HHsearch alignment of GI: 254781108 and MMDB domain: 1jey_B_1-236_463-505

>1jey_B (B:1-236,B:463-505) KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}
Probab=99.51  E-value=1.7e-12  Score=92.95  Aligned_cols=186  Identities=9%  Similarity=0.036  Sum_probs=121.2

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             54313575055666666766631012331023012688765403101343220112555333410002456655410220
Q gi|254781108|r  147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK  226 (398)
Q Consensus       147 ~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  226 (398)
                      ..++++|+|.||||......                                       ...+++..+.++..++..+..
T Consensus         7 k~~ivlviD~SgSM~~~~~~---------------------------------------~~tr~~~ak~a~~~li~~~~~   47 (279)
T 1jey_B            7 KAAVVLCMDVGFTMSNSIPG---------------------------------------IESPFEQAKKVITMFVQRQVF   47 (279)
T ss_dssp             CEEEEEEEECCGGGGCCBTT---------------------------------------BCCHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEECCHHHCCCCCC---------------------------------------CCCHHHHHHHHHHHHHHHHHC
T ss_conf             96399999898677677889---------------------------------------999799999999999998723


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCC------------CCC-CCCCHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHCCCC
Q ss_conf             2768776521346541267765431------------123-56899999999735778-887445889999999611346
Q gi|254781108|r  227 AIQEKKNLSVRIGTIAYNIGIVGNQ------------CTP-LSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEK  292 (398)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~-lt~~~~~~~~~I~~l~~-~G~T~~~~gl~~a~~~l~~~~  292 (398)
                      ...     ..+.+.+.|+.......            ..+ ...+...++..++.+.+ +|+|+++.||..|...+....
T Consensus        48 ~~~-----~d~vgiv~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~T~~~~aL~~A~~~l~~~~  122 (279)
T 1jey_B           48 AEN-----KDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHET  122 (279)
T ss_dssp             TTC-----CCEEEEEEESCSSCBSTTCTTTCSTTEEEEEEEECCCHHHHHHHHTTCCCCSSCCCHHHHHHHHHHHHHHHS
T ss_pred             CCC-----CCEEEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             899-----987999998347888755555675654985558998999999998644688778787999999999999875


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHH-----HHHHHHC-CCCC
Q ss_conf             666656676666516998158877877777663148999999997898899999547975589-----9999851-9981
Q gi|254781108|r  293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-----LLRKCTD-SSGQ  366 (398)
Q Consensus       293 ~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~-----~l~~cAs-~~~~  366 (398)
                      ...      +..+++|||+|||..+.+.     .....+++.+|+.||+||+||++.......     .+..++. +.+.
T Consensus       123 ~~~------~~~~~~IiliTDG~~~~~~-----~~~~~~~~~l~~~~i~i~~Igig~~~~~~~~~~~~~~~~~~~~~~~~  191 (279)
T 1jey_B          123 IGK------KFEKRHIEIFTDLSSRFSK-----SQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPS  191 (279)
T ss_dssp             SSS------CCSEEEEEEECCCCSCCCC-----TTHHHHHHHHHHTTEEEEEEESSCCC----------CCCCTTCSSCC
T ss_pred             HCC------CCCCEEEEEEECCCCCCCH-----HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             046------5454389998079988687-----89999999998659659996146665354664233302331124554


Q ss_pred             EEEECCHHHHHHHHH---HHHHHH
Q ss_conf             899469899999999---999987
Q gi|254781108|r  367 FFAVNDSRELLESFD---KITDKI  387 (398)
Q Consensus       367 yy~a~~~~~L~~aF~---~I~~~i  387 (398)
                      +|.+....++...++   +|...+
T Consensus       192 ~~~~~~~~~~~~~~~~l~~i~~~~  215 (279)
T 1jey_B          192 FPLKGITEQQKEGLEIVKMVMISL  215 (279)
T ss_dssp             CCTTTSCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             312343211233200112100001