HHsearch alignment for GI: 254781108 and conserved domain: cd01471

>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell. In association with invasion, T. gondii sequentially discharges three sets of secretory organelles beginning with the micronemes, which contain adhesive proteins involved in parasite attachment to a host cell. Deployed as protein complexes, several micronemal proteins possess vertebrate-derived adhesive sequences that function in binding receptors. The VWA domain likely mediates the protein-protein interactions of these with their interacting partners.
Probab=99.64  E-value=4e-14  Score=103.10  Aligned_cols=172  Identities=16%  Similarity=0.200  Sum_probs=117.5

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             43135750556666667666310123310230126887654031013432201125553334100024566554102202
Q gi|254781108|r  148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA  227 (398)
Q Consensus       148 ~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~  227 (398)
T Consensus         1 lDlvFllD~S~SVg~~n~--------------------------------------------f~~~k~F~~~lv~~f~--   34 (186)
T cd01471           1 LDLYLLVDGSGSIGYSNW--------------------------------------------VTHVVPFLHTFVQNLN--   34 (186)
T ss_pred             CEEEEEEECCCCCCCCCH--------------------------------------------HHHHHHHHHHHHHHCC--
T ss_conf             909999948898886131--------------------------------------------8999999999999749--


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCCC--CCCCHHH---HHHHHHCCC-CCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             768776521346541267765431123--5689999---999973577-8887445889999999611346666656676
Q gi|254781108|r  228 IQEKKNLSVRIGTIAYNIGIVGNQCTP--LSNNLNE---VKSRLNKLN-PYENTNTYPAMHHAYRELYNEKESSHNTIGS  301 (398)
Q Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--lt~~~~~---~~~~I~~l~-~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~  301 (398)
T Consensus        35 ---I~~~~~rVgvv~ys~~~~~~~~l~~~~~~~~~~~~~~~~~i~~~~y~gg~T~Tg~AL~~a~~~~f~~~g~R------  105 (186)
T cd01471          35 ---ISPDEINLYLVTFSTNAKELIRLSSPNSTNKDLALNAIRALLSLYYPNGSTNTTSALLVVEKHLFDTRGNR------  105 (186)
T ss_pred             ---CCCCCEEEEEEEECCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCC------
T ss_conf             ---69884499999954870599875775544656799999999837778996779999999999721146889------


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCC-----EEEECCHHHH
Q ss_conf             66651699815887787777766314899999999789889999954797558999998519981-----8994698999
Q gi|254781108|r  302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ-----FFAVNDSREL  376 (398)
Q Consensus       302 ~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~-----yy~a~~~~~L  376 (398)
T Consensus       106 ~~vpkv~illTDG~s~d~------~~~~~~a~~Lr~~GV~ifavGVG~-~v~~~eL~~Iag~~~~~~~c~~~~~~~~~~l  178 (186)
T cd01471         106 ENAPQLVIIMTDGIPDSK------FRTLKEARKLRERGVIIAVLGVGQ-GVNHEENRSLVGCDPDDSPCPLYLQSSWSEV  178 (186)
T ss_pred             CCCCEEEEEEECCCCCCC------CHHHHHHHHHHHCCCEEEEEECCC-CCCHHHHHHHCCCCCCCCCCCEEEECCHHHH
T ss_conf             999859999906987785------258999999998899999998343-2499999997099988899865751788888


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254781108|r  377 LESFD  381 (398)
Q Consensus       377 ~~aF~  381 (398)
T Consensus       179 ~~~~~  183 (186)
T cd01471         179 QNVIK  183 (186)
T ss_pred             HHHHH
T ss_conf             74775