKAARDYLRVFLSGAVDTTPDKQGRILVPQMLRDYARLGSQVVVIGVGTRAEIW 145

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + + +   +    Y  
Sbjct: 146 DARAWGEYLADKEQGYSD 163


>gi|260220006|emb|CBA27112.1| Protein mraZ [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 142

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L+      +   +      + V      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLSATAAGQITITKHP-HGCLMVFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + ++MD  GR+L++  +R   GI  +   +G GN+F+LW
Sbjct: 60  AALPMSAQWWKRI---FLGNAMDVEMDGTGRVLISPELRESAGIAKDTMLLGMGNHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+ + + ++  
Sbjct: 117 DKATYDEQEAKAMQ 130


>gi|326315561|ref|YP_004233233.1| protein mraZ [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372397|gb|ADX44666.1| Protein mraZ [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 142

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L+      L   +      + V      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLSATAGGQLTITKHP-HGCLMVFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +    ++     G    ++MD  GR+L+   +R   GI  +   +G G++F+LW
Sbjct: 60  AELPMSAQWWKRI---FLGNAQDVEMDGTGRVLVAPELRQAAGITKDTMLLGMGHHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   + ++  
Sbjct: 117 DKATYEAQEAQAMQ 130


>gi|313891510|ref|ZP_07825123.1| protein MraZ [Dialister microaerophilus UPII 345-E]
 gi|329122135|ref|ZP_08250743.1| cell division protein MraZ [Dialister micraerophilus DSM 19965]
 gi|313120087|gb|EFR43266.1| protein MraZ [Dialister microaerophilus UPII 345-E]
 gi|327466942|gb|EGF12458.1| cell division protein MraZ [Dialister micraerophilus DSM 19965]
          Length = 145

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 61/142 (42%), Gaps = 7/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F++  +  ID+KGR+ +P  FR  L +      +         + +   +  +   +K+
Sbjct: 1   MFMNEYSHTIDTKGRMILPAKFREELGES-----FILAPGLDSCLCIYPRERWDAMIEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +         QL   + G    ++ D +GRIL+   +R    ++     +G G+  ++W
Sbjct: 56  QKLPFTKKDVRQLRRYLIGKSTEMECDKQGRILIPAHLRTLAKLKKNARIIGTGSTIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +  ++ + ES+     +L +
Sbjct: 116 SSEVLKEQETESQP--IDELAE 135


>gi|86358459|ref|YP_470351.1| cell division protein MraZ [Rhizobium etli CFN 42]
 gi|86282561|gb|ABC91624.1| MraZ protein [Rhizobium etli CFN 42]
          Length = 209

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 103/122 (84%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQ  + +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 65  MSRFLSNATNRIDAKGRVSVPSAFRSVLAQCNVQELYCFQDFVFPAISVGGPDLLERFER 124

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN +SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 125 QIAAEDPFSPDANAMSLLIHGGGVFMKLDAEGRLMVTDFIRDFTGISDEVTFVGRADHFQ 184

Query: 121 LW 122
           LW
Sbjct: 185 LW 186


>gi|302338059|ref|YP_003803265.1| MraZ protein [Spirochaeta smaragdinae DSM 11293]
 gi|301635244|gb|ADK80671.1| MraZ protein [Spirochaeta smaragdinae DSM 11293]
          Length = 151

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 54/145 (37%), Gaps = 7/145 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID KGR+ +P   R+ +      ++          + +   +  +     I
Sbjct: 1   MFMGEYRNSIDEKGRLMIPSRLRSEV----TGNVVVVTRGVDTCLWLFPPEQWKKIAHSI 56

Query: 63  AEYNPFSIQANQ-LSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIE--NEVTFVGRGNYF 119
              +       + L   +       ++D  GRI +   +R   GIE   E   +G  +Y 
Sbjct: 57  MGSSSLFKSKTRLLQRRIIAPAQECEIDRSGRITIPPTLRDSAGIELKKEAVILGIDSYL 116

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W+   +R   +ES +E+     +
Sbjct: 117 EVWDTDAYRSYLDESESEFLAAAEE 141


>gi|120609506|ref|YP_969184.1| cell division protein MraZ [Acidovorax citrulli AAC00-1]
 gi|120587970|gb|ABM31410.1| MraZ protein [Acidovorax citrulli AAC00-1]
          Length = 165

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 4/136 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           ++ F    +  +D+KGR+SVP   R +L+      L   +      + V      E F +
Sbjct: 22  LTVFQGASSLSLDAKGRLSVPTRHRDVLSATAGGHLTITKHP-HGCLMVFPRPEWEKFRE 80

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IAE    +    ++     G    ++MD  GR+L+   +R   GI  +   +G G++F+
Sbjct: 81  RIAELPMSAQWWKRI---FLGNAQDVEMDGTGRVLVAPELRQAAGITKDTMLLGMGHHFE 137

Query: 121 LWNPQTFRKLQEESRN 136
           LW+  T+   + ++  
Sbjct: 138 LWDKATYEAQEAQAMQ 153


>gi|161870664|ref|YP_001599837.1| cell division protein MraZ [Neisseria meningitidis 053442]
 gi|161596217|gb|ABX73877.1| Protein mraZ [Neisseria meningitidis 053442]
          Length = 174

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 24  MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 83

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 84  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLLPAGLRKRVDFDREVVLVGRANRLELW 143

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 144 GREQWEAEMVQALDDDPDELA 164


>gi|269123557|ref|YP_003306134.1| MraZ protein [Streptobacillus moniliformis DSM 12112]
 gi|268314883|gb|ACZ01257.1| MraZ protein [Streptobacillus moniliformis DSM 12112]
          Length = 141

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 66/141 (46%), Gaps = 5/141 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   +  +D+KGR+ +P  FR +L +      Y  +      I + N +  E   QK+
Sbjct: 1   MFIGEYSCSVDTKGRLMLPAKFRELLNEEN---FYITKGVNGQ-IDLYNLENWEEIVQKL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           ++      +A +    + G    +++DS GR+ +T  ++ +  +  + T +G GN  ++W
Sbjct: 57  SKVRQTDEKATKFKRFIIGSAQEIELDSHGRLTVTSTLKKYAELSKKATVIGMGNKIEIW 116

Query: 123 NPQTFRKLQEESR-NEYCRQL 142
           + +     +E+   NE   ++
Sbjct: 117 DSEKLDIYREDEDINEIMEEI 137


>gi|145223566|ref|YP_001134244.1| cell division protein MraZ [Mycobacterium gilvum PYR-GCK]
 gi|315443913|ref|YP_004076792.1| hypothetical protein Mspyr1_23120 [Mycobacterium sp. Spyr1]
 gi|189028625|sp|A4TBF5|MRAZ_MYCGI RecName: Full=Protein MraZ
 gi|145216052|gb|ABP45456.1| protein of unknown function UPF0040 [Mycobacterium gilvum PYR-GCK]
 gi|315262216|gb|ADT98957.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1]
          Length = 144

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 54/138 (39%), Gaps = 4/138 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  LA      L   +           ++  E   +  
Sbjct: 1   MFFGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKSQDHSLAVHPRAEFEEMIAEIS 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    + QA      +         D++GRI ++   R +  +  +    G  ++ ++W
Sbjct: 57  AKAKRGNPQARAYLRNLAASTDEQYPDAQGRITLSPEHRRYANLTKDCVVTGSIDFLEIW 116

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q +++ QE     +  
Sbjct: 117 DAQAWQEYQELHEENFSA 134


>gi|94264626|ref|ZP_01288409.1| Protein of unknown function UPF0040 [delta proteobacterium MLMS-1]
 gi|94266845|ref|ZP_01290505.1| Protein of unknown function UPF0040 [delta proteobacterium MLMS-1]
 gi|93452475|gb|EAT03074.1| Protein of unknown function UPF0040 [delta proteobacterium MLMS-1]
 gi|93454921|gb|EAT05162.1| Protein of unknown function UPF0040 [delta proteobacterium MLMS-1]
          Length = 158

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 56/137 (40%), Gaps = 2/137 (1%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D KGR+S+   FR +L ++    L      +   +        E  E  + 
Sbjct: 13  FRGRSEHIMDGKGRLSIATRFREVLRRQYDERLMITP--WHSCLRAYPFPQWEKLEMSLL 70

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                     +L   + GG +   +D +GR+L+   +R   G++ +V   G   YF++W+
Sbjct: 71  AEGKKQPALIKLVRYMVGGVVECPLDKQGRVLLPPNLREECGLQKDVVVNGMMTYFEIWD 130

Query: 124 PQTFRKLQEESRNEYCR 140
              + ++ + S  ++  
Sbjct: 131 KAKWEEISKPSGEDFAE 147


>gi|326797508|ref|YP_004315327.1| protein mraZ [Sphingobacterium sp. 21]
 gi|326548272|gb|ADZ76657.1| Protein mraZ [Sphingobacterium sp. 21]
          Length = 154

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 60/145 (41%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ FL     K+D+KGR+ +P   +  + +     L   +      + +      +   +
Sbjct: 1   MAHFLGEFECKLDTKGRMVLPAGLKKQMPEVEREGLVINRGLEAH-LVIYPRKEWDRIME 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +++  N F  +  +       G   L +D+  R+L+   +  + GI+ EV    + N  +
Sbjct: 60  ELSRLNTFERKTREFVRKFMRGATELTLDAANRVLVPKPLLEYAGIDGEVVLASQFNKIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W    +    ++  +++   L ++
Sbjct: 120 MWAKDAYDAQWDDEGDDFAA-LAEE 143


>gi|296393498|ref|YP_003658382.1| MraZ protein [Segniliparus rotundus DSM 44985]
 gi|296180645|gb|ADG97551.1| MraZ protein [Segniliparus rotundus DSM 44985]
          Length = 143

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 62/138 (44%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D KGR+++P  FR  LA      L   +     +++V   D      +K 
Sbjct: 1   MFLGTYAPRLDDKGRLTLPAKFREALA----GGLVVTKGP-DRSLAVYPRDHFAELARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + QA         G    + D++GR++++   R + G+  +    G  ++ ++W
Sbjct: 56  AAASRSNPQARAFVRNFAAGADEQRPDAQGRVVLSTDHRRYAGLRRDCVVNGAIDFLEIW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +++  EE+   Y +
Sbjct: 116 DAEAWQRYAEENEEGYVQ 133


>gi|160946333|ref|ZP_02093542.1| hypothetical protein PEPMIC_00293 [Parvimonas micra ATCC 33270]
 gi|158447449|gb|EDP24444.1| hypothetical protein PEPMIC_00293 [Parvimonas micra ATCC 33270]
          Length = 145

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 54/146 (36%), Gaps = 7/146 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+ F+ +    +D KGR+ +P  FR  L    +             + V        F +
Sbjct: 1   MALFIGDFPHTLDDKGRLIMPSKFRNELGTNFVVTRGL-----EGCLFVFTERKWTEFTE 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           ++            ++       +   +D +GR L+   +R F  IE +V  +G  +  +
Sbjct: 56  QLNSKGFSKKDVRSITRFFCSCAMNADLDKQGRFLVNKNLREFAEIERDVMIIGVSDRIE 115

Query: 121 LWNPQTFRKLQEE--SRNEYCRQLLQ 144
           +W+ + + +  +   S +    +   
Sbjct: 116 IWSKEKWDEYSKAEYSDDNIMSERFD 141


>gi|257063601|ref|YP_003143273.1| hypothetical protein Shel_08770 [Slackia heliotrinireducens DSM
           20476]
 gi|256791254|gb|ACV21924.1| uncharacterized conserved protein [Slackia heliotrinireducens DSM
           20476]
          Length = 144

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 60/137 (43%), Gaps = 6/137 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVG----NSDLLE 56
           M+        KID+KGR+S+P  FR  L +   T L    D    ++S+         + 
Sbjct: 1   MAALFGEYRHKIDAKGRISLPAAFRKALTED--TQLVTVPDKTQGSLSIYTVETYEAWVA 58

Query: 57  YFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRG 116
              +K   Y+P +     L   ++       +DS  RI ++   R   G++ +V  +G  
Sbjct: 59  MLFEKRGGYDPSNRDHVLLRKKLNSIATPGYLDSAYRISVSPKNRELAGLDKDVVLIGDT 118

Query: 117 NYFQLWNPQTFRKLQEE 133
           ++F++W+ + +    E+
Sbjct: 119 DHFEIWDAKRWDDFSED 135


>gi|256827377|ref|YP_003151336.1| hypothetical protein Ccur_09580 [Cryptobacterium curtum DSM 15641]
 gi|256583520|gb|ACU94654.1| uncharacterized conserved protein [Cryptobacterium curtum DSM
           15641]
          Length = 154

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 61/132 (46%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+  +     K+D+KGRVS+P  FR +L +     L   ++  +       S  +  F +
Sbjct: 13  MTELVGEHHHKLDAKGRVSMPSAFRKVLPKNLKVTLSPKKECLYVFEPDSFSMWVNSFFE 72

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
               Y P S +   L   ++     +++D+ GRI ++  +R   G++ EV   G  ++ +
Sbjct: 73  SEGGYKPTSSRHVALRRALNARARDVEVDNSGRIGLSADMRAEAGLDKEVVLTGNDDHLE 132

Query: 121 LWNPQTFRKLQE 132
           +WN + + +   
Sbjct: 133 IWNAKRWDEFLN 144


>gi|110833450|ref|YP_692309.1| hypothetical protein ABO_0589 [Alcanivorax borkumensis SK2]
 gi|123149671|sp|Q0VS11|MRAZ_ALCBS RecName: Full=Protein MraZ
 gi|110646561|emb|CAL16037.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 146

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 56/128 (43%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F  +    +D+KGR+++P  +R  L   C   L      F   +++          +K+
Sbjct: 1   MFTGSAALNLDAKGRLTMPTRYRASLIDTCGGQLVLTLHPFDDCLALYPRAEFMDTAKKL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +E    + Q  QL     G    ++MD  GR+L+   +R    +E     +G+ + F++W
Sbjct: 61  SEQRDSNPQVRQLKRRFLGQAAEIEMDGSGRLLVPPELRAAINLEKRAMLIGQLHRFEIW 120

Query: 123 NPQTFRKL 130
             +++  +
Sbjct: 121 KEESWADV 128


>gi|228472552|ref|ZP_04057312.1| protein MraZ [Capnocytophaga gingivalis ATCC 33624]
 gi|228275965|gb|EEK14721.1| protein MraZ [Capnocytophaga gingivalis ATCC 33624]
          Length = 154

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 51/140 (36%), Gaps = 1/140 (0%)

Query: 7   NVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAE-Y 65
               K DSKGRV++P   + +L              F   I +      +   +K+    
Sbjct: 7   TYECKADSKGRVTIPVGLKAVLESELHKGFILKPSIFKGCIELYPQGEWQEIMEKMRSKL 66

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
           N FS Q          G   +++D  GR L+   +  F  I+ EV      N+ ++W+ +
Sbjct: 67  NLFSKQHLDYLRKYTAGVKEVEVDGSGRFLIPKPLLEFAKIDKEVVLAPALNFIEVWDRE 126

Query: 126 TFRKLQEESRNEYCRQLLQK 145
            +         E    L +K
Sbjct: 127 CYEAEIASIDEEAFMALTEK 146


>gi|309787243|ref|ZP_07681855.1| protein MraZ [Shigella dysenteriae 1617]
 gi|308924821|gb|EFP70316.1| protein MraZ [Shigella dysenteriae 1617]
          Length = 135

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 55/124 (44%), Gaps = 2/124 (1%)

Query: 20  VPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLV 79
           +P  +R  L +     + C  D   P + +      E  EQK+   +  +    ++  L+
Sbjct: 1   MPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKLPRLSSMNPVERRVQRLL 60

Query: 80  HGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYC 139
            G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW+  T+ +  +E  +   
Sbjct: 61  LGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWHQQVKEDID--A 118

Query: 140 RQLL 143
            QL 
Sbjct: 119 EQLA 122


>gi|325293474|ref|YP_004279338.1| cell division protein MraZ [Agrobacterium sp. H13-3]
 gi|325061327|gb|ADY65018.1| cell division protein MraZ [Agrobacterium sp. H13-3]
          Length = 146

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 80/122 (65%), Positives = 100/122 (81%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLSNVT +ID+KGRVSVP  FR++LAQR I +LYC QDF FPAISVG  DLLE +E+
Sbjct: 1   MDRFLSNVTNRIDAKGRVSVPSPFRSVLAQRGIQELYCLQDFAFPAISVGGPDLLERYER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  + FS +AN +SLLVHGGG+F+K+D EGR+ +TDF+R FTGI  +VTFVGR ++FQ
Sbjct: 61  QIASMDAFSPEANAMSLLVHGGGVFMKLDQEGRLTVTDFVREFTGISTDVTFVGRADHFQ 120

Query: 121 LW 122
           LW
Sbjct: 121 LW 122


>gi|154500740|ref|ZP_02038778.1| hypothetical protein BACCAP_04418 [Bacteroides capillosus ATCC
           29799]
 gi|150270629|gb|EDM97938.1| hypothetical protein BACCAP_04418 [Bacteroides capillosus ATCC
           29799]
          Length = 140

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 53/133 (39%), Gaps = 8/133 (6%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M          +D+KGR+ +P   R  L       +          ++V   +  + F  
Sbjct: 1   MMSATGTYEHSLDAKGRLFIPAQLRRELGDTLYVTMGI-----DGCLAVYPQETWDTFTA 55

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K A        A +    +       + DS+GRI++   +R F G+E +    G  N  +
Sbjct: 56  KFAALPMTESVAMR---PLFANAAKCEPDSQGRIVIPAMLRKFAGLEKDAVITGVHNRAE 112

Query: 121 LWNPQTFRKLQEE 133
           +W+ + +++ QEE
Sbjct: 113 IWSAERWQEKQEE 125


>gi|332528827|ref|ZP_08404801.1| cell division protein MraZ [Hylemonella gracilis ATCC 19624]
 gi|332041686|gb|EGI78038.1| cell division protein MraZ [Hylemonella gracilis ATCC 19624]
          Length = 146

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 8/138 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTIL----AQRCITDLYCFQDFFFPAISVGNSDLLEYF 58
            F    +  +D+KGR+SVP   R +L    A      L   +      + V      E F
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLVSEAAGLGAGQLTITKHP-HGCLMVFPRPEWEKF 59

Query: 59  EQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNY 118
            ++IA     +    ++     G  + + +D+ GR+L++  +R   GI  +V  +G G +
Sbjct: 60  RERIAALPMDAQWWKRI---FLGNAMDVDIDATGRVLISPELRAAAGISKDVMLLGMGRH 116

