HHsearch alignment for GI: 254781108 and conserved domain: COG4867

>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only].
Probab=92.65  E-value=0.65  Score=23.89  Aligned_cols=104  Identities=19%  Similarity=0.233  Sum_probs=65.4

Q ss_pred             HHHCCCCC--CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCC------C--CCCCCCHHHHH----
Q ss_conf             97357788--8744588999999961134666665667666651699815887787------7--77766314899----
Q gi|254781108|r  265 RLNKLNPY--ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG------A--SAYQNTLNTLQ----  330 (398)
Q Consensus       265 ~I~~l~~~--G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~~~------~--~~~~~~~~~~~----  330 (398)
T Consensus       521 eLt~l~~v~eqgTNlhhaL~LA~r~l~Rh----------~~~~~~il~vTDGePtAhle~~DG~~~~f~yp~DP~t~~~T  590 (652)
T COG4867         521 ELTGLAGVYEQGTNLHHALALAGRHLRRH----------AGAQPVVLVVTDGEPTAHLEDGDGTSVFFDYPPDPRTIAHT  590 (652)
T ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHHHHC----------CCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCCHHHHHHH
T ss_conf             98248876745554588999999998737----------56576289983798630134789856616899877799898


Q ss_pred             --HHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCC-CCCEEEECCHHHHHHH
Q ss_conf             --999999789889999954797558999998519-9818994698999999
Q gi|254781108|r  331 --ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDS-SGQFFAVNDSRELLES  379 (398)
Q Consensus       331 --~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~-~~~yy~a~~~~~L~~a  379 (398)
T Consensus       591 vr~~d~~~r~G~q~t~FrLg~DpgL~~Fv~qva~rv~G~vv-~pdldglGaa  641 (652)
T COG4867         591 VRGFDDMARLGAQVTIFRLGSDPGLARFIDQVARRVQGRVV-VPDLDGLGAA  641 (652)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCEEE-ECCCCHHHHH
T ss_conf             99888887516413677522777689999999998588488-1382213589