HHsearch alignment for GI: 254781108 and conserved domain: cd01452

>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins. It is an ATP-dependent protease responsible for the bulk of non-lysosomal proteolysis in eukaryotes, often using covalent modification of proteins by ubiquitylation. It consists of a 20S proteolytic core particle (CP) and a 19S regulatory particle (RP). The CP is an ATP independent peptidase consisting of hydrolyzing activities. One or both ends of CP carry the RP that confers both ubiquitin and ATP dependence to the 26S proteosome. The RP's proposed functions include recognition of substrates and translocation of these to CP for proteolysis. The RP can dissociate into a stable lid and base subcomplexes. The base is composed of three non-ATPase subunits (Rpn 1, 2 and 10). A single residue in the vWA domain of Rpn10 has been implicated to be responsible for stabilizing the lid-base association.
Probab=96.82  E-value=0.032  Score=31.70  Aligned_cols=153  Identities=10%  Similarity=0.196  Sum_probs=98.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             33410002456655410220276877652134654126776543112356899999999735778887445889999999
Q gi|254781108|r  207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR  286 (398)
Q Consensus       207 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~  286 (398)
T Consensus        23 PtR~~AQ~dAvn~i~~~k~~~Np--E---n~VGl~tmag-~~~~Vl~TlT~D~gkiL~~lh~i~~~G~~~~~~~IqiA~L   96 (187)
T cd01452          23 PTRFQAQADAVNLICQAKTRSNP--E---NNVGLMTMAG-NSPEVLVTLTNDQGKILSKLHDVQPKGKANFITGIQIAQL   96 (187)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCC--C---CCEEEEEECC-CCCEEEEECCCCHHHHHHHCCCCCCCCEECHHHHHHHHHH
T ss_conf             71899999999999977751495--3---3113576158-9866898448657889875326771876518879999999


Q ss_pred             HHCCCCCCCCCCCCCCCCC-EEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHH----
Q ss_conf             6113466666566766665-16998158877877777663148999999997898899999547975589999985----
Q gi|254781108|r  287 ELYNEKESSHNTIGSTRLK-KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT----  361 (398)
Q Consensus       287 ~l~~~~~~~~~~~~~~~~~-k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cA----  361 (398)
T Consensus        97 ALKHR--------qnk~~~qRIv~FV-gSPi-----~~~ek~l~~laKklKKnnV~vDII~FGe~~~n~~kL~~f~~~vn  162 (187)
T cd01452          97 ALKHR--------QNKNQKQRIVAFV-GSPI-----EEDEKDLVKLAKRLKKNNVSVDIINFGEIDDNTEKLTAFIDAVN  162 (187)
T ss_pred             HHHCC--------CCCCCCEEEEEEE-CCCC-----CCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             97234--------6777544799997-8987-----55789999999987555853589994688899899999999845


Q ss_pred             CC-CCCEEEECCHHHH-HHH
Q ss_conf             19-9818994698999-999
Q gi|254781108|r  362 DS-SGQFFAVNDSREL-LES  379 (398)
Q Consensus       362 s~-~~~yy~a~~~~~L-~~a  379 (398)
T Consensus       163 ~~~~Shlv~ippg~~lLSd~  182 (187)
T cd01452         163 GKDGSHLVSVPPGENLLSDA  182 (187)
T ss_pred             CCCCCEEEEECCCCCHHHHH
T ss_conf             89982599947998645676