HHsearch alignment of GI: 254781108 and MMDB domain: 3efo_B_171-421

>3efo_B (B:171-421) SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B
Probab=90.05  E-value=1  Score=22.27  Aligned_cols=113  Identities=8%  Similarity=0.046  Sum_probs=75.4

Q ss_pred             CCCCCCCCCHHHHHHHHHCCCC------CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             3112356899999999735778------8874458899999996113466666566766665169981588778777776
Q gi|254781108|r  250 NQCTPLSNNLNEVKSRLNKLNP------YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ  323 (398)
Q Consensus       250 ~~~~~lt~~~~~~~~~I~~l~~------~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~  323 (398)
                      ....++...+..+...++.|..      ..++..+.++..+...|.....           ...|+++++|..+.+...-
T Consensus        92 ~~l~~~~e~~~~i~~ll~~l~~~~~~~~~~~~~~G~Al~~a~~ll~~~~~-----------gG~Ii~f~sg~P~~G~g~~  160 (251)
T 3efo_B           92 GFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPVIQAGMEALKAADC-----------PGKLFIFHSSLPTAEAPGK  160 (251)
T ss_dssp             SSSBCTTTTHHHHHHHHHHHHHHHHTCCCCCCCCHHHHHHHHHHHHHHTC-----------CEEEEEEECSCCCSSSTTC
T ss_pred             CEEEEHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCC-----------CCEEEEEECCCCCCCCCCC
T ss_conf             56534799899999999843564167888764379999999999724589-----------9608999747998789854


Q ss_pred             ---------------------CCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHC-CCCCEEEECCH
Q ss_conf             ---------------------631489999999978988999995479755899999851-99818994698
Q gi|254781108|r  324 ---------------------NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDS  373 (398)
Q Consensus       324 ---------------------~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs-~~~~yy~a~~~  373 (398)
                                           ...--..++..+.+.||.+-...+..+.-+-..|..++. ++|+.|.-++-
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~fY~~la~~~~~~~isvdif~~~~~~~~l~~l~~l~~~TgG~i~~y~~f  232 (251)
T 3efo_B          161 LKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNF  232 (251)
T ss_dssp             CCCCCCCCCSSCSCGGGGGSCSSSHHHHHHHHHHHTTEEEEEEECCSSCCCHHHHTHHHHHTTCCEEECTTC
T ss_pred             CCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHCCCEEEEECCC
T ss_conf             456553334676044542151068999999999975956999973487667799999998659679995898