RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781106|ref|YP_003065519.1| cell division protein MraZ [Candidatus Liberibacter asiaticus str. psy62] (145 letters) >gnl|CDD|32184 COG2001, COG2001, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 146 Score = 113 bits (284), Expect = 2e-26 Identities = 40/135 (29%), Positives = 66/135 (48%), Gaps = 2/135 (1%) Query: 3 RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62 FL +DSKGR+SVP FR L + L + + V E E+K+ Sbjct: 1 MFLGAYEHNLDSKGRLSVPAKFRAALGENA-AGLVVTRGIDHC-LEVYPLAEWERLEEKL 58 Query: 63 AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122 + +A L+ GG + +++D GRIL+ +R + G+E EV VG+G+ F++W Sbjct: 59 SALPSTDPEARAFQRLLFGGAVEVELDGAGRILIPQNLREYAGLEKEVVLVGQGDRFEIW 118 Query: 123 NPQTFRKLQEESRNE 137 + Q + Q E+ + Sbjct: 119 DKQAWEAYQAEAEDA 133 >gnl|CDD|111290 pfam02381, MraZ, MraZ protein. This small 70 amino acid domain is found duplicated in a family of bacterial proteins. These proteins may be DNA-binding transcription factors (Pers. comm. A Andreeva & A Murzin). Length = 72 Score = 41.9 bits (99), Expect = 6e-05 Identities = 15/57 (26%), Positives = 33/57 (57%) Query: 81 GGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNE 137 G +++DS+GRI++ +R + G+E E +G+ N ++W + + +E++ E Sbjct: 3 AGATEVELDSKGRIILPAKLREYAGLEKECVTIGQDNCLEIWPRAEWEQYEEKANEE 59 Score = 25.7 bits (57), Expect = 4.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 4 FLSNVTQKIDSKGRVSVPFVFR 25 F ++DSKGR+ +P R Sbjct: 2 FAGATEVELDSKGRIILPAKLR 23 >gnl|CDD|36609 KOG1395, KOG1395, KOG1395, Tryptophan synthase beta chain [Amino acid transport and metabolism]. Length = 477 Score = 27.7 bits (61), Expect = 1.2 Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 6/64 (9%) Query: 80 HGGGIFLKMDSEGRILMTDFIRV---FTGIENEVTFV---GRGNYFQLWNPQTFRKLQEE 133 HG ++ D++G+I I + G+ E++ + GR + + + + ++ Sbjct: 348 HGVTTYVLQDTDGQIFDPHSISAGLDYPGVGPELSHLKETGRAEFISITDAECLEGFKQL 407 Query: 134 SRNE 137 SR E Sbjct: 408 SRLE 411 >gnl|CDD|35812 KOG0592, KOG0592, KOG0592, 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]. Length = 604 Score = 27.3 bits (60), Expect = 1.7 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 18/84 (21%) Query: 33 ITDLYC-FQD---FFFPAISVGNSDLLEYFEQKIAEYNPFSIQ---ANQLSLL--VHGGG 83 I LY FQD +F N DLL+ +K ++ + A L L +H G Sbjct: 136 IVKLYFTFQDEESLYFVLEYAPNGDLLDLI-KKYGSFDETCARFYAAEILDALEYLHSNG 194 Query: 84 IF--------LKMDSEGRILMTDF 99 I + +D +G I +TDF Sbjct: 195 IIHRDLKPENILLDKDGHIKITDF 218 >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1. Length = 321 Score = 26.5 bits (58), Expect = 2.7 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 6/45 (13%) Query: 88 MDSEGRILMTDFIRVFTGIENE---VTFVGRGNYFQLWNPQTFRK 129 +DS+G +++TDF G+E E TF G Y P+ RK Sbjct: 129 LDSQGHVVLTDFGLCKEGVEPEETTSTFCGTPEYLA---PEVLRK 170 >gnl|CDD|133074 cd03863, M14_CPD_II, The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain II. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, while the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active at pH 6.3-7.5 and prefers substrates with C-terminal Arg, whereas domain II is active at pH 5.0-6.5 and prefers substrates with C-terminal Lys. CPD functions in the processing of proteins that transit the secretory pathway, and is present in all vertebrates as well as Drosophila. It is broadly distributed in all tissue types. Within cells, CPD is present in the trans-Golgi network and immature