HHsearch alignment of GI: 254781108 and MMDB domain: 1jey_A_1-252

>1jey_A (A:1-252) KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}
Probab=99.64  E-value=3.8e-16  Score=114.89  Aligned_cols=191  Identities=12%  Similarity=0.110  Sum_probs=130.1

Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             56543135750556666667666310123310230126887654031013432201125553334100024566554102
Q gi|254781108|r  145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI  224 (398)
Q Consensus       145 ~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~  224 (398)
                      ....++++|+|.|+||........                                      ..+++..+.++..++..+
T Consensus        33 ~~~~div~viD~S~SM~~~~~~~~--------------------------------------~s~~~~~k~~~~~~i~~l   74 (252)
T 1jey_A           33 SGRDSLIFLVDASKAMFESQSEDE--------------------------------------LTPFDMSIQCIQSVYISK   74 (252)
T ss_dssp             -CEEEEEEEEECSGGGGCCCSSSS--------------------------------------CCHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEEEECCHHHCCCCCCCC--------------------------------------CCHHHHHHHHHHHHHHHC
T ss_conf             684599999989878878788889--------------------------------------784999999999999961


Q ss_pred             HHCCCCCCCCCEEEEEEECCCCCCCC--------CCCCCC----CCHHHHHHHHHC---------CCCCCCCCHHHHHHH
Q ss_conf             20276877652134654126776543--------112356----899999999735---------778887445889999
Q gi|254781108|r  225 QKAIQEKKNLSVRIGTIAYNIGIVGN--------QCTPLS----NNLNEVKSRLNK---------LNPYENTNTYPAMHH  283 (398)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~lt----~~~~~~~~~I~~---------l~~~G~T~~~~gl~~  283 (398)
                      .....     ..+.+.+.|.......        .+.++.    .+...+...++.         ..+.|+|++..||..
T Consensus        75 ~~~~~-----~~~v~iv~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~~~~al~~  149 (252)
T 1jey_A           75 IISSD-----RDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWV  149 (252)
T ss_dssp             HHTTC-----CCEEEEEEESCSSCBSTTCCTTEEEEEEEECCCHHHHHHHHTTSHHHHHHHHHHHHCCSCCCCHHHHHHH
T ss_pred             CCCCC-----CCEEEEEEECCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCHHHHHHH
T ss_conf             66799-----9818999973689888889870799504888799999999976402331022103676654439999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCC------HHHHH
Q ss_conf             999611346666656676666516998158877877777663148999999997898899999547975------58999
Q gi|254781108|r  284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE------GQDLL  357 (398)
Q Consensus       284 a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~------~~~~l  357 (398)
                      +...|.....        ...+|+|||+|||+.+.............+++.+++.||.+|+|+++.+..      ...++
T Consensus       150 a~~~l~~~~~--------~~~~~~iiliTDG~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~i~i~~~~~~~~~~~~~~~~  221 (252)
T 1jey_A          150 CANLFSDVQF--------KMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDII  221 (252)
T ss_dssp             HHHHHHTCSS--------CEEEEEEEEEESCSCTTTTCHHHHHHHHHHHHHHHHHTEEEEEEEBCCTTCCCTTTTGGGTC
T ss_pred             HHHHHHHHCC--------CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             9999986130--------23674799988999878875377999999999999709047883468889876103168774


Q ss_pred             HHHHCC-CCCEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             998519-9818994698999999999999875
Q gi|254781108|r  358 RKCTDS-SGQFFAVNDSRELLESFDKITDKIQ  388 (398)
Q Consensus       358 ~~cAs~-~~~yy~a~~~~~L~~aF~~I~~~i~  388 (398)
                      +.++.. +++||.+.+  .|.++|++|..++.
T Consensus       222 ~~~~~~~~~~~~~~~~--~l~~~~~~i~~~~~  251 (252)
T 1jey_A          222 SIAEDEDLRVHFEESS--KLEDLLRKVRAKET  251 (252)
T ss_dssp             C--------CCCCCBC--SHHHHHHHHHHHHS
T ss_pred             HHCCCCCCCCCCCCHH--HHHHHHHHHHHCCC
T ss_conf             1113322234665156--69999987642200