Query: 119 FQLWNPQTFRKLQEESRN 136
           F+LW+   +   + ++  
Sbjct: 117 FELWDKARYEAEEAQAMQ 134


>gi|213612332|ref|ZP_03370158.1| cell division protein MraZ [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 135

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 3/129 (2%)

Query: 20  VPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLV 79
           +P  +R  L +     + C  D   P + +      E  EQK++  +  +    ++  L+
Sbjct: 1   MPTRYREQLIESATGQIVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLL 60

Query: 80  HGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEE---SRN 136
            G     +MD  GR+L+   +R   G+  EV  VG+ N F+LW+  T+ +  +E   +  
Sbjct: 61  LGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQ 120

Query: 137 EYCRQLLQK 145
                L ++
Sbjct: 121 SATETLSER 129


>gi|25028618|ref|NP_738672.1| cell division protein MraZ [Corynebacterium efficiens YS-314]
 gi|23493904|dbj|BAC18872.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 158

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 5/130 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             FL   T K+D KGR+++P  FR  L       L   +     +++V   +      +K
Sbjct: 15  RMFLGTYTPKLDDKGRLTLPAKFRDEL----TGGLVVTKG-QDHSLAVYPKEEFAARARK 69

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            A  +  S +A      +       + D++GRI ++   R + G+  E   +G  ++ ++
Sbjct: 70  AAAVSRTSPEARAFIRNLAASADEQRPDAQGRITLSVGHRSYAGLTRECVVIGSVDFLEI 129

Query: 122 WNPQTFRKLQ 131
           W+ Q +   Q
Sbjct: 130 WDAQAWATYQ 139


>gi|78065112|ref|YP_367881.1| cell division protein MraZ [Burkholderia sp. 383]
 gi|206561808|ref|YP_002232573.1| cell division protein MraZ [Burkholderia cenocepacia J2315]
 gi|91207187|sp|Q39JX9|MRAZ_BURS3 RecName: Full=Protein MraZ
 gi|226709956|sp|B4E6K1|MRAZ_BURCJ RecName: Full=Protein MraZ
 gi|77965857|gb|ABB07237.1| protein of unknown function UPF0040 [Burkholderia sp. 383]
 gi|198037850|emb|CAR53794.1| protein mraZ [Burkholderia cenocepacia J2315]
          Length = 142

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPARYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DSQTYNAKEQAAMAQ 131


>gi|326334985|ref|ZP_08201185.1| cell division protein MraZ [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325692790|gb|EGD34729.1| cell division protein MraZ [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 171

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 57/140 (40%), Gaps = 1/140 (0%)

Query: 7   NVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA-EY 65
               K DSKGRV++P   + +L +    +L      F P I +      +   +K+  + 
Sbjct: 24  TYQCKADSKGRVTIPVGLKAVLDKALQENLILKPSIFKPCIELYPQGEWQEIMEKMRTKL 83

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
           N FS Q          G    ++D+ GR L+   +  F  I+ EV      N+ ++W+ +
Sbjct: 84  NLFSKQHLDYLRKYTAGVKEAEVDATGRFLIPKPLCEFAKIDKEVVLAPALNFIEIWDKE 143

Query: 126 TFRKLQEESRNEYCRQLLQK 145
            + +       E    L +K
Sbjct: 144 LYEQEINSISEEDFMALTEK 163


>gi|51316471|sp|Q8FNT1|MRAZ_COREF RecName: Full=Protein MraZ
          Length = 143

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+D KGR+++P  FR  L       L   +     +++V   +      +K 
Sbjct: 1   MFLGTYTPKLDDKGRLTLPAKFRDEL----TGGLVVTKG-QDHSLAVYPKEEFAARARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  S +A      +       + D++GRI ++   R + G+  E   +G  ++ ++W
Sbjct: 56  AAVSRTSPEARAFIRNLAASADEQRPDAQGRITLSVGHRSYAGLTRECVVIGSVDFLEIW 115

Query: 123 NPQTFRKLQ 131
           + Q +   Q
Sbjct: 116 DAQAWATYQ 124


>gi|269215885|ref|ZP_06159739.1| putative lipoprotein [Slackia exigua ATCC 700122]
 gi|269130835|gb|EEZ61911.1| putative lipoprotein [Slackia exigua ATCC 700122]
          Length = 144

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSD----LLE 56
           M+        K+D+KGR+++P  FR  L +   T L          +SV  ++     ++
Sbjct: 1   MTALFGEYRHKVDAKGRLTLPSPFRKALTEE--TQLVVVPSTKNEFLSVYTAEGFETWVD 58

Query: 57  YFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRG 116
              +K   +NP           ++   +   MDS GRI +    R   G++ +V  +G  
Sbjct: 59  ALFEKRGGFNPSDRMHVLARTKLNASAVSSSMDSVGRINLASKQRELAGLDKDVVLIGNT 118

Query: 117 NYFQLWNPQTFRKLQEESRNEYC 139
           ++F++W+ + + + Q     +  
Sbjct: 119 DHFEIWDAKRWDEFQSSIDLDAL 141


>gi|259507676|ref|ZP_05750576.1| cell division protein MraZ [Corynebacterium efficiens YS-314]
 gi|259164723|gb|EEW49277.1| cell division protein MraZ [Corynebacterium efficiens YS-314]
          Length = 154

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 5/130 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             FL   T K+D KGR+++P  FR  L       L   +     +++V   +      +K
Sbjct: 11  RMFLGTYTPKLDDKGRLTLPAKFRDEL----TGGLVVTKG-QDHSLAVYPKEEFAARARK 65

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
            A  +  S +A      +       + D++GRI ++   R + G+  E   +G  ++ ++
Sbjct: 66  AAAVSRTSPEARAFIRNLAASADEQRPDAQGRITLSVGHRSYAGLTRECVVIGSVDFLEI 125

Query: 122 WNPQTFRKLQ 131
           W+ Q +   Q
Sbjct: 126 WDAQAWATYQ 135


>gi|86137692|ref|ZP_01056269.1| MraZ, putative [Roseobacter sp. MED193]
 gi|85826027|gb|EAQ46225.1| MraZ, putative [Roseobacter sp. MED193]
          Length = 155

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 12  IDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           +D+KGRVS+P  FR ++               +  + D     +     + +E  + KI 
Sbjct: 1   MDTKGRVSIPASFRRVIEASDPNWKSGESPELVIVYGDHRRNYLECYTIEAIEEVDAKID 60

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S+Q   L  + HG      +D  GR+++   +R   G+E E  F+  G+ FQ+W 
Sbjct: 61  ALPRGSMQRKMLQRMFHGQSFPTTIDETGRLVLPAKLRNKVGLEKEAFFMAAGDTFQIWK 120

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
           P+T+ + ++   +++  +L +
Sbjct: 121 PETYDEEEQALADKWMDELPE 141



 Score = 36.9 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 11/75 (14%), Positives = 18/75 (24%), Gaps = 1/75 (1%)

Query: 2   SRFLSN-VTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
             F        ID  GR+ +P   R  +            D F         +  +    
Sbjct: 74  RMFHGQSFPTTIDETGRLVLPAKLRNKVGLEKEAFFMAAGDTFQIWKPETYDEEEQALAD 133

Query: 61  KIAEYNPFSIQANQL 75
           K  +  P      + 
Sbjct: 134 KWMDELPEGFDPLEF 148


>gi|255994328|ref|ZP_05427463.1| MraZ protein [Eubacterium saphenum ATCC 49989]
 gi|255993041|gb|EEU03130.1| MraZ protein [Eubacterium saphenum ATCC 49989]
          Length = 163

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 60/142 (42%), Gaps = 6/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D+K R+ VP  FR  L  RC+             I +      E F  K+
Sbjct: 21  MFIGKYENTLDTKNRLIVPSKFREELGIRCVITKGL-----DNCIYIYPVHEWEDFLLKL 75

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +E     I A +     +      ++DS+GR+ +   ++ + G + E+T +G  N  ++W
Sbjct: 76  SELPISDINARKFVRHFNASANEAEIDSQGRLTIPADLKDYMGAQKEITTIGDRNKLEIW 135

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + +T   +  E+      +L +
Sbjct: 136 DRKTLNSVSSEALPS-PSELAE 156


>gi|312888803|ref|ZP_07748366.1| MraZ protein [Mucilaginibacter paludis DSM 18603]
 gi|311298678|gb|EFQ75784.1| MraZ protein [Mucilaginibacter paludis DSM 18603]
          Length = 154

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 57/145 (39%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MS FL     K+D+KGR+ +P   +  L +     L   + F    + +      +   +
Sbjct: 1   MSHFLGEFDCKLDTKGRMMIPVGLKKQLPEAEREGLVINRGF-EKHLVIYTRKEWDKIVE 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
            +A+ N +  +  +       G   L +D+  R+L+   +  + GI  +V    + N  +
Sbjct: 60  DLAKLNQYEKKTREFIRYFTRGASELTLDAANRVLLPKALTDYAGIGTDVVLSCQFNKIE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W    +    +     +   L ++
Sbjct: 120 VWAKDAYDSQMDNEPENFA-NLAEE 143


>gi|225023750|ref|ZP_03712942.1| hypothetical protein EIKCOROL_00614 [Eikenella corrodens ATCC
           23834]
 gi|224943632|gb|EEG24841.1| hypothetical protein EIKCOROL_00614 [Eikenella corrodens ATCC
           23834]
          Length = 151

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 58/143 (40%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR+++P  FR +L +     L    +     +    ++  +  E   
Sbjct: 1   MFGGVHELSIDSKGRLAIPAKFRDLLVRHYTPSLVVTVEARTHLVMYPEAEWQKTAENLQ 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +  A     L+      L +D+ GRIL+   +R     + EVT VGR +  +LW
Sbjct: 61  AMNVSGNPAARMFRDLMLNHAETLDLDASGRILLPPSLRRRVQFDKEVTLVGRADRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           N + +        +    +L ++
Sbjct: 121 NRERWEANMNAVLDMDPDELAEQ 143


>gi|284048646|ref|YP_003398985.1| MraZ protein [Acidaminococcus fermentans DSM 20731]
 gi|283952867|gb|ADB47670.1| MraZ protein [Acidaminococcus fermentans DSM 20731]
          Length = 141

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 52/142 (36%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +DSKGR+ VP   R  L    +             + V   +  E  +   
Sbjct: 1   MLMGEFEHALDSKGRLFVPAKMRENLGPSFVVTKGV-----DGCLDVYPLEAWEKLKNSF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+      +   +S  + GG   ++ D +GRIL+   +R +  I      VG G   ++W
Sbjct: 56  AQKMMPKQKMRDVSRFIFGGACEVEPDKQGRILLPANLRTYARIGETALIVGVGGKAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + Q +    +    +    + +
Sbjct: 116 DAQRYADYTKAVEGDVAELIEE 137


>gi|88801294|ref|ZP_01116822.1| putative cell division protein [Polaribacter irgensii 23-P]
 gi|88781952|gb|EAR13129.1| putative cell division protein [Polaribacter irgensii 23-P]
          Length = 155

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 50/129 (38%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M   +     K D+KGRV      +  L           +  F P + + + +  +    
Sbjct: 1   MINLIGTYECKADAKGRVLFASALKKQLQPVLNEGFVIKRAVFQPCLELYSMEEWQLIMS 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI + N F  + N        G   ++ DS GR+L+   +  F GI+ +V      N  +
Sbjct: 61  KINKLNKFVKKNNDFIRRFTAGVKIVEFDSAGRVLIPKDLADFAGIKKQVVLSSAVNIIE 120

Query: 121 LWNPQTFRK 129
           +W+   + K
Sbjct: 121 IWDKDNYEK 129


>gi|269120593|ref|YP_003308770.1| MraZ protein [Sebaldella termitidis ATCC 33386]
 gi|268614471|gb|ACZ08839.1| MraZ protein [Sebaldella termitidis ATCC 33386]
          Length = 143

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 55/143 (38%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T KID KGR  +P  FR IL      +    +     +I +  S      E ++
Sbjct: 1   MFMGEFTCKIDDKGRFMLPAKFREILQ---NDEFVITRGL-DNSIDLFPSSEWTNIENEL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +      +       V      L +D++GR+ + + +     I   +   G  +  ++W
Sbjct: 57  RKLKRTDSKHRAYQRFVLSAATKLTVDNQGRVNLPNSLVEHAKINKTLIVTGMVDKIEIW 116

Query: 123 NPQTFRKLQEESR---NEYCRQL 142
             + +++  E++     +   ++
Sbjct: 117 AEEVWKEYIEKTEASIEDIVDEI 139


>gi|283783868|ref|YP_003363733.1| hypothetical protein ROD_00871 [Citrobacter rodentium ICC168]
 gi|282947322|emb|CBG86867.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 135

 Score =  117 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 3/129 (2%)

Query: 20  VPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLV 79
           +P  +R  L +     + C  D   P + +      E  EQK++  +  +    ++  L+
Sbjct: 1   MPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLL 60

Query: 80  HGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEE---SRN 136
            G     +MDS GR+L+   +R   G+  EV  VG+ N F+LW+  T+ +  +E   +  
Sbjct: 61  LGHASECQMDSAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQ 120

Query: 137 EYCRQLLQK 145
                L ++
Sbjct: 121 SATETLSER 129


>gi|320093983|ref|ZP_08025810.1| cell division protein MraZ [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319979089|gb|EFW10605.1| cell division protein MraZ [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 143

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 55/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  +       +   +      +    +   E    ++
Sbjct: 1   MFLGTYEPKLDDKGRMFLPARFREDME----GGIVLTRG-QEHCVYAFPAAEFENMTAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S QA     ++  G      D +GRI +   +R + G++ E+T +G G+  ++W
Sbjct: 56  RRAPLSSKQARDWIRVMLSGAYKEVPDKQGRISVPADLRKYAGLDRELTVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   +R+        +     +
Sbjct: 116 NSSAWREYLAVQEEVFSSTAEE 137


>gi|107021629|ref|YP_619956.1| cell division protein MraZ [Burkholderia cenocepacia AU 1054]
 gi|116688574|ref|YP_834197.1| cell division protein MraZ [Burkholderia cenocepacia HI2424]
 gi|170731874|ref|YP_001763821.1| cell division protein MraZ [Burkholderia cenocepacia MC0-3]
 gi|254246427|ref|ZP_04939748.1| hypothetical protein BCPG_01173 [Burkholderia cenocepacia PC184]
 gi|123072442|sp|Q1BZH2|MRAZ_BURCA RecName: Full=Protein MraZ
 gi|167011861|sp|A0K477|MRAZ_BURCH RecName: Full=Protein MraZ
 gi|226709955|sp|B1JUW3|MRAZ_BURCC RecName: Full=Protein MraZ
 gi|105891818|gb|ABF74983.1| protein of unknown function UPF0040 [Burkholderia cenocepacia AU
           1054]
 gi|116646663|gb|ABK07304.1| MraZ protein [Burkholderia cenocepacia HI2424]
 gi|124871203|gb|EAY62919.1| hypothetical protein BCPG_01173 [Burkholderia cenocepacia PC184]
 gi|169815116|gb|ACA89699.1| MraZ protein [Burkholderia cenocepacia MC0-3]
          Length = 142

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DSQTYNAKEQAAMAQ 131


>gi|219849708|ref|YP_002464141.1| MraZ protein [Chloroflexus aggregans DSM 9485]
 gi|219543967|gb|ACL25705.1| MraZ protein [Chloroflexus aggregans DSM 9485]
          Length = 143

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 59/130 (45%), Gaps = 5/130 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      ID KGR+++P  FR  LA      +   + F    + +          +++
Sbjct: 1   MFLGTHEHAIDEKGRLAIPARFRAELA----GGMVLTRGF-DRCLLIFPLPFWSDLTRRV 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           +  +     A  L  L+       +MD +GR+L+   +R   G+ ++   +G   + ++W
Sbjct: 56  SSLSLVDEDARMLRRLLFASASEQEMDRQGRVLLPQNLREIGGLVDQAILIGLDAFIEVW 115

Query: 123 NPQTFRKLQE 132
           +P+ +R+++E
Sbjct: 116 SPERWREVEE 125


>gi|121635456|ref|YP_975701.1| cell division protein MraZ [Neisseria meningitidis FAM18]
 gi|167012261|sp|A1KVM5|MRAZ_NEIMF RecName: Full=Protein MraZ
 gi|120867162|emb|CAM10929.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|261391924|emb|CAX49386.1| putative MraZ-like protein [Neisseria meningitidis 8013]
 gi|308388612|gb|ADO30932.1| cell division protein MraZ [Neisseria meningitidis alpha710]
 gi|325130836|gb|EGC53569.1| mraZ protein [Neisseria meningitidis OX99.30304]
 gi|325132956|gb|EGC55633.1| mraZ protein [Neisseria meningitidis M6190]
 gi|325136977|gb|EGC59574.1| mraZ protein [Neisseria meningitidis M0579]
 gi|325138944|gb|EGC61494.1| mraZ protein [Neisseria meningitidis ES14902]
 gi|325142965|gb|EGC65322.1| mraZ protein [Neisseria meningitidis 961-5945]
 gi|325144949|gb|EGC67232.1| mraZ protein [Neisseria meningitidis M01-240013]
 gi|325202778|gb|ADY98232.1| mraZ protein [Neisseria meningitidis M01-240149]
 gi|325203517|gb|ADY98970.1| mraZ protein [Neisseria meningitidis M01-240355]
 gi|325208774|gb|ADZ04226.1| mraZ protein [Neisseria meningitidis NZ-05/33]
          Length = 151

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLLPAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|296134856|ref|YP_003642098.1| MraZ protein [Thiomonas intermedia K12]
 gi|294338810|emb|CAZ87144.1| putative Protein mraZ [Thiomonas sp. 3As]
 gi|295794978|gb|ADG29768.1| MraZ protein [Thiomonas intermedia K12]
          Length = 142

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 56/130 (43%), Gaps = 4/130 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      +D KGR++VP   R +L  R    L   +      + + + D    F  ++
Sbjct: 1   MFIGISALTLDGKGRMTVPARHRDLLMARSQGRLTLTKSP-DGCLLMFSDDEWTSFRDRV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G     +MD  GR+L++  +R   G+E EV  +G G +F++W
Sbjct: 60  MQLPMSAQGWKRI---YLGHATETEMDGTGRVLISPELRQAVGLEREVDLIGMGRHFEIW 116

