HHsearch alignment of GI: 254781108 and MMDB domain: 2iue_A_

>2iue_A (A:) Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus}
Probab=99.34  E-value=1.6e-12  Score=93.15  Aligned_cols=189  Identities=11%  Similarity=0.063  Sum_probs=126.5

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .|+|+++|+|.||||+..                                              ....+.++..++..+.
T Consensus         2 ~pvDivfviD~SgSM~~~----------------------------------------------~~~~k~~~~~~i~~l~   35 (212)
T 2iue_A            2 NSVDLYFLMGLSGSAQGH----------------------------------------------LSNVQTLGSDLLKALN   35 (212)
T ss_dssp             CCEEEEEEEECCGGGTTT----------------------------------------------HHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEEECCCCHHHH----------------------------------------------HHHHHHHHHHHHHHHH
T ss_conf             856899999787131779----------------------------------------------9999999999999987


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             02768776521346541267765431123568999999997357788874458899999996113466666566766665
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK  305 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~  305 (398)
                      ....     ..+.+...|.+... ....+++.+...+...|+.|.+.|+|+...++..+...+.......    .....+
T Consensus        36 ~~~~-----~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~~i~~l~~~ggt~~~~~~~~a~~~~~~~~~~~----~~~~~~  105 (212)
T 2iue_A           36 EISR-----SGRIGFGSIVNMTF-QHILKLTADSSQFQRELRKQLVSGKLATPKGQLDAVVQVAICLGEI----GWRNGT  105 (212)
T ss_dssp             HHCS-----CEEEEEEEESSSCE-EEEEEEESCHHHHHHHHHTCCCCCCSSSSBCHHHHHHHHHHCHHHH----TCCSSE
T ss_pred             HCCC-----CCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC----CCCCCC
T ss_conf             4374-----43201344046543-2367766679999998742212578988831999999999856752----898774


Q ss_pred             EEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC----CCHHHHHHHHHCCCCCEEEECCHHHHHHHHH
Q ss_conf             169981588778777776631489999999978988999995479----7558999998519981899469899999999
Q gi|254781108|r  306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP----PEGQDLLRKCTDSSGQFFAVNDSRELLESFD  381 (398)
Q Consensus       306 k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~----~~~~~~l~~cAs~~~~yy~a~~~~~L~~aF~  381 (398)
                      |+|||+|||..+.......     ......+..++.++.++++.+    ......+......++.++.......+.+.|+
T Consensus       106 ~~iilltdg~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  180 (212)
T 2iue_A          106 RFLVLVTDNDFHLAKDKTL-----GTRQNTSDGRCHLDDGMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVKTYE  180 (212)
T ss_dssp             EEEEEECSSCBCCTTGGGG-----GTCCSCCCSSCCBSSSBBGGGGSSCCCCHHHHHHHHHHHTCEEEEEEEHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCHHH-----HHHHCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECHHHHHHHH
T ss_conf             6999987886344551134-----33303468716875464456666567758999999987098289995656689999


Q ss_pred             HHHHHHHHCEEEEC
Q ss_conf             99998751245734
Q gi|254781108|r  382 KITDKIQEQSVRIA  395 (398)
Q Consensus       382 ~I~~~i~~~r~~~~  395 (398)
                      .|++.+......+.
T Consensus       181 ~i~~~~~~~~~~~~  194 (212)
T 2iue_A          181 KLTTFIPKLTIGEL  194 (212)
T ss_dssp             HHHHHSTTCEEEEE
T ss_pred             HHHHHCCCCEEEEH
T ss_conf             99997698577413