HHsearch alignment for GI: 254781108 and conserved domain: smart00327

>smart00327 VWA von Willebrand factor (vWF) type A domain. VWA domains in extracellular eukaryotic proteins mediate adhesion via metal ion-dependent adhesion sites (MIDAS). Intracellular VWA domains and homologues in prokaryotes have recently been identified. The proposed VWA domains in integrin beta subunits have recently been substantiated using sequence-based methods.
Probab=99.65  E-value=1.9e-14  Score=105.09  Aligned_cols=160  Identities=21%  Similarity=0.278  Sum_probs=116.4

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             54313575055666666766631012331023012688765403101343220112555333410002456655410220
Q gi|254781108|r  147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK  226 (398)
Q Consensus       147 ~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  226 (398)
T Consensus         1 ~~di~~vvD~S~SM~~~---------------------------------------------~~~~~k~~~~~~i~~l~~   35 (177)
T smart00327        1 PLDVVFLLDGSGSMGPN---------------------------------------------RFEKAKEFVLKLVEQLDI   35 (177)
T ss_pred             CCEEEEEEECCCCCCCH---------------------------------------------HHHHHHHHHHHHHHHHHC
T ss_conf             94899999288998828---------------------------------------------999999999999998641


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCC--CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             276877652134654126776543112356899999999735778--887445889999999611346666656676666
Q gi|254781108|r  227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKESSHNTIGSTRL  304 (398)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~--~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~  304 (398)
T Consensus        36 ~~-----~~~~v~vv~f~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~g~t~~~~al~~a~~~~~~~~~~~~-----~~~  105 (177)
T smart00327       36 GP-----DGDRVGLVTFSDDATVLFPLNDSRSKDALLEALASLSYKLGGGTNLGAALQYALENLFSKSAGSR-----RGA  105 (177)
T ss_pred             CC-----CCCEEEEEEECCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-----CCC
T ss_conf             79-----98789999963726899768886899999999971415578877642899999999976650377-----887


Q ss_pred             CEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCEE
Q ss_conf             5169981588778777776631489999999978988999995479755899999851998189
Q gi|254781108|r  305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF  368 (398)
Q Consensus       305 ~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~yy  368 (398)
T Consensus       106 ~~~iil~TDG~~~~~------~~~~~~~~~~~~~~v~i~~ig~g~~-~~~~~l~~ia~~~~~~~  162 (177)
T smart00327      106 PKVLILITDGESNDG------GDLLKAAKELKRSGVKVFVVGVGND-VDEEELKKLASAPGGVY  162 (177)
T ss_pred             CEEEEEEECCCCCCC------HHHHHHHHHHHHCCCEEEEEEECCC-CCHHHHHHHHHCCCCEE
T ss_conf             428999805887872------5299999999867948999995884-79999999984899659