HHsearch alignment for GI: 254781108 and conserved domain: cd01463

>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta. The alpha 2 and delta subunits result from proteolytic processing of a single gene product and carries at its N-terminus the VWA and cache domains, The alpha 2 delta gene family has orthologues in D. melanogaster and C. elegans but none have been detected in aither A. thaliana or yeast. The exact biochemical function of the VWA domain is not known but the alpha 2 delta complex has been shown to regulate various functional properties of the channel complex.
Probab=99.75  E-value=4.6e-17  Score=120.76  Aligned_cols=171  Identities=13%  Similarity=0.229  Sum_probs=116.4

Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             45565431357505566666676663101233102301268876540310134322011255533341000245665541
Q gi|254781108|r  143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN  222 (398)
Q Consensus       143 ~~~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  222 (398)
T Consensus         9 a~~~Pkdvv~vlD~SGSM~g~---------------------------------------------kl~~ak~a~~~il~   43 (190)
T cd01463           9 AATSPKDIVILLDVSGSMTGQ---------------------------------------------RLHLAKQTVSSILD   43 (190)
T ss_pred             CCCCCCEEEEEEECCCCCCCC---------------------------------------------HHHHHHHHHHHHHH
T ss_conf             678982699999799988973---------------------------------------------49999999999998


Q ss_pred             HHHHCCCCCCCCCEEEEEEECCCCCCCC-------CCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             0220276877652134654126776543-------112356899999999735778887445889999999611346666
Q gi|254781108|r  223 SIQKAIQEKKNLSVRIGTIAYNIGIVGN-------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS  295 (398)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~~~~  295 (398)
T Consensus        44 ~L~~~--------D~~~iv~Fs~~~~~~~p~~~~~~~~~t~~n~~~~~~~i~~l~~~G~Tn~~~al~~A~~~l~~~~~~~  115 (190)
T cd01463          44 TLSDN--------DFFNIITFSNEVNPVVPCFNDTLVQATTSNKKVLKEALDMLEAKGIANYTKALEFAFSLLLKNLQSN  115 (190)
T ss_pred             HCCCC--------CEEEEEEECCCCEEEECCCCCCEEECCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             19987--------7999999689753630245684336899999999999982857987248999999999998742015


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH--HCCCEEEEEEECCCCCHHHHHHHHHCC-CCCEEEECC
Q ss_conf             65667666651699815887787777766314899999999--789889999954797558999998519-981899469
Q gi|254781108|r  296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR--NAGMKIYSVAVSAPPEGQDLLRKCTDS-SGQFFAVND  372 (398)
Q Consensus       296 ~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K--~~gi~IytIg~~~~~~~~~~l~~cAs~-~~~yy~a~~  372 (398)
T Consensus       116 ~~~~-~~~~~~~IillTDG~~~~~------~~i~~~~~~~~~~~~~i~ift~G~G~~~~d~~~L~~iA~~~~G~y~~I~~  188 (190)
T cd01463         116 HSGS-RSQCNQAIMLITDGVPENY------KEIFDKYNWDKNSEIPVRVFTYLIGREVTDRREIQWMACENKGYYSHIQS  188 (190)
T ss_pred             CCCC-CCCCCCEEEEEECCCCCCH------HHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
T ss_conf             5665-5555515999836988757------88999999975579987999999679977879999999809956997888


Q ss_pred             H
Q ss_conf             8
Q gi|254781108|r  373 S  373 (398)
Q Consensus       373 ~  373 (398)
T Consensus       189 ~  189 (190)
T cd01463         189 L  189 (190)
T ss_pred             C
T ss_conf             9