Query: 123 NPQTFRKLQE 132
           +    +  + 
Sbjct: 117 DRAKHQAQEA 126


>gi|238927331|ref|ZP_04659091.1| cell division protein MraZ [Selenomonas flueggei ATCC 43531]
 gi|238884613|gb|EEQ48251.1| cell division protein MraZ [Selenomonas flueggei ATCC 43531]
          Length = 147

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 51/140 (36%), Gaps = 7/140 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGRV +P  FR  L           +     ++ +      + F  K+
Sbjct: 1   MFMGEYAHSIDAKGRVILPADFRQELG----VSFIITKGL-DGSLFLFPQAAWDEFAAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFT--GIENEVTFVGRGNYFQ 120
              +     A   +     G   L+ D +GR L+   +R +   G++ +V   G     +
Sbjct: 56  RTLSIADPNARAFARFFIAGARTLECDKQGRFLVPANLRAYASIGLKQDVILTGADTRIE 115

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+ + + +   E       
Sbjct: 116 VWDKEKWTRYAGEVDPNITE 135


>gi|304386664|ref|ZP_07368946.1| cell division protein MraZ [Neisseria meningitidis ATCC 13091]
 gi|254671183|emb|CBA08311.1| MraZ protein [Neisseria meningitidis alpha153]
 gi|254673390|emb|CBA08692.1| MraZ protein [Neisseria meningitidis alpha275]
 gi|304339249|gb|EFM05327.1| cell division protein MraZ [Neisseria meningitidis ATCC 13091]
 gi|319411061|emb|CBY91461.1| putative MraZ-like protein [Neisseria meningitidis WUE 2594]
 gi|325128827|gb|EGC51686.1| mraZ protein [Neisseria meningitidis N1568]
 gi|325205480|gb|ADZ00933.1| mraZ protein [Neisseria meningitidis M04-240196]
          Length = 151

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLLPAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|227486690|ref|ZP_03917006.1| cell division protein MraZ [Anaerococcus lactolyticus ATCC 51172]
 gi|227235278|gb|EEI85293.1| cell division protein MraZ [Anaerococcus lactolyticus ATCC 51172]
          Length = 137

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D+K R+ +P  FR  L           +      + V   D  +   + +
Sbjct: 1   MFLGEYVHKLDNKNRIMIPSDFREDLEGYFYLTKGPEKS-----LVVYTEDEFQKRSEAL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    + +   +  L     + + +D +GRIL+   ++ + GI +E   +G     ++W
Sbjct: 56  DQLVYENKKNRAIKRLFFSSTVKVALDKQGRILINKSLKDYAGISDEAILIGNNTTIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           + + +     E        + +
Sbjct: 116 DKKIWDDYINEVEVNLSDIMDE 137


>gi|218780980|ref|YP_002432298.1| MraZ protein [Desulfatibacillum alkenivorans AK-01]
 gi|218762364|gb|ACL04830.1| MraZ protein [Desulfatibacillum alkenivorans AK-01]
          Length = 156

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 55/137 (40%), Gaps = 4/137 (2%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
             F        D K R++VP  FR +L    +  +         A+     D  +  E +
Sbjct: 6   KNFRGTSYHSTDEKARITVPARFREVLKDGEVDGVMV--SRMDGALVAYPFDEWQVIENR 63

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGI--ENEVTFVGRGNYF 119
           I   +  + +  Q      GG      D +GRIL+   +R + GI  + E+  VG  ++F
Sbjct: 64  IMTKSKRNAKLRQFRRFFVGGAQECMCDKQGRILVPKDLRDYAGIGAKEEIALVGAVSHF 123

Query: 120 QLWNPQTFRKLQEESRN 136
           ++W+ + +    E+   
Sbjct: 124 EIWDKKKYDAAYEDFEE 140


>gi|319764381|ref|YP_004128318.1| mraz protein [Alicycliphilus denitrificans BC]
 gi|330826600|ref|YP_004389903.1| protein mraZ [Alicycliphilus denitrificans K601]
 gi|317118942|gb|ADV01431.1| MraZ protein [Alicycliphilus denitrificans BC]
 gi|329311972|gb|AEB86387.1| Protein mraZ [Alicycliphilus denitrificans K601]
          Length = 142

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR+SVP   R  L  +    L   +      + V      E   ++I
Sbjct: 1   MFQGASSLSLDVKGRLSVPTRHRDALLAQAGGSLTITKHP-DGCLMVFPRPEWEQVRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    +    ++     G  + ++MD  GR+L++  +R   G+  E   +G G++F+LW
Sbjct: 60  AKLPMSAQWTKRI---FLGNAMDVEMDGTGRVLVSPELREAAGLTKEAILLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   +  +  
Sbjct: 117 DKATYEAKEAAAMQ 130


>gi|121611470|ref|YP_999277.1| cell division protein MraZ [Verminephrobacter eiseniae EF01-2]
 gi|167012283|sp|A1WRK2|MRAZ_VEREI RecName: Full=Protein MraZ
 gi|121556110|gb|ABM60259.1| MraZ protein [Verminephrobacter eiseniae EF01-2]
          Length = 142

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L       L   +      + +      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLVATAAGLLTITRHP-HGCLMLFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           AE    +    ++     G  + +++D+ GR+L++  +R   GI  +   +G G +F+LW
Sbjct: 60  AELPMSAQWWKRI---FLGNAMDVEIDATGRVLISPELRQAAGIAKDTMLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  ++   + ++  
Sbjct: 117 DKASYEAQEAQAMQ 130


>gi|187925451|ref|YP_001897093.1| cell division protein MraZ [Burkholderia phytofirmans PsJN]
 gi|226709958|sp|B2SYY4|MRAZ_BURPP RecName: Full=Protein MraZ
 gi|187716645|gb|ACD17869.1| MraZ protein [Burkholderia phytofirmans PsJN]
          Length = 142

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 63/135 (46%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + ++MD  GR+L++  +R   G+E EVT +G G +F+LW
Sbjct: 60  DKLPMNATWWKRI---FLGNAMDVEMDGAGRVLVSPELRTAGGLEKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  E
Sbjct: 117 DAQTYAAKEQAAMAE 131


>gi|149914517|ref|ZP_01903047.1| MraZ, putative [Roseobacter sp. AzwK-3b]
 gi|149811310|gb|EDM71145.1| MraZ, putative [Roseobacter sp. AzwK-3b]
          Length = 155

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 60/141 (42%), Gaps = 8/141 (5%)

Query: 12  IDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           +DSKGRVS+P  FR +L               +  + D     +     + +   + KI 
Sbjct: 1   MDSKGRVSIPASFRRVLEASDPNWTEGLSPELVIVYGDHRRNYLECYTMEAIAEVDAKID 60

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S++   L  L HG      +D  GR+++   +R    ++ E  F+  G+ FQ+W 
Sbjct: 61  ALPRGSMERRMLQRLFHGQSYPTNVDETGRLVLPAKLRQKIALDAEAFFIAAGDTFQIWK 120

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
           P+T+   +     ++  +L +
Sbjct: 121 PETYESEELARTEQWLEELPE 141



 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 20/67 (29%), Gaps = 2/67 (2%)

Query: 2   SRFLSN-VTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQD-FFFPAISVGNSDLLEYFE 59
             F        +D  GR+ +P   R  +A           D F         S+ L   E
Sbjct: 74  RLFHGQSYPTNVDETGRLVLPAKLRQKIALDAEAFFIAAGDTFQIWKPETYESEELARTE 133

Query: 60  QKIAEYN 66
           Q + E  
Sbjct: 134 QWLEELP 140


>gi|260886496|ref|ZP_05897759.1| MraZ protein [Selenomonas sputigena ATCC 35185]
 gi|330839660|ref|YP_004414240.1| MraZ protein [Selenomonas sputigena ATCC 35185]
 gi|260863639|gb|EEX78139.1| MraZ protein [Selenomonas sputigena ATCC 35185]
 gi|329747424|gb|AEC00781.1| MraZ protein [Selenomonas sputigena ATCC 35185]
          Length = 143

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 48/131 (36%), Gaps = 5/131 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +   T  ID+KGRV +P  FR  L    +             + +   +  E    K+
Sbjct: 1   MLMGEYTHTIDAKGRVILPVDFRPELGGSFVITKGL-----DSCLFLYGEEEWERLSAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +A   +     G   L++D +GR L+   +R +  ++ +V   G     ++W
Sbjct: 56  KALPMSKPEARAFARFFFAGARKLELDRQGRFLVPANLRAYASLKKDVVLNGVMTRAEIW 115

Query: 123 NPQTFRKLQEE 133
           +   +     E
Sbjct: 116 SRTAWDAYNAE 126


>gi|328950950|ref|YP_004368285.1| Protein mraZ [Marinithermus hydrothermalis DSM 14884]
 gi|328451274|gb|AEB12175.1| Protein mraZ [Marinithermus hydrothermalis DSM 14884]
          Length = 142

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 51/132 (38%), Gaps = 5/132 (3%)

Query: 6   SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEY 65
                 +D KGRV +P  FR  +    +             + V         E+++   
Sbjct: 4   GEYQYSLDDKGRVVIPAPFREFIEDGLVLTRGM-----EGCLYVFPLANWRKIEEQLVGL 58

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
           +    ++       + G    ++D++GR+L+   +R F G+EN+V   G  N  ++W+  
Sbjct: 59  SLTDAESRAFVRFFYSGAYKTRLDNQGRVLIPPTLRQFAGLENDVIIAGAPNRLEIWSEA 118

Query: 126 TFRKLQEESRNE 137
            + +  +     
Sbjct: 119 RWWEAIQNVMQN 130


>gi|304437332|ref|ZP_07397291.1| cell division protein MraZ [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369588|gb|EFM23254.1| cell division protein MraZ [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 147

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 50/140 (35%), Gaps = 7/140 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+   T  ID+KGRV +P  FR  L           +     ++ +      + F  K+
Sbjct: 1   MFMGEYTHSIDAKGRVILPADFRQELG----VSFIITKGL-DGSLFLFPQAAWDEFTAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFT--GIENEVTFVGRGNYFQ 120
              +     A         G   L+ D +GR L+   +R +   G++ +V   G     +
Sbjct: 56  RTLSIADPNARAFVRFFIAGARTLECDKQGRFLVPANLRDYADIGLKQDVILTGADTRIE 115

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W  + + +   E       
Sbjct: 116 VWAKEKWARYAGEVDPNITE 135


>gi|218768821|ref|YP_002343333.1| cell division protein MraZ [Neisseria meningitidis Z2491]
 gi|20139194|sp|Q9JSY8|MRAZ_NEIMA RecName: Full=Protein MraZ
 gi|121052829|emb|CAM09177.1| conserved hypothetical protein [Neisseria meningitidis Z2491]
          Length = 151

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLVPAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|327404191|ref|YP_004345029.1| Protein mraZ [Fluviicola taffensis DSM 16823]
 gi|327319699|gb|AEA44191.1| Protein mraZ [Fluviicola taffensis DSM 16823]
          Length = 153

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 57/140 (40%), Gaps = 1/140 (0%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M+  +     K+D KGR   P   R  L+          + F    +++   +  E    
Sbjct: 1   MAGLVGEFEVKLDGKGRFLFPAGLRKQLSPDAQEQFMLNKGFEE-CLTLYPMNEWEKLSV 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K+++ N F  Q      L H G   + +D+ GR+L+        G++ +V  +   +  +
Sbjct: 60  KLSKLNLFKPQNRMFYRLFHQGAKQIALDNAGRVLIPVMHMERVGLDKDVMLIAYNDRIE 119

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+   + +L + S  ++  
Sbjct: 120 IWDKSKYFQLIDGSMADFAD 139


>gi|242278176|ref|YP_002990305.1| MraZ protein [Desulfovibrio salexigens DSM 2638]
 gi|259509650|sp|C6BYH5|MRAZ_DESAD RecName: Full=Protein MraZ
 gi|242121070|gb|ACS78766.1| MraZ protein [Desulfovibrio salexigens DSM 2638]
          Length = 149

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 58/141 (41%), Gaps = 1/141 (0%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F  +  + +D+KGR+ +   +R  +              F   I           E+K+ 
Sbjct: 3   FRGHAHRSMDAKGRLMLTPEYRDQVYSDSPDG-CVTLTIFEGNIVGFTPPDWAILEEKLT 61

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S +      ++  G   + +D +GRI +  ++R    ++ +V   G G+ F++W+
Sbjct: 62  SIKSPSRKLRNFIRIIISGSEEVSLDKQGRITIPSYLRKSGKLDKDVVLAGVGDRFEIWD 121

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            + +  L E+  ++   +L +
Sbjct: 122 KREYEALLEQDFDDVSDELAE 142


>gi|332654097|ref|ZP_08419841.1| MraZ protein [Ruminococcaceae bacterium D16]
 gi|332517183|gb|EGJ46788.1| MraZ protein [Ruminococcaceae bacterium D16]
          Length = 137

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 54/128 (42%), Gaps = 8/128 (6%)

Query: 6   SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEY 65
                 ID+KGR+ +P   R  L       +          +++      + F +K A  
Sbjct: 3   GTYEHSIDAKGRLFIPAKLREELGVSFYLAMGI-----DTCLAIYPQATWDKFTEKFASL 57

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
                +  +    +    +  ++DS+GRI++   +R +  +E +   +G  +  ++W+ +
Sbjct: 58  PMTQSRVMR---PLFANAVKCELDSQGRIVIPQKLRKYAQLEKDAVILGVNDRAEIWSAK 114

Query: 126 TFRKLQEE 133
            +++ +EE
Sbjct: 115 LWQEDEEE 122


>gi|330815434|ref|YP_004359139.1| MraZ protein [Burkholderia gladioli BSR3]
 gi|327367827|gb|AEA59183.1| MraZ protein [Burkholderia gladioli BSR3]
          Length = 142

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G    + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNASDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DSQTYTAKEQAAMAQ 131


>gi|254805558|ref|YP_003083779.1| MraZ protein [Neisseria meningitidis alpha14]
 gi|296313572|ref|ZP_06863513.1| MraZ protein [Neisseria polysaccharea ATCC 43768]
 gi|254669100|emb|CBA07676.1| MraZ protein [Neisseria meningitidis alpha14]
 gi|296839873|gb|EFH23811.1| MraZ protein [Neisseria polysaccharea ATCC 43768]
 gi|325134877|gb|EGC57510.1| mraZ protein [Neisseria meningitidis M13399]
 gi|325198907|gb|ADY94363.1| mraZ protein [Neisseria meningitidis G2136]
          Length = 151

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLVPAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|197105794|ref|YP_002131171.1| hypothetical protein PHZ_c2332 [Phenylobacterium zucineum HLK1]
 gi|226709998|sp|B4RFS9|MRAZ_PHEZH RecName: Full=Protein MraZ
 gi|196479214|gb|ACG78742.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 160

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 1/142 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FLS   +++D+K R+ VP  FR  LA      ++CF       I  G   L + +   I
Sbjct: 1   MFLSTFEKQLDAKRRIVVPQEFR-ALAAGPFDGVFCFPSIEADCIEGGGKALFDRYNGVI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E        + L   V GG   L  D+ GRI + + +    G+ + VT VG G+ FQ+W
Sbjct: 60  EELEFGDPLRSALETSVLGGMAKLSFDTAGRITLPESLCDLFGLTDWVTIVGLGDRFQIW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
             + F   +   R    + L +
Sbjct: 120 EREAFNAHRAAQRELARQGLAE 141


>gi|238026123|ref|YP_002910354.1| cell division protein MraZ [Burkholderia glumae BGR1]
 gi|237875317|gb|ACR27650.1| MraZ protein [Burkholderia glumae BGR1]
          Length = 142

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DAQTYTAKEQAAMAQ 131


>gi|38492456|pdb|1N0E|A Chain A, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492457|pdb|1N0E|B Chain B, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492458|pdb|1N0E|C Chain C, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492459|pdb|1N0E|D Chain D, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492460|pdb|1N0E|E Chain E, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492461|pdb|1N0E|F Chain F, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492462|pdb|1N0E|G Chain G, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492463|pdb|1N0E|H Chain H, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492464|pdb|1N0F|A Chain A, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492465|pdb|1N0F|B Chain B, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492466|pdb|1N0F|C Chain C, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492467|pdb|1N0F|D Chain D, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492468|pdb|1N0F|E Chain E, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492469|pdb|1N0F|F Chain F, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492470|pdb|1N0F|G Chain G, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492471|pdb|1N0F|H Chain H, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492472|pdb|1N0G|A Chain A, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
 gi|38492473|pdb|1N0G|B Chain B, Crystal Structure Of A Cell Division And Cell Wall
           Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae:
           Indication Of A Novel Fold With A Possible New Conserved
           Sequence Motif
          Length = 166

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      +D+K R+S+P   R                 F   + V      + + ++ 
Sbjct: 26  MLLGTFNITLDAKNRISLPAKLRA-----FFEGSIVINRGFENCLEVRKPQDFQKYFEQF 80

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W
Sbjct: 81  NSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIW 140

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      S +     + ++
Sbjct: 141 DKKLYEDYLANSES--LETVAER 161


>gi|300933363|ref|ZP_07148619.1| cell division protein MraZ [Corynebacterium resistens DSM 45100]
          Length = 143

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  L    +            ++++   D      +K 
Sbjct: 1   MFFGTFTPKLDDKGRLTLPAKFRADLEDGLMVVK-----GQDRSLAIYPRDEFLVRARKA 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A  +  + +A      +         DS+GRI +    R + G+  +   +G  ++ ++W
Sbjct: 56  AAASRTNPKARAFVRNLAASADEQNPDSQGRITIASGHREYAGLSKQCVVIGNVDFVEVW 115

Query: 123 NPQTFRKLQEESRNEYCR 140
           + + +++       ++  
Sbjct: 116 DAEAWQEYSSRYEEDFSA 133


>gi|292669651|ref|ZP_06603077.1| cell division protein MraZ [Selenomonas noxia ATCC 43541]
 gi|292648448|gb|EFF66420.1| cell division protein MraZ [Selenomonas noxia ATCC 43541]
          Length = 147

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 51/140 (36%), Gaps = 7/140 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGRV +P  FR  L           +     ++ +      + F  K+
Sbjct: 1   MFMGEYAHSIDAKGRVILPADFRQELG----VSFIITKGL-DGSLFLFPQAAWDEFAAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFT--GIENEVTFVGRGNYFQ 120
              +     A   +     G   L+ D +GR L+   +R +   G++ +V   G     +
Sbjct: 56  RTLSIADPNARAFARFFIAGARTLECDKQGRFLVPANLRTYANIGLKQDVILTGADARIE 115

