RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781106|ref|YP_003065519.1| cell division protein MraZ [Candidatus Liberibacter asiaticus str. psy62] (145 letters) >gnl|CDD|178978 PRK00326, PRK00326, cell division protein MraZ; Reviewed. Length = 139 Score = 138 bits (351), Expect = 5e-34 Identities = 39/145 (26%), Positives = 69/145 (47%), Gaps = 11/145 (7%) Query: 3 RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQD-----FFFPAISVGNSDLLEY 57 F +D+KGR+S+P FR L + L + +P E Sbjct: 1 MFRGEYAHNLDAKGRLSIPAKFRDELGEEADGRLVITKGLDGCLLLYPL------PEWEK 54 Query: 58 FEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGN 117 E+K+A + +A L+ GG + +++D +GRIL+ +R + G+E EV VG+GN Sbjct: 55 IEEKLAALPLTNPEARAFQRLLLGGAVEVELDKQGRILIPPNLREYAGLEKEVVLVGQGN 114 Query: 118 YFQLWNPQTFRKLQEESRNEYCRQL 142 F++W+P+ + E+ ++ L Sbjct: 115 KFEIWDPEAWEAYLAEAEEDFADDL 139 >gnl|CDD|129345 TIGR00242, TIGR00242, mraZ protein. Members of this family contain two tandem copies of a domain described by pfam02381. This protein often is found with other genes of the dcw (division cell wall) gene cluster, including mraW, ftsI, murE, murF, ftsW, murG, etc. Length = 142 Score = 57.5 bits (139), Expect = 1e-09 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 9/135 (6%) Query: 1 MSRFLSNVTQKIDSKGRVSVPFVFRT-ILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE 59 M R +NVT +D+KGR+SVP +R +L F + + E E Sbjct: 1 MFRGATNVT--LDAKGRISVPAKYRAFLLESVVTNRG------FENCLLLYPLQEWEKIE 52 Query: 60 QKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYF 119 QK+ +L L+ G +MD+ GR+L+ + +R +E E+ +G+ N F Sbjct: 53 QKLNALPSTQKDTRRLQRLIFGHATECEMDTAGRVLIANNLRNHAKLEKEIVLIGQFNKF 112 Query: 120 QLWNPQTFRKLQEES 134 ++W+ + + E Sbjct: 113 EIWDKVLWEQYLAED 127 >gnl|CDD|181484 PRK08577, PRK08577, hypothetical protein; Provisional. Length = 136 Score = 28.4 bits (64), Expect = 0.77 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 11 KIDSKGRVSVPFVFRTIL 28 K+DSKGR+++P R L Sbjct: 8 KVDSKGRITIPLEIREAL 25 >gnl|CDD|139055 PRK12546, PRK12546, RNA polymerase sigma factor; Provisional. Length = 188 Score = 27.9 bits (62), Expect = 0.94 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 79 VHGGGIFLKMDSEGRILMTDFIRVFTGIENE----VTFVGRGNY 118 VH + +K +GR+ M+DF F + +E + VG + Sbjct: 87 VHAASLAVKPAHDGRLAMSDFRAAFAQLPDEQREALILVGASGF 130 >gnl|CDD|181560 PRK08815, PRK08815, GTP cyclohydrolase; Provisional. Length = 375 Score = 25.9 bits (57), Expect = 3.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 81 GGGIFLKMDSEGR 93 GGG+ L +D EGR Sbjct: 253 GGGVLLYLDQEGR 265 >gnl|CDD|151551 pfam11107, FANCF, Fanconi anemia group F protein (FANCF). FANCF regulates its own expression by methylation at both mRNA and protein levels. Methylation-induced inactivation of FANCF has an important role on the occurrence of ovarian cancers by disrupting the FA-BRCA pathway. Length = 343 Score = 25.5 bits (56), Expect = 4.9 Identities = 9/37 (24%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 109 EVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK 145 EV + R ++ W+P T R+ + + Y Q+ ++ Sbjct: 13 EVLALSRSDHVATWDPATVRRAFQWAL--YFEQVHRR 47 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.142 0.423 Gapped Lambda K H 0.267 0.0740 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,339,240 Number of extensions: 137673 Number of successful extensions: 369 Number of sequences better than 10.0: 1 Number of HSP's gapped: 366 Number of HSP's successfully gapped: 25 Length of query: 145 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 61 Effective length of database: 4,179,401 Effective search space: 254943461 Effective search space used: 254943461 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (23.8 bits)