secretory vesicles, but is excluded from mature vesicles. It is thought to play a role in the processing of proteins that are initially processed by furin or related endopeptidases present in the trans-Golgi network, such as growth factors and receptors. CPD is implicated in the pathogenesis of lupus erythematosus (LE), it is regulated by TGF-beta in various cell types of murine and human origin and is significantly down-regulated in CD14 positive cells isolated from patients with LE. As down -regulation of CPD leads to down-modulation of TGF-beta, CPD may have a role in a positive feedback loop. Length = 375 Score = 26.5 bits (58), Expect = 3.0 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Query: 71 QANQLSLLVHGGGI------FLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNP 124 + N+ SLL + F+ ++GR ++ I V I + VT G+Y++L P Sbjct: 282 EQNRRSLLQFMKQVHRGVRGFVLDATDGRGILNATISV-ADINHPVTTYKDGDYWRLLVP 340 Query: 125 QTFR 128 T++ Sbjct: 341 GTYK 344 >gnl|CDD|147211 pfam04928, PAP_central, Poly(A) polymerase central domain. The central domain of Poly(A) polymerase shares structural similarity with the allosteric activity domain of ribonucleotide reductase R1, which comprises a four-helix bundle and a three-stranded mixed beta- sheet. Even though the two enzymes bind ATP, the ATP-recognition motifs are different. Length = 347 Score = 26.1 bits (58), Expect = 4.2 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 23 VFRTILAQRC-ITDLYCFQDFFFPAI 47 F IL R +T+L+ +D F P I Sbjct: 116 SFYEILKGRPEVTELHPVEDAFVPII 141 >gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism]. Length = 540 Score = 25.6 bits (56), Expect = 5.1 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Query: 17 RVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEY--FEQKIAEYNPFSIQANQ 74 +V++P + I A + + C DF P I G LE ++ ++ ++ +A Sbjct: 187 KVTLPLLRPAIAAGALLVFMLCLADFGTPLILGGGYTTLETAIYQAIMSSFDL--ARAAL 244 Query: 75 LSLL 78 L+LL Sbjct: 245 LALL 248 >gnl|CDD|32307 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 411 Score = 25.4 bits (55), Expect = 5.1 Identities = 22/95 (23%), Positives = 32/95 (33%), Gaps = 9/95 (9%) Query: 54 LLEYFEQKIAEYNPFSIQANQLSLLVH----GGGIFLKMDSEGRILMTDFIRVFTGIENE 109 L Y IAE + LSLL+ GGG S+ I + G E Sbjct: 198 LDAYLRALIAERRAAPRD-DLLSLLLSAEDDGGGRL----SDDEIRDELITLLVAGHETT 252 Query: 110 VTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ 144 + Y L +P KL+ E +++ Sbjct: 253 ANALAWALYALLRHPDQLAKLRAEPDRPLLEAVVE 287 >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels, and receptors. It plays a critical role in hair follicle morphogenesis and hair cycling. Length = 325 Score = 25.4 bits (55), Expect = 6.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Query: 88 MDSEGRILMTDFIRVFTGI---ENEVTFVGRGNYFQLWNPQTFRK 129 +DS+G +++TDF GI + TF G Y P+ RK Sbjct: 129 LDSQGHVVLTDFGLCKEGIAQSDTTTTFCGTPEYLA---PEVIRK 170 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.142 0.423 Gapped Lambda K H 0.267 0.0758 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,781,959 Number of extensions: 88000 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's gapped: 285 Number of HSP's successfully gapped: 15 Length of query: 145 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 60 Effective length of database: 4,426,972 Effective search space: 265618320 Effective search space used: 265618320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.1 bits)