HHsearch alignment for GI: 254781108 and conserved domain: PRK13406

>PRK13406 bchD magnesium chelatase subunit D; Provisional.
Probab=98.62  E-value=3.5e-06  Score=55.45  Aligned_cols=155  Identities=15%  Similarity=0.172  Sum_probs=105.1

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41000245665541022027687765213465412677654311235689999999973577888744588999999961
Q gi|254781108|r  209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL  288 (398)
Q Consensus       209 ~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l  288 (398)
T Consensus       418 Rm~~aKGAV~~LL~dAY-------~~RD~ValIaFRG~-~AevlLPPTrSv~~A~r~L~~LP~GG~TPLA~GL~~A~~l~  489 (584)
T PRK13406        418 RLAEAKGAVELLLAECY-------VRRDHVALVAFRGR-GAELLLPPTRSLVRAKRSLAGLPGGGGTPLAAGLDAALALA  489 (584)
T ss_pred             HHHHHHHHHHHHHHHHH-------HHHCEEEEEEECCC-CCEEEECCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999999999-------60044789987687-63074188655999999996299999885999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC-----CCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             13466666566766665169981588778777776-----6314899999999789889999954797558999998519
Q gi|254781108|r  289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ-----NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDS  363 (398)
Q Consensus       289 ~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~-----~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~  363 (398)
T Consensus       490 ~~~r~~--------~~~p~~VllTDGRaNv~ldg~~~r~~a~~da~~~A~~l~~~g~~~vVIDT~--~~~~~~a~~LA~~  559 (584)
T PRK13406        490 LSVRRK--------GQTPTVVLLTDGRANIARDGAGGRAQAEEDALAAARALRAAGLPALVIDTS--PRPQPQARALAEA  559 (584)
T ss_pred             HHHHCC--------CCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECC--CCCCHHHHHHHHH
T ss_conf             997557--------995489998279877787778871148999999999999769978999489--8886269999998


Q ss_pred             -CCCEEEEC--CHHHHHHHHH
Q ss_conf             -98189946--9899999999
Q gi|254781108|r  364 -SGQFFAVN--DSRELLESFD  381 (398)
Q Consensus       364 -~~~yy~a~--~~~~L~~aF~  381 (398)
T Consensus       560 l~a~Y~~Lp~~~A~~l~~~V~  580 (584)
T PRK13406        560 MGARYLPLPRADATRLSQAVR  580 (584)
T ss_pred             CCCCEEECCCCCHHHHHHHHH
T ss_conf             399189789789899999999