HHsearch alignment of GI: 254781108 and MMDB domain: 2ww8_A_221-279_318-447_506-585

>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}
Probab=99.96  E-value=2.2e-29  Score=194.31  Aligned_cols=189  Identities=14%  Similarity=0.217  Sum_probs=141.9

Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             56543135750556666667666310123310230126887654031013432201125553334100024566554102
Q gi|254781108|r  145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI  224 (398)
Q Consensus       145 ~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~  224 (398)
                      +.++++++|||.|+||......                                       ...+++..+.+...++..+
T Consensus         2 ~~~~~i~~viD~S~SM~~~~~~---------------------------------------~~~~~~~~~~~~~~~~~~~   42 (269)
T 2ww8_A            2 SVPLDVVILLDNSNSMSNIRNK---------------------------------------NARRAERAGEATRSLIDKI   42 (269)
T ss_dssp             TCCEEEEEEEECCGGGCTTHHH---------------------------------------HCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCCCCCCCCC---------------------------------------CCEEEEECCCCEEEEEEEE
T ss_conf             2245579996146630001346---------------------------------------5305652264504642577


Q ss_pred             HHCCCCCCCCCEEEEEEECCCCCCCC------------CCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             20276877652134654126776543------------112356899999999735778887445889999999611346
Q gi|254781108|r  225 QKAIQEKKNLSVRIGTIAYNIGIVGN------------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK  292 (398)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~  292 (398)
                      ...+.      .+.+++.|.+.....            .+.+++.+...++..++.+.++|||+++.||+|+++.+.+.+
T Consensus        43 ~~~~~------~~v~lv~f~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~i~~~~~~GgT~~~~AL~~a~~~l~~~~  116 (269)
T 2ww8_A           43 TSDSE------NRVALVTYASTIDYSYLKLTNDKNDIVELKNKVPTEAEDHDGNRLMYQFGATFTQKALMKADEILTQQA  116 (269)
T ss_dssp             HTSTT------CEEEEEEESSSBBCCEEEEECCHHHHHHHHHHSCSCCCCSCTTSGGGGGCSCCHHHHHHHHHHHHHHHS
T ss_pred             EECCC------CEEEEEEECCCCCCCEEEEEECCCCEEEECCEEEEEECCCCCCCEEECCCCEEEEEECCCCCEEEEECC
T ss_conf             75378------605788402310420255541254113303101232102456410101462466530022414776215


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCC-------------------------------------------------
Q ss_conf             6666566766665169981588778777776-------------------------------------------------
Q gi|254781108|r  293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQ-------------------------------------------------  323 (398)
Q Consensus       293 ~~~~~~~~~~~~~k~iillTDG~~~~~~~~~-------------------------------------------------  323 (398)
                      +        ...+|+|||||||+.+......                                                 
T Consensus       117 ~--------~~~~kvIiliTDG~~~~~~~~~~~~~~~~~~~~v~i~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (269)
T 2ww8_A          117 R--------QNSQKVIFHITDGVPTMSYPINFNHATFAPSYQNQLNAFFSKSPNKDGILLSDFITQATSGEHTIVRGDGQ  188 (269)
T ss_dssp             C--------SSSEEEEEEEESSCCSEECCBCCCCSTTCCCHHHHHHHHHHTSTTSSSCCGGGBCCCCTTCGGGTCEECSS
T ss_pred             C--------CCCCEEEEECCCCCCCEEECCCCCCCCCCEEEECCCEEEEEECCCCCEEEECCEEEEECCCCCEEECCCCE
T ss_conf             7--------76520478615663100000134454100476313105665112112066111012310122102037742


Q ss_pred             -----------CCHHHHHHHHHHHHCCCEEEEEEECCCCC-------HHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHH
Q ss_conf             -----------63148999999997898899999547975-------589999985199818994698999999999999
Q gi|254781108|r  324 -----------NTLNTLQICEYMRNAGMKIYSVAVSAPPE-------GQDLLRKCTDSSGQFFAVNDSRELLESFDKITD  385 (398)
Q Consensus       324 -----------~~~~~~~~c~~~K~~gi~IytIg~~~~~~-------~~~~l~~cAs~~~~yy~a~~~~~L~~aF~~I~~  385 (398)
                                 .+..+..+|+.+|++||+||||||+.++.       ++++|++|||+|+|||+|++   |.++|++|++
T Consensus       189 ~~~~~~~~~~~~~~~~~~~c~~~k~~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~~---~~~~f~~ia~  265 (269)
T 2ww8_A          189 SNSNTAKITNHGDPTRWYYNGNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTD---TTKILEQLNR  265 (269)
T ss_dssp             CTCSSCCBCBSHHHHHHHHHHHTGGGCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEESS---GGGHHHHHHH
T ss_pred             ECCCCEEEEECCCCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEECC---CCCEECCCCC
T ss_conf             7532057620474305788752046763035776771564210023430577566116653264056---6511113355


Q ss_pred             HHHH
Q ss_conf             8751
Q gi|254781108|r  386 KIQE  389 (398)
Q Consensus       386 ~i~~  389 (398)
                      +|.+
T Consensus       266 ~~~~  269 (269)
T 2ww8_A          266 YFHT  269 (269)
T ss_dssp             HHTT
T ss_pred             CCEE
T ss_conf             4127