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+ + + +   E       
Sbjct: 116 VWDREKWERYAGEVDPNITE 135


>gi|121606315|ref|YP_983644.1| cell division protein MraZ [Polaromonas naphthalenivorans CJ2]
 gi|120595284|gb|ABM38723.1| MraZ protein [Polaromonas naphthalenivorans CJ2]
          Length = 150

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 4/133 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR+SVP   R  L           +      + +      E F ++IA
Sbjct: 10  FQGASFLALDAKGRLSVPARHRDALGASHSGQFTITKHP-HGCLMIFPLSEWEKFRERIA 68

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +    ++     G  + + MD+ GRIL++  +R   GI  +   +G GNYF+LW+
Sbjct: 69  SLPMQAQWWKRI---FLGNAMDVAMDATGRILVSPELRKAAGISKDAVLLGMGNYFELWD 125

Query: 124 PQTFRKLQEESRN 136
             T+   + E   
Sbjct: 126 AATYAAQEAEQMK 138


>gi|221065129|ref|ZP_03541234.1| MraZ protein [Comamonas testosteroni KF-1]
 gi|220710152|gb|EED65520.1| MraZ protein [Comamonas testosteroni KF-1]
          Length = 142

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D KGR+SVP   R  L       +   +      + +        F +++
Sbjct: 1   MFQGASSLNLDGKGRLSVPTRHRDALLSLAEGQVTFTKHP-DGCLLLFPRPEWLQFRERV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    +    ++     G  +  +MD+ GR+L++  +R  TG+  EV  +G G +F++W
Sbjct: 60  AQLPITAQWWKRI---FLGNAMDAEMDATGRLLISPELREATGLTKEVLMLGMGAHFEVW 116

Query: 123 NPQTFRKLQEESRNE 137
           +  T+   + E+R +
Sbjct: 117 DKATYEMREAEARQQ 131


>gi|329115568|ref|ZP_08244290.1| Protein MraZ [Acetobacter pomorum DM001]
 gi|326694996|gb|EGE46715.1| Protein MraZ [Acetobacter pomorum DM001]
          Length = 185

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 64/139 (46%), Gaps = 5/139 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITD---LYCFQDFFFPAISVGNSDLLEYFEQ 60
           FL     + D+KGR+S+P  FR++L  +       +        P +    +       +
Sbjct: 28  FLGTHENRFDAKGRISIPAGFRSVLKTQQTEGDALMILRPSHTLPCVEAWPAVAFARLTE 87

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENE--VTFVGRGNY 118
            +   + FS + + L+  ++     +  D EGRI++ +F+R   G+ +     F+G G  
Sbjct: 88  PLDRLDMFSDEHDDLAAALYADAYPIDPDREGRIILPEFLRDHAGLADSPTAAFMGVGRI 147

Query: 119 FQLWNPQTFRKLQEESRNE 137
           FQ+W PQ  ++ + E+R  
Sbjct: 148 FQIWEPQAAQQRRVEARQR 166


>gi|167838013|ref|ZP_02464872.1| hypothetical protein Bpse38_15977 [Burkholderia thailandensis
           MSMB43]
          Length = 142

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 63/135 (46%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRTKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +D  GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDGAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DAQTYTAKEQAAMAQ 131


>gi|53720644|ref|YP_109630.1| cell division protein MraZ [Burkholderia pseudomallei K96243]
 gi|53726016|ref|YP_104103.1| cell division protein MraZ [Burkholderia mallei ATCC 23344]
 gi|83720857|ref|YP_441657.1| cell division protein MraZ [Burkholderia thailandensis E264]
 gi|121599011|ref|YP_991830.1| cell division protein MraZ [Burkholderia mallei SAVP1]
 gi|124383567|ref|YP_001027323.1| cell division protein MraZ [Burkholderia mallei NCTC 10229]
 gi|126441175|ref|YP_001060544.1| cell division protein MraZ [Burkholderia pseudomallei 668]
 gi|126448245|ref|YP_001082740.1| cell division protein MraZ [Burkholderia mallei NCTC 10247]
 gi|126455248|ref|YP_001067795.1| cell division protein MraZ [Burkholderia pseudomallei 1106a]
 gi|166998646|ref|ZP_02264504.1| mraZ protein [Burkholderia mallei PRL-20]
 gi|167580464|ref|ZP_02373338.1| hypothetical protein BthaT_20081 [Burkholderia thailandensis TXDOH]
 gi|167618572|ref|ZP_02387203.1| hypothetical protein BthaB_19850 [Burkholderia thailandensis Bt4]
 gi|167721352|ref|ZP_02404588.1| hypothetical protein BpseD_20248 [Burkholderia pseudomallei DM98]
 gi|167740321|ref|ZP_02413095.1| hypothetical protein Bpse14_19820 [Burkholderia pseudomallei 14]
 gi|167817539|ref|ZP_02449219.1| hypothetical protein Bpse9_20546 [Burkholderia pseudomallei 91]
 gi|167825938|ref|ZP_02457409.1| hypothetical protein Bpseu9_19874 [Burkholderia pseudomallei 9]
 gi|167847425|ref|ZP_02472933.1| hypothetical protein BpseB_19279 [Burkholderia pseudomallei B7210]
 gi|167896014|ref|ZP_02483416.1| hypothetical protein Bpse7_19883 [Burkholderia pseudomallei 7894]
 gi|167904400|ref|ZP_02491605.1| hypothetical protein BpseN_19263 [Burkholderia pseudomallei NCTC
           13177]
 gi|167912661|ref|ZP_02499752.1| hypothetical protein Bpse112_19391 [Burkholderia pseudomallei 112]
 gi|167920628|ref|ZP_02507719.1| hypothetical protein BpseBC_18926 [Burkholderia pseudomallei
           BCC215]
 gi|217425695|ref|ZP_03457185.1| protein MraZ [Burkholderia pseudomallei 576]
 gi|226199596|ref|ZP_03795152.1| mraZ protein [Burkholderia pseudomallei Pakistan 9]
 gi|237813928|ref|YP_002898379.1| MraZ protein [Burkholderia pseudomallei MSHR346]
 gi|242316834|ref|ZP_04815850.1| mraZ protein [Burkholderia pseudomallei 1106b]
 gi|254178823|ref|ZP_04885477.1| mraZ protein [Burkholderia mallei ATCC 10399]
 gi|254180537|ref|ZP_04887135.1| mraZ protein [Burkholderia pseudomallei 1655]
 gi|254191021|ref|ZP_04897527.1| mraZ protein [Burkholderia pseudomallei Pasteur 52237]
 gi|254202824|ref|ZP_04909187.1| mraZ protein [Burkholderia mallei FMH]
 gi|254260893|ref|ZP_04951947.1| mraZ protein [Burkholderia pseudomallei 1710a]
 gi|254299375|ref|ZP_04966825.1| mraZ protein [Burkholderia pseudomallei 406e]
 gi|254357630|ref|ZP_04973904.1| mraZ protein [Burkholderia mallei 2002721280]
 gi|257137826|ref|ZP_05586088.1| cell division protein MraZ [Burkholderia thailandensis E264]
 gi|90103481|sp|Q62GR8|MRAZ_BURMA RecName: Full=Protein MraZ
 gi|90103482|sp|Q63QI8|MRAZ_BURPS RecName: Full=Protein MraZ
 gi|123537608|sp|Q2SZJ2|MRAZ_BURTA RecName: Full=Protein MraZ
 gi|167011862|sp|A3MR54|MRAZ_BURM7 RecName: Full=Protein MraZ
 gi|167011863|sp|A2S5V4|MRAZ_BURM9 RecName: Full=Protein MraZ
 gi|167011864|sp|A1V0S7|MRAZ_BURMS RecName: Full=Protein MraZ
 gi|167011865|sp|A3NZM4|MRAZ_BURP0 RecName: Full=Protein MraZ
 gi|167011866|sp|A3NDX3|MRAZ_BURP6 RecName: Full=Protein MraZ
 gi|52211058|emb|CAH37046.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52429439|gb|AAU50032.1| mraZ protein [Burkholderia mallei ATCC 23344]
 gi|83654682|gb|ABC38745.1| mraZ protein [Burkholderia thailandensis E264]
 gi|121227821|gb|ABM50339.1| mraZ protein [Burkholderia mallei SAVP1]
 gi|124291587|gb|ABN00856.1| mraZ protein [Burkholderia mallei NCTC 10229]
 gi|126220668|gb|ABN84174.1| protein MraZ [Burkholderia pseudomallei 668]
 gi|126228890|gb|ABN92430.1| mraZ protein [Burkholderia pseudomallei 1106a]
 gi|126241115|gb|ABO04208.1| mraZ protein [Burkholderia mallei NCTC 10247]
 gi|147747071|gb|EDK54148.1| mraZ protein [Burkholderia mallei FMH]
 gi|148026694|gb|EDK84779.1| mraZ protein [Burkholderia mallei 2002721280]
 gi|157809050|gb|EDO86220.1| mraZ protein [Burkholderia pseudomallei 406e]
 gi|157938695|gb|EDO94365.1| mraZ protein [Burkholderia pseudomallei Pasteur 52237]
 gi|160694737|gb|EDP84745.1| mraZ protein [Burkholderia mallei ATCC 10399]
 gi|184211076|gb|EDU08119.1| mraZ protein [Burkholderia pseudomallei 1655]
 gi|217391283|gb|EEC31315.1| protein MraZ [Burkholderia pseudomallei 576]
 gi|225928342|gb|EEH24373.1| mraZ protein [Burkholderia pseudomallei Pakistan 9]
 gi|237506662|gb|ACQ98980.1| MraZ protein [Burkholderia pseudomallei MSHR346]
 gi|242140073|gb|EES26475.1| mraZ protein [Burkholderia pseudomallei 1106b]
 gi|243065325|gb|EES47511.1| mraZ protein [Burkholderia mallei PRL-20]
 gi|254219582|gb|EET08966.1| mraZ protein [Burkholderia pseudomallei 1710a]
          Length = 142

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DAQTYTAKEQAAMAQ 131


>gi|160891412|ref|ZP_02072415.1| hypothetical protein BACUNI_03862 [Bacteroides uniformis ATCC 8492]
 gi|156858819|gb|EDO52250.1| hypothetical protein BACUNI_03862 [Bacteroides uniformis ATCC 8492]
          Length = 158

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M +FL N+  K D+KGRV +P  FR  L       L   +D +   + +    +    + 
Sbjct: 1   MIQFLGNIEAKADAKGRVFIPATFRKQLQAASEERLVLRKDVYQDCLVLYPESVWFATQN 60

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +   +          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 61  QLRCRLNKWNAKQQMIFRQFVSDAEVMTPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +      +E+   L +
Sbjct: 121 EIWAKERADQPFMN-PDEFSEALEE 144


>gi|257066697|ref|YP_003152953.1| MraZ protein [Anaerococcus prevotii DSM 20548]
 gi|256798577|gb|ACV29232.1| MraZ protein [Anaerococcus prevotii DSM 20548]
          Length = 137

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL   T K+DSK R+ +P  FR  L++         +      + +   +      +K+
Sbjct: 1   MFLGEFTHKLDSKNRIMIPSEFRDDLSENFYITKGPEKS-----LVIYTEEEFIKQSEKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 + +   +  L     +   +D +GR+L+   +R ++ I+ E   +G  +  +LW
Sbjct: 56  DSLEVQNKKNRAIKRLFFSSTVKASLDKQGRVLLNKNLRDYSEIKEEAMIIGNNSTIELW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +    +E        + +
Sbjct: 116 DRANWEAYIDEVEVNLSDIMDE 137


>gi|270295457|ref|ZP_06201658.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317478455|ref|ZP_07937615.1| mraZ protein [Bacteroides sp. 4_1_36]
 gi|270274704|gb|EFA20565.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316905344|gb|EFV27138.1| mraZ protein [Bacteroides sp. 4_1_36]
          Length = 158

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M +FL N+  K D+KGRV +P  FR  L       L   +D +   + +    +    + 
Sbjct: 1   MIQFLGNIEAKADAKGRVFIPATFRKQLQAASEERLVLRKDVYQDCLVLYPESVWFATQN 60

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +   +          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 61  QLRCRLNKWNAKQQMIFRQFVSDAEVMTPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +      +E+   L +
Sbjct: 121 EIWAKERADQPFMN-PDEFSEALEE 144


>gi|302383892|ref|YP_003819715.1| MraZ domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194520|gb|ADL02092.1| MraZ domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 155

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 1/143 (0%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL    +++D K R+ +P  FRT  A      ++CF       +  G   L+  +   I
Sbjct: 1   MFLGTSEKQLDGKRRLLIPQEFRTA-ANGAEHGVFCFFSVESDCLEAGGDKLMAEYVAMI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                       L   V+GG   L  D  GRI + + +    G+  +V  VG G  FQ+W
Sbjct: 60  EALPFGDDWRTALEETVYGGQKQLAYDGGGRITLPESLCEEAGLGEDVVIVGMGPRFQIW 119

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           +   +   +++ R    + + ++
Sbjct: 120 DRARWNDRKDDRRALARKAMRER 142


>gi|224536606|ref|ZP_03677145.1| hypothetical protein BACCELL_01481 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521697|gb|EEF90802.1| hypothetical protein BACCELL_01481 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 171

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +    +    + 
Sbjct: 14  MIRFLGNIEAKTDAKGRVFIPAGFRRQLQSASEERLVLRKDVFQDCLVLYPESVWFKTQN 73

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +   +          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 74  QLRRRLNKWNAKHQDIFRQFVSDAEIMIPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 133

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +    S  E+   L  
Sbjct: 134 EIWAKEKTEQPFV-SPEEFSEALQD 157


>gi|134294638|ref|YP_001118373.1| cell division protein MraZ [Burkholderia vietnamiensis G4]
 gi|161526014|ref|YP_001581026.1| cell division protein MraZ [Burkholderia multivorans ATCC 17616]
 gi|167586010|ref|ZP_02378398.1| MraZ protein [Burkholderia ubonensis Bu]
 gi|171316198|ref|ZP_02905421.1| MraZ protein [Burkholderia ambifaria MEX-5]
 gi|189349269|ref|YP_001944897.1| cell division protein MraZ [Burkholderia multivorans ATCC 17616]
 gi|221202505|ref|ZP_03575535.1| mraZ protein [Burkholderia multivorans CGD2M]
 gi|221208173|ref|ZP_03581178.1| mraZ protein [Burkholderia multivorans CGD2]
 gi|221213286|ref|ZP_03586261.1| mraZ protein [Burkholderia multivorans CGD1]
 gi|254253340|ref|ZP_04946658.1| hypothetical protein BDAG_02601 [Burkholderia dolosa AUO158]
 gi|167011867|sp|A4JB85|MRAZ_BURVG RecName: Full=Protein MraZ
 gi|226709957|sp|A9AJ25|MRAZ_BURM1 RecName: Full=Protein MraZ
 gi|124895949|gb|EAY69829.1| hypothetical protein BDAG_02601 [Burkholderia dolosa AUO158]
 gi|134137795|gb|ABO53538.1| MraZ protein [Burkholderia vietnamiensis G4]
 gi|160343443|gb|ABX16529.1| MraZ protein [Burkholderia multivorans ATCC 17616]
 gi|171098612|gb|EDT43409.1| MraZ protein [Burkholderia ambifaria MEX-5]
 gi|189333291|dbj|BAG42361.1| MraZ protein [Burkholderia multivorans ATCC 17616]
 gi|221166738|gb|EED99209.1| mraZ protein [Burkholderia multivorans CGD1]
 gi|221172076|gb|EEE04518.1| mraZ protein [Burkholderia multivorans CGD2]
 gi|221177600|gb|EEE10017.1| mraZ protein [Burkholderia multivorans CGD2M]
 gi|325519764|gb|EGC99069.1| cell division protein MraZ [Burkholderia sp. TJI49]
          Length = 142

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPARYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DSQTYIAKEQAAMAQ 131


>gi|16126801|ref|NP_421365.1| hypothetical protein CC_2563 [Caulobacter crescentus CB15]
 gi|221235582|ref|YP_002518019.1| cell division protein MraZ [Caulobacter crescentus NA1000]
 gi|20139114|sp|Q9A594|MRAZ_CAUCR RecName: Full=Protein MraZ
 gi|254813272|sp|B8H0A3|MRAZ_CAUCN RecName: Full=Protein MraZ
 gi|13424129|gb|AAK24533.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964755|gb|ACL96111.1| cell division protein mraZ [Caulobacter crescentus NA1000]
          Length = 156

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FLS   +++DSK R+ VP  FR  ++      ++CF       +  G   L + ++  I
Sbjct: 1   MFLSTFEKQLDSKRRIVVPQEFRAAVSGPF-DGIFCFPSIEADCLEAGGKALFDRYQAVI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E          L   + GG   L  D+ GRI + D +    G+ + V  VG G  FQ+W
Sbjct: 60  EEMPFGDPTRTALETSILGGMAKLTFDTAGRITLPDHLCDMFGLTDSVAVVGMGERFQIW 119

Query: 123 NPQTFRKLQEESRNEYCRQ 141
           + + F+  + + R +  R+
Sbjct: 120 SREAFQAHRAQQR-DLARE 137


>gi|261401194|ref|ZP_05987319.1| MraZ protein [Neisseria lactamica ATCC 23970]
 gi|313667805|ref|YP_004048089.1| protein MraZ [Neisseria lactamica ST-640]
 gi|269208875|gb|EEZ75330.1| MraZ protein [Neisseria lactamica ATCC 23970]
 gi|309379056|emb|CBX22358.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005267|emb|CBN86700.1| protein MraZ [Neisseria lactamica 020-06]
          Length = 151

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 57/141 (40%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ D  GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDGAGRVLLPAGLRKRVVFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPEELA 141


>gi|319791659|ref|YP_004153299.1| mraz protein [Variovorax paradoxus EPS]
 gi|315594122|gb|ADU35188.1| MraZ protein [Variovorax paradoxus EPS]
          Length = 142

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L+      L   +      + V      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLSATAGGQLTITKHP-HGCLMVFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    +   +  G  + ++MD  GRIL++  +R  TGI  +   +G GN+F+LW
Sbjct: 60  AALPMSAQWWKR---VFLGNAMDVEMDGTGRILVSPELRAATGIARDTLLLGMGNHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   + E+  
Sbjct: 117 DKATYEAKEAEATQ 130


>gi|319786244|ref|YP_004145719.1| MraZ protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317464756|gb|ADV26488.1| MraZ protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 148

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 3/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYC-FQDFFFPAISVGNSDLLEYFEQK 61
            F       +D KGRV++P  +R ++A+ C   L   +  F   ++ +      E     
Sbjct: 1   MFQGETAITVDDKGRVAIPTAYRELVARECGNRLVITYNPFEAGSLYLYPYAEWERVRDS 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +     +   QL L + G    +++D  GRI +    R   GIE +   +G G+ F+L
Sbjct: 61  VNKLPSTRMAHRQLQLKLVGAATPVELDGNGRISVPASHRSAVGIEKKAVLLGMGDKFEL 120

Query: 122 WNPQTFRKLQEE--SRNEYCRQLLQ 144
           W+ Q          S  +    +L 
Sbjct: 121 WSEQAHHAQIRRTLSDEDLSEHMLD 145


>gi|120404504|ref|YP_954333.1| cell division protein MraZ [Mycobacterium vanbaalenii PYR-1]
 gi|167012260|sp|A1TAX7|MRAZ_MYCVP RecName: Full=Protein MraZ
 gi|119957322|gb|ABM14327.1| protein of unknown function UPF0040 [Mycobacterium vanbaalenii
           PYR-1]
          Length = 144

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 52/138 (37%), Gaps = 4/138 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    T K+D KGR+++P  FR  LA      L   +           ++  E   +  
Sbjct: 1   MFFGTYTPKLDDKGRLTLPAKFRDALA----GGLMVTKSQDHSLAVHPRAEFEEMIAEIS 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A+    + QA      +         D++GRI ++   R +  +  E    G   + ++W
Sbjct: 57  AKAKRGNPQARAYLRNLAASTDEQYPDAQGRITLSAEHRRYANLTKECVVTGSIGFLEIW 116

Query: 123 NPQTFRKLQEESRNEYCR 140
           + Q ++  QE     +  
Sbjct: 117 DAQAWQDYQELHEENFSA 134


>gi|167564208|ref|ZP_02357124.1| hypothetical protein BoklE_16754 [Burkholderia oklahomensis EO147]
 gi|167571358|ref|ZP_02364232.1| hypothetical protein BoklC_16067 [Burkholderia oklahomensis C6786]
          Length = 142

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DAQTYIAKEQAAMAQ 131


>gi|59801881|ref|YP_208593.1| cell division protein MraZ [Neisseria gonorrhoeae FA 1090]
 gi|194099360|ref|YP_002002460.1| cell division protein MraZ [Neisseria gonorrhoeae NCCP11945]
 gi|239999616|ref|ZP_04719540.1| cell division protein MraZ [Neisseria gonorrhoeae 35/02]
 gi|240014791|ref|ZP_04721704.1| cell division protein MraZ [Neisseria gonorrhoeae DGI18]
 gi|240017239|ref|ZP_04723779.1| cell division protein MraZ [Neisseria gonorrhoeae FA6140]
 gi|240081124|ref|ZP_04725667.1| cell division protein MraZ [Neisseria gonorrhoeae FA19]
 gi|240113336|ref|ZP_04727826.1| cell division protein MraZ [Neisseria gonorrhoeae MS11]
 gi|240116317|ref|ZP_04730379.1| cell division protein MraZ [Neisseria gonorrhoeae PID18]
 gi|240118604|ref|ZP_04732666.1| cell division protein MraZ [Neisseria gonorrhoeae PID1]
 gi|240121314|ref|ZP_04734276.1| cell division protein MraZ [Neisseria gonorrhoeae PID24-1]
 gi|240124147|ref|ZP_04737103.1| cell division protein MraZ [Neisseria gonorrhoeae PID332]
 gi|240126237|ref|ZP_04739123.1| cell division protein MraZ [Neisseria gonorrhoeae SK-92-679]
 gi|240128817|ref|ZP_04741478.1| cell division protein MraZ [Neisseria gonorrhoeae SK-93-1035]
 gi|254494331|ref|ZP_05107502.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260439866|ref|ZP_05793682.1| cell division protein MraZ [Neisseria gonorrhoeae DGI2]
 gi|268595427|ref|ZP_06129594.1| protein mraZ [Neisseria gonorrhoeae 35/02]
 gi|268597235|ref|ZP_06131402.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599410|ref|ZP_06133577.1| mraZ [Neisseria gonorrhoeae MS11]
 gi|268601984|ref|ZP_06136151.1| mraZ [Neisseria gonorrhoeae PID18]
 gi|268604316|ref|ZP_06138483.1| mraZ [Neisseria gonorrhoeae PID1]
 gi|268682772|ref|ZP_06149634.1| mraZ [Neisseria gonorrhoeae PID332]
 gi|268684818|ref|ZP_06151680.1| mraZ [Neisseria gonorrhoeae SK-92-679]
 gi|268687199|ref|ZP_06154061.1| mraZ [Neisseria gonorrhoeae SK-93-1035]
 gi|291043142|ref|ZP_06568865.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398478|ref|ZP_06642656.1| mraZ protein [Neisseria gonorrhoeae F62]
 gi|68565669|sp|Q5F6K6|MRAZ_NEIG1 RecName: Full=Protein MraZ
 gi|226709996|sp|B4RQD8|MRAZ_NEIG2 RecName: Full=Protein MraZ
 gi|59718776|gb|AAW90181.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934650|gb|ACF30474.1| Protein mraZ [Neisseria gonorrhoeae NCCP11945]
 gi|226513371|gb|EEH62716.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548816|gb|EEZ44234.1| protein mraZ [Neisseria gonorrhoeae 35/02]
 gi|268551023|gb|EEZ46042.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583541|gb|EEZ48217.1| mraZ [Neisseria gonorrhoeae MS11]
 gi|268586115|gb|EEZ50791.1| mraZ [Neisseria gonorrhoeae PID18]
 gi|268588447|gb|EEZ53123.1| mraZ [Neisseria gonorrhoeae PID1]
 gi|268623056|gb|EEZ55456.1| mraZ [Neisseria gonorrhoeae PID332]
 gi|268625102|gb|EEZ57502.1| mraZ [Neisseria gonorrhoeae SK-92-679]
 gi|268627483|gb|EEZ59883.1| mraZ [Neisseria gonorrhoeae SK-93-1035]
 gi|291012748|gb|EFE04731.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610949|gb|EFF40046.1| mraZ protein [Neisseria gonorrhoeae F62]
 gi|317164867|gb|ADV08408.1| cell division protein MraZ [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 151

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVATLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLVPAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|91785302|ref|YP_560508.1| cell division protein MraZ [Burkholderia xenovorans LB400]
 gi|123168037|sp|Q13TY3|MRAZ_BURXL RecName: Full=Protein MraZ
 gi|91689256|gb|ABE32456.1| Putative cell division protein, MraZ [Burkholderia xenovorans
           LB400]
          Length = 142

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 61/135 (45%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITRHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R   G+  EVT +G G +F+LW
Sbjct: 60  DKLPMNATWWKRI---FLGNAMDVDMDGAGRVLVSPELRTAGGLAKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  E
Sbjct: 117 DAQTYTAKEQAAMAE 131


>gi|313895995|ref|ZP_07829549.1| protein MraZ [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320530961|ref|ZP_08031994.1| protein MraZ [Selenomonas artemidis F0399]
 gi|312975420|gb|EFR40881.1| protein MraZ [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320136826|gb|EFW28775.1| protein MraZ [Selenomonas artemidis F0399]
          Length = 147

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 50/140 (35%), Gaps = 7/140 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F+      ID+KGRV +P  FR  L           +     ++ +      + F  K+
Sbjct: 1   MFMGEYAHSIDAKGRVILPADFRQELG----VSFIITKGL-DGSLFLFPQAAWDEFAAKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFT--GIENEVTFVGRGNYFQ 120
              +     A   +     G   L+ D +GR L+   +R +   G++ +V   G     +
Sbjct: 56  RTLSIADPNARAFARFFIAGARTLECDKQGRFLVPANLRTYANIGLKQDVILTGADARIE 115

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W+ + +     E       
Sbjct: 116 VWDKEKWLSYAGEVDPNITE 135


>gi|239813917|ref|YP_002942827.1| cell division protein MraZ [Variovorax paradoxus S110]
 gi|259509666|sp|C5CNE5|MRAZ_VARPS RecName: Full=Protein MraZ
 gi|239800494|gb|ACS17561.1| MraZ protein [Variovorax paradoxus S110]
          Length = 142

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L+      L   +      + V      E F ++I
Sbjct: 1   MFQGASSLSLDAKGRLSVPTRHRDVLSATAGGQLTITKHP-HGCLMVFPRPEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    +   +  G  + ++MD  GRIL++  +R  TGI  +   +G GN+F+LW
Sbjct: 60  AALPMSAQWWKR---VFLGNAMDVEMDGTGRILVSPELRAATGIVRDTLLLGMGNHFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   + E+  
Sbjct: 117 DKATYEAKEAEATQ 130


>gi|110634366|ref|YP_674574.1| cell division protein MraZ [Mesorhizobium sp. BNC1]
 gi|110285350|gb|ABG63409.1| protein MraZ [Chelativorans sp. BNC1]
          Length = 156

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 66/140 (47%), Positives = 90/140 (64%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFLS+   KID+KGRVSVP  FR+++ +R   +LY  +    PA+ VG  DLL+ +EQ
Sbjct: 1   MDRFLSSAVNKIDTKGRVSVPAHFRSVVQRRGFAELYALRALDVPAMDVGGPDLLDRYEQ 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PF   A+ +S  VHG G FLK+D +GRI +TDFIR  TGI  EV FVGRG +FQ
Sbjct: 61  RIALEDPFLQTADDMSFFVHGDGSFLKLDQDGRISITDFIREHTGIATEVAFVGRGLFFQ 120

Query: 121 LWNPQTFRKLQEESRNEYCR 140
           +W P+  +      R+   +
Sbjct: 121 MWEPERLKAHAAAVRSRLLK 140


>gi|88811847|ref|ZP_01127100.1| mraZ protein [Nitrococcus mobilis Nb-231]
 gi|88790731|gb|EAR21845.1| mraZ protein [Nitrococcus mobilis Nb-231]
          Length = 135

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 18  VSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSL 77
           ++ P  +R  L Q     +    D     + +      E  EQK+ +    +  A +L  
Sbjct: 1   MAFPGRYRDRLLQSSDGQVVVTVD-RDHCLLIYPLPEWERIEQKLIKLPTLNRTARRLQR 59

Query: 78  LVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNE 137
           L+ G     ++D  GRIL+   +R F G++ +   +G+GN F+LW+   + + +++   E
Sbjct: 60  LLIGHATECQLDGNGRILLPQPLREFAGLDKKAVLIGQGNKFELWDEPVWHERRDQWLAE 119

Query: 138 YCRQ 141
             ++
Sbjct: 120 AAQE 123


>gi|296160552|ref|ZP_06843368.1| MraZ protein [Burkholderia sp. Ch1-1]
 gi|295889301|gb|EFG69103.1| MraZ protein [Burkholderia sp. Ch1-1]
          Length = 142

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 61/135 (45%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R   G+  EVT +G G +F+LW
Sbjct: 60  DKLPMNATWWKRI---FLGNAMDVDMDGAGRVLVSPELRTAGGLAKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  E
Sbjct: 117 DAQTYTAKEQAAMAE 131


>gi|154509050|ref|ZP_02044692.1| hypothetical protein ACTODO_01567 [Actinomyces odontolyticus ATCC
           17982]
 gi|293192320|ref|ZP_06609431.1| MraZ protein [Actinomyces odontolyticus F0309]
 gi|153798684|gb|EDN81104.1| hypothetical protein ACTODO_01567 [Actinomyces odontolyticus ATCC
           17982]
 gi|292820235|gb|EFF79229.1| MraZ protein [Actinomyces odontolyticus F0309]
          Length = 143

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 52/137 (37%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  +       +   +      I    +   E    ++
Sbjct: 1   MFLGTYEPKLDDKGRMFLPARFREDME----GGIVLTRG-QEHCIYAFPASEFENMTAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S QA     ++  G      D +GRI +   +R + G+  E+  +G G+  ++W
Sbjct: 56  RRAPLSSKQARDWIRVMLSGAYKEVPDKQGRISVPADLRAYAGLGRELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYC 139
           +   +R+        + 
Sbjct: 116 DASAWREYLAVQEEVFS 132


>gi|13508053|ref|NP_110002.1| cell division protein MraZ [Mycoplasma pneumoniae M129]
 gi|2496334|sp|P75467|MRAZ_MYCPN RecName: Full=Protein MraZ
 gi|1674217|gb|AAB96170.1| conserved hypothetical protein [Mycoplasma pneumoniae M129]
 gi|301633359|gb|ADK86913.1| protein MraZ [Mycoplasma pneumoniae FH]
          Length = 141

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      +D+K R+S+P   R                 F   + V      + + ++ 
Sbjct: 1   MLLGTFNITLDAKNRISLPAKLRA-----FFEGSIVINRGFENCLEVRKPQDFQKYFEQF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W
Sbjct: 56  NSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      S +     + ++
Sbjct: 116 DKKLYEDYLANSES--LETVAER 136


>gi|325914207|ref|ZP_08176559.1| mraZ protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325539591|gb|EGD11235.1| mraZ protein [Xanthomonas vesicatoria ATCC 35937]
          Length = 148

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 58/145 (40%), Gaps = 3/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYC-FQDFFFPAISVGNSDLLEYFEQK 61
            F       +D KGRV+VP  +R ++ +     L   +  F    + +      E     
Sbjct: 1   MFQGETAITVDDKGRVAVPTAYRDLVTRVSGNRLVLTYNPFEAGCLWLYAEKEWERVRDD 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +            L   + G    L++D+ GR+ +    R   GIE +   +G G+ F+L
Sbjct: 61  VMSKPNTQRVVRTLQQKLVGSSAVLELDANGRLSIPASHRNAVGIEKKAVLLGMGDKFEL 120

Query: 122 WNPQTFRKLQEE--SRNEYCRQLLQ 144
           W+ Q  R L ++  S  +   +LL 
Sbjct: 121 WSEQAHRALIQQTLSDGDLGDELLD 145


>gi|187671949|sp|Q1ME24|MRAZ_RHIL3 RecName: Full=Protein MraZ
          Length = 145

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR + +LYCFQDF FPAIS+G  DLLE FE+
Sbjct: 1   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNVQELYCFQDFVFPAISIGGPDLLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 61  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 120

Query: 121 LW 122
           LW
Sbjct: 121 LW 122


>gi|115350508|ref|YP_772347.1| cell division protein MraZ [Burkholderia ambifaria AMMD]
 gi|170700173|ref|ZP_02891191.1| MraZ protein [Burkholderia ambifaria IOP40-10]
 gi|172059540|ref|YP_001807192.1| cell division protein MraZ [Burkholderia ambifaria MC40-6]
 gi|122324109|sp|Q0BIL0|MRAZ_BURCM RecName: Full=Protein MraZ
 gi|226709954|sp|B1YSR5|MRAZ_BURA4 RecName: Full=Protein MraZ
 gi|115280496|gb|ABI86013.1| MraZ protein [Burkholderia ambifaria AMMD]
 gi|170134905|gb|EDT03215.1| MraZ protein [Burkholderia ambifaria IOP40-10]
 gi|171992057|gb|ACB62976.1| MraZ protein [Burkholderia ambifaria MC40-6]
          Length = 142

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KI
Sbjct: 1   MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW
Sbjct: 60  AALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + QT+   ++ +  +
Sbjct: 117 DSQTYIAKEQAAMAQ 131


>gi|28572699|ref|NP_789479.1| cell division protein MraZ [Tropheryma whipplei TW08/27]
 gi|51316413|sp|Q83HJ5|MRAZ_TROW8 RecName: Full=Protein MraZ
 gi|28410831|emb|CAD67217.1| conserved hypothetical protein MraZ [Tropheryma whipplei TW08/27]
          Length = 142

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 53/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D K R  +P  FR +L                  + + +    E     I
Sbjct: 1   MFLGTHPVRLDDKNRFVLPAKFRGMLDS------VVLTRGQERCLYLFDRSEFERISDGI 54

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +      +   G      D + RI++ + +R +  ++ EVT +G G + ++W
Sbjct: 55  RNTALSQKKVRDYLRIFLSGAAAQLPDRQHRIVIANHLRAYADLKKEVTVIGAGKHIEIW 114

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    EE    +  ++ ++
Sbjct: 115 DSEAWSSYLEEQEAAFS-EIAEE 136


>gi|126729242|ref|ZP_01745056.1| MraZ, putative [Sagittula stellata E-37]
 gi|126710232|gb|EBA09284.1| MraZ, putative [Sagittula stellata E-37]
          Length = 168

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/144 (26%), Positives = 58/144 (40%), Gaps = 8/144 (5%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDL 54
           RF      K+D+KGRVS+P  FR +L Q             +  + D     +       
Sbjct: 6   RFRGESRHKVDTKGRVSIPASFRRVLEQGDPDWTEGLNPNFVIVYGDHRRKYLECFTIQE 65

Query: 55  LEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVG 114
           +E  E KI+     S +   L  L     +   +D  GRI++   +R   GI +E  F  
Sbjct: 66  MEAVEDKISSKPRGSQERKLLERLYSTQSMTTSVDETGRIVLPAKLRAKIGISDEAYFAS 125

Query: 115 RGNYFQLWNPQTFRKLQEESRNEY 138
             + FQ+W P T+   +     EY
Sbjct: 126 NVDTFQIWQPATYEAEELAQTEEY 149


>gi|307731081|ref|YP_003908305.1| MraZ protein [Burkholderia sp. CCGE1003]
 gi|323527439|ref|YP_004229592.1| MraZ protein [Burkholderia sp. CCGE1001]
 gi|307585616|gb|ADN59014.1| MraZ protein [Burkholderia sp. CCGE1003]
 gi|323384441|gb|ADX56532.1| MraZ protein [Burkholderia sp. CCGE1001]
          Length = 142

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R    +E EVT +G G +F++W
Sbjct: 60  DKLPMNAAWWKRI---FLGNAMDVDMDGAGRVLVSPELRAAGSLEKEVTLLGMGRHFEIW 116

Query: 123 NPQTFRKLQEESRNE 137
           + Q +   ++ +  E
Sbjct: 117 DAQIYAAKEQAAIAE 131


>gi|91786964|ref|YP_547916.1| cell division protein MraZ [Polaromonas sp. JS666]
 gi|123356004|sp|Q12EM4|MRAZ_POLSJ RecName: Full=Protein MraZ
 gi|91696189|gb|ABE43018.1| protein of unknown function UPF0040 [Polaromonas sp. JS666]
          Length = 142

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F    +  +D+KGR+SVP   R +L+    + L   +      + +   +  E F ++I
Sbjct: 1   MFQGASSLALDTKGRLSVPTRHRDVLSATASSQLTITKHP-HGCLMIFPRNEWEKFRERI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G  + + MD+ GR+L++  +R   GI  +   +G G+YF+LW
Sbjct: 60  ASLPMQAQWWKRI---FLGNAMDVDMDATGRVLVSPELRQAAGISKDAVLLGMGSYFELW 116

Query: 123 NPQTFRKLQEESRN 136
           +  T+   + E   
Sbjct: 117 DAATYAAQEAEQMK 130


>gi|160944904|ref|ZP_02092131.1| hypothetical protein FAEPRAM212_02420 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444088|gb|EDP21092.1| hypothetical protein FAEPRAM212_02420 [Faecalibacterium prausnitzii
           M21/2]
          Length = 139

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 58/143 (40%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       ID+KGR++ P  FR  + +  +   +         +     + +E    K+
Sbjct: 1   MFFGRYDYTIDTKGRLNFPAKFRDAMGESFVVLEWV-----DSCLFALPMEEVERLADKL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                       +S  +      +  D +GRIL+   +R + G+E +VT +G  N+ ++W
Sbjct: 56  ESDELMDSW--AISGDLFSTACEVAPDKQGRILLPAELRAYAGLEKDVTIIGNRNHAEIW 113

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
             + +   +    N+   + L+K
Sbjct: 114 ATEVWNARRAAVTNDQRAERLRK 136


>gi|315604431|ref|ZP_07879497.1| cell division protein MraZ [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315314137|gb|EFU62188.1| cell division protein MraZ [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 143

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 54/137 (39%), Gaps = 5/137 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+D KGR+ +P  FR  +       +   +      +    +   E    ++
Sbjct: 1   MFLGTYEPKLDDKGRMFLPARFREDME----GGIVLTRG-QEHCVYAFPAAEFENMTAEL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S QA     ++  G      D +GRI +   +R + G+E E+  +G G+  ++W
Sbjct: 56  RRAPLSSKQARDWIRVMLSGAYKEIPDKQGRISVPADLRAYAGLERELAVIGAGSRAEIW 115

Query: 123 NPQTFRKLQEESRNEYC 139
           N  ++R+        + 
Sbjct: 116 NASSWREYLAVQEEVFS 132


>gi|189423748|ref|YP_001950925.1| cell division protein MraZ [Geobacter lovleyi SZ]
 gi|226709984|sp|B3E3Z1|MRAZ_GEOLS RecName: Full=Protein MraZ
 gi|189420007|gb|ACD94405.1| protein of unknown function UPF0040 [Geobacter lovleyi SZ]
          Length = 159

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 11/149 (7%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTIL-AQRCITDLYCFQ----DFFFPA----ISVGNSD 53
            F       ID+KGR S+P  FR +L  +         +    DF   +    +SV    
Sbjct: 1   MFGGESLTTIDAKGRTSIPARFREVLVTEFGDERFVVTKASPVDFDDGSYGRGLSVYPLG 60

Query: 54  LLEYFEQKIAEYNPFSI--QANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVT 111
             +  E+KI          Q N L  LV G       D  GR+L+   +R+   +  ++ 
Sbjct: 61  EWQELEKKIQANEGELPLAQLNSLKRLVLGPAQECTADKLGRVLIPPALRIHANLGRDLY 120

Query: 112 FVGRGNYFQLWNPQTFRKLQEESRNEYCR 140
           FVG G  F +W  +T+ ++  +    + +
Sbjct: 121 FVGMGRRFDIWASETYARVNAQDERNFPQ 149


>gi|209550183|ref|YP_002282100.1| cell division protein MraZ [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226710004|sp|B5ZWK3|MRAZ_RHILW RecName: Full=Protein MraZ
 gi|209535939|gb|ACI55874.1| conserved hypothetical conserved protein MraZ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 145

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 104/122 (85%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++L QR + +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 1   MSRFLSNATNRIDAKGRVSVPSAFRSVLVQRNVQELYCFQDFVFPAISVGGPDLLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 61  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 120

Query: 121 LW 122
           LW
Sbjct: 121 LW 122


>gi|327191488|gb|EGE58506.1| cell division protein MraZ [Rhizobium etli CNPAF512]
          Length = 145

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 84/122 (68%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR I +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 1   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNIQELYCFQDFVFPAISVGGLDLLERFER 60

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 61  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 120

Query: 121 LW 122
           LW
Sbjct: 121 LW 122


>gi|212702348|ref|ZP_03310476.1| hypothetical protein DESPIG_00361 [Desulfovibrio piger ATCC 29098]
 gi|212674226|gb|EEB34709.1| hypothetical protein DESPIG_00361 [Desulfovibrio piger ATCC 29098]
          Length = 148

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 58/136 (42%), Gaps = 1/136 (0%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F+ +  + +D+KGR+ +P  +R  L        +      +  +        E   +K
Sbjct: 3   NLFIQSAYRNLDAKGRLLLPPEYRDALLAAGDGSFWLTIGL-YGGLKAYMPADWEAIVEK 61

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +      S++ + +   + G    +  D++GRI +   +    G+E +V  VG  + F++
Sbjct: 62  LNSVPLPSMKLSHVKTKLLGLAQRMVPDAQGRIRIPQPLMRAAGLEKDVVLVGMADKFEI 121

Query: 122 WNPQTFRKLQEESRNE 137
           W+   F  L  E  ++
Sbjct: 122 WDQARFDALLVEDVSD 137


>gi|28493186|ref|NP_787347.1| cell division protein MraZ [Tropheryma whipplei str. Twist]
 gi|51316418|sp|Q83N09|MRAZ_TROWT RecName: Full=Protein MraZ
 gi|28476227|gb|AAO44316.1| MraZ protein [Tropheryma whipplei str. Twist]
          Length = 142

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 53/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     ++D K R  +P  FR +L                  + + +    E     I
Sbjct: 1   MFLGTHPVRLDDKNRFVLPAKFRGMLDS------VVLTRGQERCLYLFDRSEFERISDGI 54

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +      +   G      D + RI++ + +R +  ++ EVT +G G + ++W
Sbjct: 55  RNTALSQKKVRDYLRIFLSGAAAQLPDRQHRIVIANHLRAYADLKKEVTVIGAGKHVEIW 114

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +    EE    +  ++ ++
Sbjct: 115 DSEAWSSYLEEQEAAFS-EIAEE 136


>gi|15676323|ref|NP_273459.1| cell division protein MraZ [Neisseria meningitidis MC58]
 gi|20139200|sp|Q9K0Z1|MRAZ_NEIMB RecName: Full=Protein MraZ
 gi|7225633|gb|AAF40849.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316984917|gb|EFV63873.1| protein MraZ [Neisseria meningitidis H44/76]
 gi|325140925|gb|EGC63432.1| mraZ protein [Neisseria meningitidis CU385]
 gi|325199599|gb|ADY95054.1| mraZ protein [Neisseria meningitidis H44/76]
          Length = 151

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 59/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L++  +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLVSAGLRKRVDFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPDELA 141


>gi|21241541|ref|NP_641123.1| cell division protein MraZ [Xanthomonas axonopodis pv. citri str.
           306]
 gi|188993034|ref|YP_001905044.1| cell division protein MraZ [Xanthomonas campestris pv. campestris
           str. B100]
 gi|325924993|ref|ZP_08186417.1| mraZ protein [Xanthomonas perforans 91-118]
 gi|325925249|ref|ZP_08186656.1| mraZ protein [Xanthomonas perforans 91-118]
 gi|23821861|sp|Q8PPB6|MRAZ_XANAC RecName: Full=Protein MraZ
 gi|51338810|sp|Q8PCK8|MRAZ_XANCP RecName: Full=Protein MraZ
 gi|91207109|sp|Q3BXG0|MRAZ_XANC5 RecName: Full=Protein MraZ
 gi|91207110|sp|Q4UQW2|MRAZ_XANC8 RecName: Full=Protein MraZ
 gi|226710021|sp|B0RVB3|MRAZ_XANCB RecName: Full=Protein MraZ
 gi|21106892|gb|AAM35659.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|167734794|emb|CAP53004.1| Protein MraZ [Xanthomonas campestris pv. campestris]
 gi|325544337|gb|EGD15713.1| mraZ protein [Xanthomonas perforans 91-118]
 gi|325544594|gb|EGD15953.1| mraZ protein [Xanthomonas perforans 91-118]
          Length = 148

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 3/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYC-FQDFFFPAISVGNSDLLEYFEQK 61
            F       +D KGR++VP  +R ++A+     L   +  F    + +      E     
Sbjct: 1   MFQGETAITVDDKGRMAVPTAYRDLVARVSGNRLVLTYNPFEAGCLWLYAEKEWERVRDD 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +            L   + G    L++D+ GR+ +    R   GIE +   +G G+ F+L
Sbjct: 61  VMSKPNTQRVVRTLQQKLVGSSAVLELDANGRLSIPASHRNAVGIEKKAVLLGMGDKFEL 120

Query: 122 WNPQTFRKLQEE--SRNEYCRQLLQ 144
           W+ Q  R L ++  S  +   +LL 
Sbjct: 121 WSEQAHRALIQQTLSDGDLGDELLD 145


>gi|241205566|ref|YP_002976662.1| cell division protein MraZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859456|gb|ACS57123.1| cell division protein MraZ [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 175

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR + +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 31  MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNVQELYCFQDFVFPAISVGGPDLLERFER 90

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+++D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 91  QIAAEDPFSPDANEMSLLIHGGGVFMRLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 150

Query: 121 LW 122
           LW
Sbjct: 151 LW 152


>gi|167647638|ref|YP_001685301.1| hypothetical protein Caul_3676 [Caulobacter sp. K31]
 gi|167350068|gb|ABZ72803.1| protein of unknown function UPF0040 [Caulobacter sp. K31]
          Length = 169

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 5/146 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FLS   +++DSK R+ VP  FR  L+      ++CF       +  G   L + ++  I 
Sbjct: 16  FLSTFEKQLDSKRRIVVPQDFRAALSGPF-DGIFCFPSIEADCLEAGGKSLFDRYQGVID 74

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E        + L   V GG   L  DS GRI + D +    G+ + V  VG G  FQ+W+
Sbjct: 75  ELPFGDPLRSALETSVLGGMARLSFDSAGRITLPDTLCEMFGLTDWVAVVGLGERFQIWS 134

Query: 124 PQTFRKLQEE----SRNEYCRQLLQK 145
            + F+  +      +R+       Q+
Sbjct: 135 REAFQAHRAAQRELARDGLAAMRAQQ 160


>gi|325847854|ref|ZP_08170076.1| protein MraZ [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480872|gb|EGC83925.1| protein MraZ [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 137

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 50/142 (35%), Gaps = 5/142 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+DSK R+ +P  FR  L           +      + +   D  E   +K 
Sbjct: 1   MFLGEFIHKLDSKNRIMMPSEFRDDLGSEFYVTKGPERS-----LVLYTIDEFEKRAKKF 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E +  +     +  L     I   +D +GR+L+   +R +  +  E   +G     ++W
Sbjct: 56  EELSYQNKNNRAMKRLFFSSTIKAYLDKQGRVLLNKQLREYANLNKEAIIIGNNTNIEIW 115

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           +   +     +        + Q
Sbjct: 116 DLDNWNDYIGDVEVNLSEIMDQ 137


>gi|116253057|ref|YP_768895.1| cell division protein MraZ [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257705|emb|CAK08803.1| conserved hypothetical protein MraZ [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 149

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR + +LYCFQDF FPAIS+G  DLLE FE+
Sbjct: 5   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNVQELYCFQDFVFPAISIGGPDLLERFER 64

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 65  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 124

Query: 121 LW 122
           LW
Sbjct: 125 LW 126


>gi|89902203|ref|YP_524674.1| cell division protein MraZ [Rhodoferax ferrireducens T118]
 gi|89346940|gb|ABD71143.1| protein of unknown function UPF0040 [Rhodoferax ferrireducens T118]
          Length = 163

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 4/133 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F    +  +D+KGR+SVP   R +L+      L   +      + V      E F ++IA
Sbjct: 23  FQGASSLSLDAKGRLSVPTRHRDVLSATASGQLTITKHP-HGCLMVFPRPEWEKFRERIA 81

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +    ++     G  + +++D  GR+L++  +R   GI  +   +G G+YF+LW+
Sbjct: 82  ALPMSAQWWKRI---FLGNAMDVELDGTGRVLVSPELRAAAGIAKDAVLLGMGSYFELWD 138

Query: 124 PQTFRKLQEESRN 136
             T+   + ++  
Sbjct: 139 QVTYDAEEAKAMQ 151


>gi|189464531|ref|ZP_03013316.1| hypothetical protein BACINT_00873 [Bacteroides intestinalis DSM
           17393]
 gi|189438321|gb|EDV07306.1| hypothetical protein BACINT_00873 [Bacteroides intestinalis DSM
           17393]
          Length = 171

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 58/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +    +    + 
Sbjct: 14  MIRFLGNIEAKTDAKGRVFIPAGFRRQLQSASEEKLVLRKDVFQDCLVLYPESVWFKTQN 73

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +  ++          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 74  QLRKRLNKWNAKHQEIFRQFVSDAEIMVPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 133

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +       E+   L  
Sbjct: 134 EIWAKEKTEQPFMN-PEEFSEALQD 157


>gi|332527096|ref|ZP_08403176.1| cell division protein MraZ [Rubrivivax benzoatilyticus JA2]
 gi|332111527|gb|EGJ11509.1| cell division protein MraZ [Rubrivivax benzoatilyticus JA2]
          Length = 137

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 11  KIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSI 70
            +D+KGRV+VP  +R +L       +   ++     +++    + + FE ++        
Sbjct: 3   TLDAKGRVTVPARWRDVLMSTVQGQMVVAKNHA-GCLTLYPRPVWDAFEAELVRLPLKYE 61

Query: 71  QANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKL 130
              +   +  G    +++D+  R+L+   +R + G+E EV F+G G+ F+LW+   +   
Sbjct: 62  GWRR---VFIGSATEVEIDAASRVLVPPELRAWAGLEREVVFMGVGDKFELWDKARYEAA 118

Query: 131 QEES 134
           + ++
Sbjct: 119 EAQT 122


>gi|126741286|ref|ZP_01756964.1| MraZ, putative [Roseobacter sp. SK209-2-6]
 gi|126717604|gb|EBA14328.1| MraZ, putative [Roseobacter sp. SK209-2-6]
          Length = 154

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 60/141 (42%), Gaps = 8/141 (5%)

Query: 12  IDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           +D+KGRVS+P  FR ++               +  + D     +     + +E  + KI 
Sbjct: 1   MDTKGRVSIPASFRRVIEASDPNWKSGENPELVIVYGDHRRNFLECYTIEAIEEVDAKID 60

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S+Q   L  + HG      +D  GR+++   +R    +E E  F+  G+ FQ+W 
Sbjct: 61  SLPRGSMQRKMLQRMFHGQSFPTTVDETGRLVLPAKLRNKIDLEKEAFFIAAGDTFQIWK 120

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
           P+T+   +     ++   L +
Sbjct: 121 PETYEAEELAQTEKWMEDLPE 141



 Score = 35.7 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/67 (14%), Positives = 19/67 (28%), Gaps = 2/67 (2%)

Query: 2   SRFLSN-VTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQD-FFFPAISVGNSDLLEYFE 59
             F        +D  GR+ +P   R  +            D F         ++ L   E
Sbjct: 74  RMFHGQSFPTTVDETGRLVLPAKLRNKIDLEKEAFFIAAGDTFQIWKPETYEAEELAQTE 133

Query: 60  QKIAEYN 66
           + + +  
Sbjct: 134 KWMEDLP 140


>gi|218517129|ref|ZP_03513969.1| cell division protein MraZ [Rhizobium etli 8C-3]
          Length = 149

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 84/122 (68%), Positives = 105/122 (86%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR I +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 5   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNIQELYCFQDFVFPAISVGGLDLLERFER 64

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EVTFVGR ++FQ
Sbjct: 65  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVTFVGRADHFQ 124

Query: 121 LW 122
           LW
Sbjct: 125 LW 126


>gi|261378432|ref|ZP_05983005.1| MraZ protein [Neisseria cinerea ATCC 14685]
 gi|269145210|gb|EEZ71628.1| MraZ protein [Neisseria cinerea ATCC 14685]
          Length = 151

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       IDSKGR++VP  FR IL++     +    +     +    ++  +   Q +
Sbjct: 1   MFGGAHELSIDSKGRLAVPAKFRDILSRLYTPAVVVTLESKHKLLMYPVAEWEKVAAQLL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     + EV  VGR N  +LW
Sbjct: 61  NLKVADNPVLRRFQNLLLHNAEILEWDSAGRVLVPAGLRKRVVFDREVVLVGRANRLELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + +     ++ ++   +L 
Sbjct: 121 GREQWEAEMVQALDDDPGELA 141


>gi|84625269|ref|YP_452641.1| cell division protein MraZ [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166710644|ref|ZP_02241851.1| hypothetical protein Xoryp_04065 [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|68565673|sp|Q5GW33|MRAZ_XANOR RecName: Full=Protein MraZ
 gi|91207111|sp|Q2NZB0|MRAZ_XANOM RecName: Full=Protein MraZ
 gi|84369209|dbj|BAE70367.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 148

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 58/145 (40%), Gaps = 3/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYC-FQDFFFPAISVGNSDLLEYFEQK 61
            F       +D KGR++VP  +R ++ +     L   +  F    + +      E     
Sbjct: 1   MFQGETAITVDDKGRMAVPTAYRDLVTRVSGNRLVLTYNPFEAGCLWLYAEKEWERVRDD 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +            L   + G    L++D+ GR+ +    R   GIE +   +G G+ F+L
Sbjct: 61  VMSKPNTQRVIRTLQQKLVGSSAVLELDANGRLSIPASHRNAVGIEKKAVLLGMGDKFEL 120

Query: 122 WNPQTFRKLQEE--SRNEYCRQLLQ 144
           W+ Q  R L ++  S  +   +LL 
Sbjct: 121 WSEQAHRALIQQTLSDGDLGDELLD 145


>gi|218131856|ref|ZP_03460660.1| hypothetical protein BACEGG_03478 [Bacteroides eggerthii DSM 20697]
 gi|217986159|gb|EEC52498.1| hypothetical protein BACEGG_03478 [Bacteroides eggerthii DSM 20697]
          Length = 154

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +    +    + 
Sbjct: 1   MIRFLGNIEAKTDAKGRVFIPAGFRKQLQAVSEERLVLRKDVFQDCLVLYPESVWFATQN 60

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +  Q+          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 61  QLRQRLNKWNAKHQQIFRQFVSDAEIMVPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +       E+   L  
Sbjct: 121 EIWAKEKAEQPFMN-PEEFSEALQD 144


>gi|312795052|ref|YP_004027974.1| cell division protein mraZ [Burkholderia rhizoxinica HKI 454]
 gi|312166827|emb|CBW73830.1| Cell division protein mraZ [Burkholderia rhizoxinica HKI 454]
          Length = 150

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 63/134 (47%), Gaps = 4/134 (2%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR+SVP  +R +L  +    +   +      + +      E F  KIA
Sbjct: 10  FQGASALTLDAKGRMSVPSRYRQVLLGQAQGRVTITKHP-DGCLLLFPQPEWEAFRNKIA 68

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +    ++     G    ++MDS GR+L++  +R    +E EV  +G G++F+LW+
Sbjct: 69  ALPMDAHWWRRI---FLGNASDVEMDSAGRVLVSPELRTAANLEREVMLLGMGSHFELWD 125

Query: 124 PQTFRKLQEESRNE 137
            QT+   ++ +  +
Sbjct: 126 AQTYAAKEQAAMAQ 139


>gi|317474529|ref|ZP_07933803.1| mraZ protein [Bacteroides eggerthii 1_2_48FAA]
 gi|316909210|gb|EFV30890.1| mraZ protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 154

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +    +    + 
Sbjct: 1   MIRFLGNIEAKTDAKGRVFIPAGFRKQLQAASEERLVLRKDVFQDCLVLYPESVWFATQN 60

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +  Q+          +  D  GRIL+        GI+++V F+G  N  
Sbjct: 61  QLRQRLNKWNAKHQQIFRQFVSDAEIMVPDGNGRILLPKRYLQMAGIQSDVRFIGVDNTI 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +       E+   L  
Sbjct: 121 EIWAKEKAEQPFMN-PEEFSEALQD 144


>gi|291278990|ref|YP_003495825.1| hypothetical protein DEFDS_0587 [Deferribacter desulfuricans SSM1]
 gi|290753692|dbj|BAI80069.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 154

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 56/144 (38%), Gaps = 4/144 (2%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           S F       I+  GR+S+P  FR +L  +   D     +     ++       E  E K
Sbjct: 5   SSFKGKSVHTINESGRISIPAKFRDVLKTKYNEDSLVLVNL-GKYLAAYPVKEWEKVESK 63

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
             E  P + QA +L   +        +D  GRIL+   +R   G+  E   VG  N  ++
Sbjct: 64  FEENPPKNKQAAKLMRKLFSTAEDCSLDRLGRILIPPHLRNGVGLNGECVIVGMMNKIEI 123

Query: 122 WNPQTFRKLQEESRNEYCRQLLQK 145
           W    +    E++       L+++
Sbjct: 124 WPKDVWESEVEDTD---MSTLMEE 144


>gi|190892592|ref|YP_001979134.1| hypothetical conserved protein MraZ [Rhizobium etli CIAT 652]
 gi|190697871|gb|ACE91956.1| hypothetical conserved protein MraZ [Rhizobium etli CIAT 652]
          Length = 149

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 104/122 (85%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           MSRFLSN T +ID+KGRVSVP  FR++LAQR I +LYCFQDF FPAISVG  DLLE FE+
Sbjct: 5   MSRFLSNATNRIDAKGRVSVPSAFRSVLAQRNIQELYCFQDFVFPAISVGGLDLLERFER 64

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +IA  +PFS  AN++SLL+HGGG+F+K+D+EGR+++TDFIR FTGI +EV FVGR ++FQ
Sbjct: 65  QIAAEDPFSPDANEMSLLIHGGGVFMKLDAEGRLMVTDFIRGFTGISDEVIFVGRADHFQ 124

Query: 121 LW 122
           LW
Sbjct: 125 LW 126


>gi|270307712|ref|YP_003329770.1| MraZ protein [Dehalococcoides sp. VS]
 gi|270153604|gb|ACZ61442.1| MraZ protein [Dehalococcoides sp. VS]
          Length = 142

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 52/136 (38%), Gaps = 4/136 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F      K+D KGR  +P   R  L       L          I        +   + +
Sbjct: 1   MFFGEFEYKLDEKGRFPLPPAIRPSLKD----GLILAPGTGEKCIYAYPLCEWKKLAESL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L+  +      + +D++GR+ +   ++ + G+  EV   G  NY ++W
Sbjct: 57  KSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKNYAGVNIEVIVAGVNNYLEIW 116

Query: 123 NPQTFRKLQEESRNEY 138
           + +T+   ++ S+ + 
Sbjct: 117 DKETWESEKKASQEQA 132


>gi|238561284|ref|ZP_00442383.2| protein MraZ [Burkholderia mallei GB8 horse 4]
 gi|254199060|ref|ZP_04905475.1| mraZ protein [Burkholderia pseudomallei S13]
 gi|254208166|ref|ZP_04914516.1| mraZ protein [Burkholderia mallei JHU]
 gi|147752060|gb|EDK59127.1| mraZ protein [Burkholderia mallei JHU]
 gi|169656890|gb|EDS88287.1| mraZ protein [Burkholderia pseudomallei S13]
 gi|238525017|gb|EEP88447.1| protein MraZ [Burkholderia mallei GB8 horse 4]
          Length = 155

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 4/134 (2%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR+SVP  +R  L  +    +   +      + +      E F  KIA
Sbjct: 15  FQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHP-DGCLLLFPRPEWEVFRAKIA 73

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +    ++     G  + + +DS GRIL++  +R+  G+E EV  +G G++F+LW+
Sbjct: 74  ALPMDAHWWRRI---FLGNAMDVDLDSAGRILVSPELRMAAGLEKEVMLLGMGSHFELWD 130

Query: 124 PQTFRKLQEESRNE 137
            QT+   ++ +  +
Sbjct: 131 AQTYTAKEQAAMAQ 144


>gi|311742810|ref|ZP_07716618.1| cell division protein MraZ [Aeromicrobium marinum DSM 15272]
 gi|311313490|gb|EFQ83399.1| cell division protein MraZ [Aeromicrobium marinum DSM 15272]
          Length = 173

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 49/140 (35%), Gaps = 5/140 (3%)

Query: 2   SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQK 61
           + F    T ++D KGR+ +P  FR  L                  I     +    F  +
Sbjct: 30  ANFFGTFTPRLDEKGRLFLPAKFRPRLEHG-----VVLTRGQENCIYGWTPESFSSFTDR 84

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           + +    + QA     ++  G      D +GRI +   +R +  +  E   VG  +  ++
Sbjct: 85  VRDTPFTNKQARNFFRMLFSGASSEVPDKQGRIAIPPVLREWAQLGRECAVVGAMDRIEI 144

Query: 122 WNPQTFRKLQEESRNEYCRQ 141
           W+ + + +        +   
Sbjct: 145 WDLERWTEFSAGQEEAFSDM 164


>gi|229820905|ref|YP_002882431.1| MraZ protein [Beutenbergia cavernae DSM 12333]
 gi|259509647|sp|C5BW68|MRAZ_BEUC1 RecName: Full=Protein MraZ
 gi|229566818|gb|ACQ80669.1| MraZ protein [Beutenbergia cavernae DSM 12333]
          Length = 143

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 54/128 (42%), Gaps = 5/128 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +   T K+D KGR+ +P  FR   A    T L   +      + V   D      + +
Sbjct: 1   MLIGTFTPKLDDKGRLILPAKFRERFA----TGLVLTRG-QENCVFVFPRDEFLQVHENL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S Q+   + ++  G      D +GR+ +   +R +  ++ ++T +G G+  ++W
Sbjct: 56  RRAPLTSKQSRDFNRVLLAGAHDELPDKQGRVTIPPILREWARLDRDLTVIGTGSKLEVW 115

Query: 123 NPQTFRKL 130
           +  T++  
Sbjct: 116 DTGTWQGY 123


>gi|226941978|ref|YP_002797052.1| Protein mraZ [Laribacter hongkongensis HLHK9]
 gi|226716905|gb|ACO76043.1| Protein mraZ [Laribacter hongkongensis HLHK9]
          Length = 144

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 53/141 (37%), Gaps = 6/141 (4%)

Query: 6   SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEY 65
              +  +D KGR+ VP   R  ++      L    +     + +      +  E ++   
Sbjct: 5   GVASLTLDGKGRLMVPARLRADMSDA---TLVVTLE-SAKCLLLYPLSCWQPVEARLMSL 60

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
                 A +   LV G    L  D  GRIL+   +R   G+E +V  VG G  ++LW+  
Sbjct: 61  PANDPAALRFQRLVLGHAEALTPDPAGRILLPARLRKLAGLERKVVLVGMGRRWELWDEA 120

Query: 126 TFRKLQEE--SRNEYCRQLLQ 144
            +    +   +  +    L +
Sbjct: 121 RWDAEMDAVLAAPDSLAHLGE 141


>gi|254459605|ref|ZP_05073021.1| protein MraZ [Rhodobacterales bacterium HTCC2083]
 gi|206676194|gb|EDZ40681.1| protein MraZ [Rhodobacteraceae bacterium HTCC2083]
          Length = 159

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 12  IDSKGRVSVPFVFRTILAQRCITD--------LYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           +D+KGRVS+P  FR ++               +  + D     +     + +E  + KI 
Sbjct: 1   MDTKGRVSIPAAFRRVIEAADPNWTDGLPPELVIVYGDHRRNYLECYTMEAIEEVDAKID 60

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S+Q   L  L HG      +D  GR+++   +R    ++ E  F+  G+ FQ+W 
Sbjct: 61  ALPRGSMQRKMLQRLFHGQSFPTTIDETGRLVLPAKLRQKIELDKEAFFIAAGDTFQIWK 120

Query: 124 PQTFRKLQEESRNEYCRQLLQ 144
            +T+   +     E+  +L  
Sbjct: 121 TETYEADELAKTEEWLEELPD 141



 Score = 35.7 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 20/76 (26%), Gaps = 2/76 (2%)

Query: 2   SRFLSN-VTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQD-FFFPAISVGNSDLLEYFE 59
             F        ID  GR+ +P   R  +            D F         +D L   E
Sbjct: 74  RLFHGQSFPTTIDETGRLVLPAKLRQKIELDKEAFFIAAGDTFQIWKTETYEADELAKTE 133

Query: 60  QKIAEYNPFSIQANQL 75
           + + E          L
Sbjct: 134 EWLEELPDDFDPLEFL 149


>gi|328948459|ref|YP_004365796.1| protein mraZ [Treponema succinifaciens DSM 2489]
 gi|328448783|gb|AEB14499.1| Protein mraZ [Treponema succinifaciens DSM 2489]
          Length = 147

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 57/141 (40%), Gaps = 5/141 (3%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M          +D KGR+  P   R++L Q     L   Q      + + + D      +
Sbjct: 1   MEMLFGEYNNTLDDKGRIQFPAKLRSVLQQES---LVVTQGL-DRCLMIFSIDEWTSLNK 56

Query: 61  KI-AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           KI    + F+ Q   +          L  D  GR+ +   +R + G++ E T +G   Y 
Sbjct: 57  KIVDSASLFNDQKRLVMRRFIAPAQKLDFDKSGRLSIPQTLRDYAGLKGECTILGINKYM 116

Query: 120 QLWNPQTFRKLQEESRNEYCR 140
           +LW+ + +R   E++ + + +
Sbjct: 117 ELWDSEKYRAYLEKTEDSFLK 137


>gi|295677773|ref|YP_003606297.1| MraZ protein [Burkholderia sp. CCGE1002]
 gi|295437616|gb|ADG16786.1| MraZ protein [Burkholderia sp. CCGE1002]
          Length = 142

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R    +E EVT +G G +F+LW
Sbjct: 60  DKLPMNAAWWKRI---FLGNAMDVDMDGAGRVLVSPELRAAGSLEKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + Q +   ++ +  E
Sbjct: 117 DAQIYAAKEQAAIAE 131


>gi|209519086|ref|ZP_03267892.1| MraZ protein [Burkholderia sp. H160]
 gi|209500458|gb|EEA00508.1| MraZ protein [Burkholderia sp. H160]
          Length = 142

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEVFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R    +E EVT +G G +F+LW
Sbjct: 60  DKLPMNAAWWKRI---FLGNAMDVDMDGAGRVLVSPELRTAGSLEKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + Q +   ++ +  E
Sbjct: 117 DAQIYAAKEQAAIAE 131


>gi|261367519|ref|ZP_05980402.1| protein MraZ [Subdoligranulum variabile DSM 15176]
 gi|282570300|gb|EFB75835.1| protein MraZ [Subdoligranulum variabile DSM 15176]
          Length = 138

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 63/142 (44%), Gaps = 7/142 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      ID+KGR++ P  FR  + +  I   +         ++   ++  E    KI
Sbjct: 1   MLVGQYDYAIDTKGRLNFPARFRDAMGETFIVTRWL-----DHCLAAFPTEEFEKVAAKI 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E         ++S +++   + +  D +GRI +   +R + G++++VT +G  ++ ++W
Sbjct: 56  EEKGLVK--GRKVSRMLYASAVEVTPDKQGRIQLPAKLREYAGLDHDVTIIGNRSFAEIW 113

Query: 123 NPQTFRKLQEESRNEYCRQLLQ 144
           N   +   Q  S  ++   + +
Sbjct: 114 NTAAWNGDQATSDEDFTAAMEE 135


>gi|325923944|ref|ZP_08185534.1| mraZ protein [Xanthomonas gardneri ATCC 19865]
 gi|325545570|gb|EGD16834.1| mraZ protein [Xanthomonas gardneri ATCC 19865]
          Length = 148

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 58/145 (40%), Gaps = 3/145 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYC-FQDFFFPAISVGNSDLLEYFEQK 61
            F       +D KGR++VP  +R ++ +     L   +  F    + +      E     
Sbjct: 1   MFQGETAITVDDKGRMAVPTAYRDLVTRASGNRLVLTYNPFEAGCLWLYAEKEWERVRDD 60

Query: 62  IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQL 121
           +            L   + G    L++D+ GR+ +    R   GIE +   +G G+ F+L
Sbjct: 61  VMSKPNTQRVVRTLQQKLVGSSAMLELDANGRLSIPASHRNAVGIEKKAVLLGMGDKFEL 120

Query: 122 WNPQTFRKLQEE--SRNEYCRQLLQ 144
           W+ Q  R L ++  S  +   +LL 
Sbjct: 121 WSEQAHRALIQQTLSDGDLGDELLD 145


>gi|167764164|ref|ZP_02436291.1| hypothetical protein BACSTE_02548 [Bacteroides stercoris ATCC
           43183]
 gi|167698280|gb|EDS14859.1| hypothetical protein BACSTE_02548 [Bacteroides stercoris ATCC
           43183]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +    +    + 
Sbjct: 1   MIRFLGNIEAKTDTKGRVFIPAGFRKQLQAASEERLVLRKDVFQDCLILYPESVWFKTQN 60

Query: 61  K-IAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++ +  Q+          +  D  GRIL+        GI++EV F+G  N  
Sbjct: 61  QLRQRLNKWNAKHQQIFRQFVSDAEIMIPDGNGRILLPKRYLQMAGIQSEVRFIGVDNTI 120

Query: 120 QLWNPQTFRKLQEESRNEYCRQLLQ 144
           ++W  +   +   +   E+   L  
Sbjct: 121 EIWAKEKAEQPFMD-PEEFSEALQD 144


>gi|212697079|ref|ZP_03305207.1| hypothetical protein ANHYDRO_01644 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212675854|gb|EEB35461.1| hypothetical protein ANHYDRO_01644 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 146

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 48/138 (34%), Gaps = 5/138 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL     K+DSK R+ +P  FR  L           +      + +   D  E   +K 
Sbjct: 10  MFLGEFIHKLDSKNRIMMPSEFRDDLGSEFYVTKGPERS-----LVLYTIDEFEKRAKKF 64

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            + +  +     +  L     I   +D +GR+L+   +R +  +  E   +G     ++W
Sbjct: 65  EDLSYQNKNNRAMKRLFFSSTIKAYLDKQGRVLLNKQLREYANLNKEAIIIGNNTNIEIW 124

Query: 123 NPQTFRKLQEESRNEYCR 140
           +   +     +       
Sbjct: 125 DLDNWNDYIGDVEVNLSE 142


>gi|194290822|ref|YP_002006729.1| cell division protein mraz [Cupriavidus taiwanensis LMG 19424]
 gi|226709967|sp|B3R6W8|MRAZ_CUPTR RecName: Full=Protein MraZ
 gi|193224657|emb|CAQ70668.1| conserved hypothetical protein, UPF0040 COG2001 [Cupriavidus
           taiwanensis LMG 19424]
          Length = 142

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P   R  L Q+    +   +      + +      E F  +I
Sbjct: 1   MFQGASALSLDAKGRMSIPSRHREALQQQAEGRVTLTKHP-DGCLLLFPRPEWETFRTRI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G    ++MD  GR+L+   +R    ++ EV  +G G++F++W
Sbjct: 60  AALPMDAHWWKRI---FLGNAADVEMDGAGRVLIAPELRSAAMLDKEVMLLGMGSHFEVW 116

Query: 123 NPQTFRKLQEESRNE 137
           +  T+   ++++  +
Sbjct: 117 DAATYAAKEQQAMAQ 131


>gi|73542672|ref|YP_297192.1| cell division protein MraZ [Ralstonia eutropha JMP134]
 gi|91207210|sp|Q46WY5|MRAZ_RALEJ RecName: Full=Protein MraZ
 gi|72120085|gb|AAZ62348.1| Protein of unknown function UPF0040 [Ralstonia eutropha JMP134]
          Length = 142

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 61/135 (45%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P   R  L Q+    +   +      + +      E F Q+I
Sbjct: 1   MFQGASALSLDAKGRMSIPSRHREALQQQAEGRVTLTKHP-DGCLLLFPRPEWESFRQRI 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
           A     +    ++     G    ++MD  GR+L+   +R    ++ EV  +G G++F++W
Sbjct: 60  AALPMDAHWWKRI---FLGNAADVEMDGAGRVLIAPELRGAAMLDKEVMLLGMGSHFEVW 116

Query: 123 NPQTFRKLQEESRNE 137
           +  T+   ++++  +
Sbjct: 117 DAATYAAKEQQAMAQ 131


>gi|170696712|ref|ZP_02887827.1| MraZ protein [Burkholderia graminis C4D1M]
 gi|170138375|gb|EDT06588.1| MraZ protein [Burkholderia graminis C4D1M]
          Length = 142

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +D+KGR+S+P  +R  L  +    +   +      + +      E F  K+
Sbjct: 1   MFQGASALTLDAKGRMSIPSRYRDALQTQAEGRVTITKHP-DGCLLLFPRPEWEIFRDKV 59

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            +    +    ++     G  + + MD  GR+L++  +R    +E EVT +G G +F+LW
Sbjct: 60  DKLPMNAAWWKRI---FLGNAMDVDMDGAGRVLVSPELRAAGSLEKEVTLLGMGRHFELW 116

Query: 123 NPQTFRKLQEESRNE 137
           + Q +   ++ +  E
Sbjct: 117 DAQIYAAKEQAAIAE 131


>gi|332663144|ref|YP_004445932.1| protein mraZ [Haliscomenobacter hydrossis DSM 1100]
 gi|332331958|gb|AEE49059.1| Protein mraZ [Haliscomenobacter hydrossis DSM 1100]
          Length = 148

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           M + L     KID KGR+ +P    + L +R        + F    + +   ++ E   +
Sbjct: 1   MRKLLGEFECKIDEKGRMRLPSGLISQLGEREAYTFVMNRGF-EKCLMLYPREVWEKITE 59

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           +I + N +  ++       + G   L MDS  RIL+   +  + GIE +V  +   +  +
Sbjct: 60  EIDQLNYYDQESRAFQRYFYRGAQELTMDSSDRILLNKRLLEYAGIEKDVILMAYNDRVE 119

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           +W+   +  + ++   ++   L Q+
Sbjct: 120 VWSKDRYDDMLDDEPADFSG-LAQR 143


>gi|265764989|ref|ZP_06093264.1| mraZ [Bacteroides sp. 2_1_16]
 gi|263254373|gb|EEZ25807.1| mraZ [Bacteroides sp. 2_1_16]
          Length = 158

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 3/148 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSD-LLEYFE 59
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +   +   E  +
Sbjct: 1   MIRFLGNIEAKADAKGRVFIPAQFRRQLQSGSEDKLIMRKDVFQDCLVLYPEEVWNEELD 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++     +          + MD  GRIL+       TGI+++V F+G  N  
Sbjct: 61  ELRQRLNKWNANHQLIFRQFVSDVEIITMDGNGRILIPKRYLQITGIQSDVRFIGVDNKI 120

Query: 120 QLWNPQTFRK--LQEESRNEYCRQLLQK 145
           ++W  +   K  ++ E+      +++++
Sbjct: 121 EIWAKERAEKLFMEPEAFGAALEEIMKE 148


>gi|257791850|ref|YP_003182456.1| hypothetical protein Elen_2104 [Eggerthella lenta DSM 2243]
 gi|317489855|ref|ZP_07948348.1| mraZ protein [Eggerthella sp. 1_3_56FAA]
 gi|325829974|ref|ZP_08163432.1| putative protein MraZ [Eggerthella sp. HGA1]
 gi|257475747|gb|ACV56067.1| protein of unknown function UPF0040 [Eggerthella lenta DSM 2243]
 gi|316911010|gb|EFV32626.1| mraZ protein [Eggerthella sp. 1_3_56FAA]
 gi|325488141|gb|EGC90578.1| putative protein MraZ [Eggerthella sp. HGA1]
          Length = 149

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 9/135 (6%)

Query: 6   SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYF-----EQ 60
           S    K+D+KGR+S+P  FR +L+    TDL   ++     + V   D    +     E 
Sbjct: 13  SAYRHKVDAKGRMSLPASFRKVLS----TDLVVTRNPKDECLYVFEPDAFNAWVAGVFED 68

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           K  +++  +    +L   +      + +D+ GRI+++   R   GI+ EV  VG   YF+
Sbjct: 69  KFEKFDRTNDLHVRLRRKLKSRAADVSIDAAGRIMISAEQREAVGIDKEVVVVGNTGYFE 128

Query: 121 LWNPQTFRKLQEESR 135
           +W+ + +  + +E+ 
Sbjct: 129 IWDAKRYDAVDDETD 143


>gi|145588346|ref|YP_001154943.1| cell division protein MraZ [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145046752|gb|ABP33379.1| MraZ protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 143

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 4/131 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR+S+P   R  L  +    +   +      + +      E F  ++A
Sbjct: 3   FQGASALNLDAKGRMSIPAKHRDALLVQGEGRITLTKHP-DGCLLLFPRPEWETFRSRVA 61

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           +    +    ++     G    + +D  GR+L++  +R   GIE EV  +G G++ +LW+
Sbjct: 62  QLPMDAHWWRRI---FLGNAAEVDLDGAGRVLVSPELRAAAGIEKEVMLLGMGSHLELWD 118

Query: 124 PQTFRKLQEES 134
             T+   ++ +
Sbjct: 119 AATYAAKEQAA 129


>gi|107099994|ref|ZP_01363912.1| hypothetical protein PaerPA_01001015 [Pseudomonas aeruginosa PACS2]
          Length = 134

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 50/115 (43%)

Query: 20  VPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLV 79
           +P  +R  L  RC   L    D   P ++V      E  E K+ E      +  +L  L+
Sbjct: 1   MPSRYRDELVSRCAGQLIVTIDAVDPCLTVYPLPEWELIEAKLRELPSLREETRRLQRLL 60

Query: 80  HGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEES 134
            G  + L++D  GR L+   +R +  ++     VG+ N FQLW+   +  + E  
Sbjct: 61  IGNAVDLELDGNGRFLIPPRLREYAKLDKRAMLVGQLNKFQLWDEDAWNAMAEAD 115


>gi|319639027|ref|ZP_07993785.1| mraZ protein [Neisseria mucosa C102]
 gi|317399931|gb|EFV80594.1| mraZ protein [Neisseria mucosa C102]
          Length = 151

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 58/141 (41%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F       +DSKGR+++P  FR IL +R    +    D     +        E  EQ +
Sbjct: 1   MFGGAHELSMDSKGRLAIPAKFRDILLRRYTPAIVVTLDSRKKLLMYPEPVWEEKAEQIL 60

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 +    +   L+      L+ DS GR+L+   +R     E EVT VGR N  +LW
Sbjct: 61  KLKVAGNESLQRYQNLLLHNAEILEWDSAGRVLIPANLRKRVDFEKEVTLVGRANRMELW 120

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
             + + +   ++ +    +L 
Sbjct: 121 GREHWEEEMNQALDIDPDELA 141


>gi|319949144|ref|ZP_08023235.1| cell division protein MraZ [Dietzia cinnamea P4]
 gi|319437193|gb|EFV92222.1| cell division protein MraZ [Dietzia cinnamea P4]
          Length = 158

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 6   SNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEY 65
                K+D KGR+++P  FR  LA            +F   +SV   D  +   +K+   
Sbjct: 19  GTHRPKLDDKGRLTIPARFRPGLADG-----VVVCGWFTNTLSVFPEDEFDALVRKVRPT 73

Query: 66  NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQ 125
              S +      L+  G    ++DS+GRI +    R + G++ +    G G   ++W+ +
Sbjct: 74  ANLSERHMAFFRLLVSGAEVQQLDSQGRISIPASQRNYAGLDKDCVVNGLGERLEVWDAE 133

Query: 126 TFRKLQEESRNEYCRQ 141
            + +   E+   +   
Sbjct: 134 AWDRYSAENLPVFSEM 149


>gi|148265994|ref|YP_001232700.1| cell division protein MraZ [Geobacter uraniireducens Rf4]
 gi|189028620|sp|A5G8K9|MRAZ_GEOUR RecName: Full=Protein MraZ
 gi|146399494|gb|ABQ28127.1| MraZ protein [Geobacter uraniireducens Rf4]
          Length = 160

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 54/148 (36%), Gaps = 12/148 (8%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLY---------CFQDFFFPAISVGNSD 53
            F       ID KGR S+P  FR +L +    + +           +  +   + V    
Sbjct: 1   MFRGKFETTIDVKGRTSLPAKFRDVLFETFGDERFFITNSNPVRLGEGVYSSGLVVYPYK 60

Query: 54  LLEYFEQKIA---EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEV 110
                E+K+         S +   +   +    I    D  GR+L+   +R    +E E+
Sbjct: 61  EWLALEEKLMVGTGLGLSSAELAAVKRRIVAPAIECVADKLGRVLVPPHLRKSAVLEREI 120

Query: 111 TFVGRGNYFQLWNPQTFRKLQEESRNEY 138
            FVG  N  ++W+   + K+  +    +
Sbjct: 121 LFVGMLNKAEIWSQAEWEKVCRQDEQNF 148


>gi|108804338|ref|YP_644275.1| hypothetical protein Rxyl_1501 [Rubrobacter xylanophilus DSM 9941]
 gi|108765581|gb|ABG04463.1| protein of unknown function UPF0040 [Rubrobacter xylanophilus DSM
           9941]
          Length = 151

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 51/137 (37%), Gaps = 5/137 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L      +D KGR+++P   R          +   +      +     +    F+ ++ 
Sbjct: 8   LLGEYEHTLDEKGRLTLPSRLRPYFE----GGIVITKGV-DKCLFAFPPEEWAAFKARVK 62

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                S +  QL+ +         +D +GR+L+   +  + G+  +VT  G  +  ++W+
Sbjct: 63  ASADLSARGRQLARMFFSMAFEATLDRQGRVLIPAKLARYAGLSRDVTITGVDDRLEIWD 122

Query: 124 PQTFRKLQEESRNEYCR 140
              + +  E +   +  
Sbjct: 123 TGEWNRYMEGADETFAE 139


>gi|304439974|ref|ZP_07399867.1| cell division protein MraZ [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371466|gb|EFM25079.1| cell division protein MraZ [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 54/141 (38%), Gaps = 5/141 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             +      +D +GR+ +P   R  L    +             I V      E   +K+
Sbjct: 16  MLIGEYNLTLDDRGRIIIPSKLRNDLEDSFVMTKGL-----DGCIFVYPKTEWEEISKKV 70

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                 S +A       +   +   +D +GR+L+   +R  +G+  +   VG     ++W
Sbjct: 71  RSLPLSSKEARAFQRSFYSKAVLTNLDKQGRVLIPQSLRDHSGLVKDGIIVGLDVRAEIW 130

Query: 123 NPQTFRKLQEESRNEYCRQLL 143
           + + ++++ E+  + Y   ++
Sbjct: 131 SLEKWQEMDEDLESSYEDNVM 151


>gi|320161731|ref|YP_004174956.1| protein MraZ [Anaerolinea thermophila UNI-1]
 gi|319995585|dbj|BAJ64356.1| protein MraZ [Anaerolinea thermophila UNI-1]
          Length = 145

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 5/130 (3%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            FL      +D K R+ +P  +R ++              F   + V  +++ E     +
Sbjct: 1   MFLGRFEHNLDDKSRIIIPAKYRELIKSGAYVTQ-----GFDRNLMVLTTEVFERVVTYL 55

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
            E    +  A  L  L+      +  D  GR L+  ++R F  IEN V  VG G+YF++W
Sbjct: 56  NELGMTNPDARTLKRLIFSSASPVTFDKLGRFLIPAYLREFARIENHVILVGVGDYFEIW 115

Query: 123 NPQTFRKLQE 132
           + + + K + 
Sbjct: 116 SKEEWLKQES 125


>gi|53711605|ref|YP_097597.1| cell division protein MraZ [Bacteroides fragilis YCH46]
 gi|60679855|ref|YP_209999.1| cell division protein MraZ [Bacteroides fragilis NCTC 9343]
 gi|253564344|ref|ZP_04841801.1| mraZ [Bacteroides sp. 3_2_5]
 gi|81317073|sp|Q5LII9|MRAZ_BACFN RecName: Full=Protein MraZ
 gi|90103478|sp|Q64ZL3|MRAZ_BACFR RecName: Full=Protein MraZ
 gi|52214470|dbj|BAD47063.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|60491289|emb|CAH06037.1| putative cell division protein [Bacteroides fragilis NCTC 9343]
 gi|251948120|gb|EES88402.1| mraZ [Bacteroides sp. 3_2_5]
 gi|301161375|emb|CBW20915.1| putative cell division protein [Bacteroides fragilis 638R]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 3/148 (2%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSD-LLEYFE 59
           M RFL N+  K D+KGRV +P  FR  L       L   +D F   + +   +   E  +
Sbjct: 1   MIRFLGNIEAKADAKGRVFIPAQFRRQLQSGSEDKLIMRKDVFQDCLVLYPEEVWNEELD 60

Query: 60  QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119
           +     N ++     +          + MD  GRIL+       TGI+++V F+G  N  
Sbjct: 61  ELRQRLNKWNANHQLIFRQFVSDVEIITMDGNGRILIPKRYLQITGIQSDVRFIGVDNKI 120

Query: 120 QLWNPQTFRK--LQEESRNEYCRQLLQK 145
           ++W  +   K  ++ ++      +++++
Sbjct: 121 EIWAKERAEKLFMEPKAFGAALEEIMKE 148


>gi|295688553|ref|YP_003592246.1| MraZ domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295430456|gb|ADG09628.1| MraZ domain protein [Caulobacter segnis ATCC 21756]
          Length = 163

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 1/137 (0%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           FLS   +++DSK R+ VP  FR  ++      ++CF       +  G   L + +   I 
Sbjct: 10  FLSTFEKQLDSKRRIVVPQEFRAAVSGLF-DGIFCFPSIEADCLEAGGKALFDRYTGVIE 68

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
           E        + L   V GG   L  D+ GRI + D +    G+ + V  VG G  FQ+W+
Sbjct: 69  ELPFGDPIRSALETSVLGGMAKLSFDTAGRITLPDHLCEMCGLTDWVAVVGMGERFQIWS 128

Query: 124 PQTFRKLQEESRNEYCR 140
            + F+  +   R+    
Sbjct: 129 REAFQAHRATQRDMARE 145


>gi|325473768|gb|EGC76956.1| mraZ [Treponema denticola F0402]
          Length = 149

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 58/143 (40%), Gaps = 7/143 (4%)

Query: 1   MSRF--LSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYF 58
           M  F         +D KGR+  P   R  L       L   +      + +  +D  + F
Sbjct: 1   MGNFAMTGEYKNTLDEKGRIMFPAKIRAELPDSN---LVITRGVGN-CLWIFTADKWKKF 56

Query: 59  EQKIAEY-NPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117
             +I +  + F  Q+  +   +      +++D  GRI +   +R   G+E +   +G G 
Sbjct: 57  SDEIMKKTSLFKAQSLLVMRRLIAPAQEVEVDKNGRISIPQSLRECAGLEKDCIILGLGK 116

Query: 118 YFQLWNPQTFRKLQEESRNEYCR 140
            F+LW+ + + K  +ES  ++  
Sbjct: 117 CFELWDLKQYEKYLKESEPDFSE 139


>gi|147668965|ref|YP_001213783.1| MraZ protein [Dehalococcoides sp. BAV1]
 gi|289432240|ref|YP_003462113.1| MraZ protein [Dehalococcoides sp. GT]
 gi|189028618|sp|A5FSB6|MRAZ_DEHSB RecName: Full=Protein MraZ
 gi|146269913|gb|ABQ16905.1| MraZ protein [Dehalococcoides sp. BAV1]
 gi|288945960|gb|ADC73657.1| MraZ protein [Dehalococcoides sp. GT]
          Length = 142

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 52/136 (38%), Gaps = 4/136 (2%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
            F      K+D KGR  +P   R  L       L          I        +   + +
Sbjct: 1   MFFGEFEYKLDEKGRFPLPPAIRPSLKD----GLILAPGTGEKCIYAYPLCEWKKLAESL 56

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
                   +  +L+  +      + +D++GR+ +   ++ + G+  EV   G  NY ++W
Sbjct: 57  KSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKTYAGVNIEVIVAGVNNYLEIW 116

Query: 123 NPQTFRKLQEESRNEY 138
           + +T+   ++ S+ + 
Sbjct: 117 DKETWESEKKASQEQA 132


>gi|222053872|ref|YP_002536234.1| MraZ protein [Geobacter sp. FRC-32]
 gi|254813280|sp|B9M163|MRAZ_GEOSF RecName: Full=Protein MraZ
 gi|221563161|gb|ACM19133.1| MraZ protein [Geobacter sp. FRC-32]
          Length = 160

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 55/148 (37%), Gaps = 12/148 (8%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLY---------CFQDFFFPAISVGNSD 53
            F  N    ID+KGR S+P  FR +L      + +              +   + +   +
Sbjct: 1   MFRGNFETSIDAKGRTSLPAKFREVLVDSFGDERFFMTNSNPVRLGDGGYSSGLVIYPYN 60

Query: 54  LLEYFEQKIA---EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEV 110
                E+K+         S +   +   +    +    D  GRIL+   +R    +E E+
Sbjct: 61  EWLALEEKLKVGTGLGLSSAELASVKRRIVAPAVECVADKLGRILVPPHLRKSACLEREI 120

Query: 111 TFVGRGNYFQLWNPQTFRKLQEESRNEY 138
            FVG  N  ++W+   + K+  +    +
Sbjct: 121 LFVGMLNKAEIWSQAEWEKVFRQDIENF 148


>gi|124265646|ref|YP_001019650.1| cell division protein MraZ [Methylibium petroleiphilum PM1]
 gi|187671947|sp|A2SCX6|MRAZ_METPP RecName: Full=Protein MraZ
 gi|124258421|gb|ABM93415.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 146

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 60/134 (44%), Gaps = 4/134 (2%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
           F       +D+KGR++VP   R +L       L   +      + V      E F  K+A
Sbjct: 6   FQGASALALDAKGRLAVPARHRDVLGALAQGRLTLTKHPV-GCLLVFPRPAWEGFRDKVA 64

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
                +    ++     G  + +++D+  R+L++  +R   G+  +V  +G G++F+LW+
Sbjct: 65  ALPLRAEGWKRI---FLGNAMDVEIDASSRVLVSPELRQAAGLVKDVMLLGMGSHFELWD 121

Query: 124 PQTFRKLQEESRNE 137
            Q ++  + E   +
Sbjct: 122 VQRYQAHEAEVMQQ 135


>gi|256545405|ref|ZP_05472768.1| MraZ protein [Anaerococcus vaginalis ATCC 51170]
 gi