Query         gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 398
No_of_seqs    141 out of 1170
Neff          10.5
Searched_HMMs 13730
Date          Wed Jun  1 11:37:55 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781108.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1q0pa_ c.62.1.1 (A:) Compleme  99.8 2.5E-19 1.8E-23  131.6  11.8  191  147-390     1-208 (209)
  2 d1shux_ c.62.1.1 (X:) Capillar  99.8 6.9E-18   5E-22  123.0  15.2  174  146-388     4-181 (181)
  3 d1pt6a_ c.62.1.1 (A:) Integrin  99.8 1.5E-17 1.1E-21  120.9  15.9  178  148-388     2-191 (192)
  4 d1v7pc_ c.62.1.1 (C:) Integrin  99.7 1.4E-16 9.9E-21  115.2  16.9  178  148-390     2-193 (193)
  5 d1ijba_ c.62.1.1 (A:) von Will  99.7 3.1E-16 2.3E-20  113.0  17.9  183  146-390    12-198 (202)
  6 d1atza_ c.62.1.1 (A:) von Will  99.7 1.6E-16 1.2E-20  114.8  16.2  179  146-389     1-182 (184)
  7 d1n3ya_ c.62.1.1 (A:) Integrin  99.7 1.7E-17 1.2E-21  120.6  10.0  180  147-390     2-189 (189)
  8 d1mf7a_ c.62.1.1 (A:) Integrin  99.7 1.2E-16 8.5E-21  115.6  10.6  180  146-389     4-191 (194)
  9 d1mjna_ c.62.1.1 (A:) Integrin  99.6 3.3E-16 2.4E-20  112.9   5.9  171  146-387     1-179 (179)
 10 d1jeya2 c.62.1.3 (A:34-253) Ku  99.3 6.6E-12 4.8E-16   87.1   9.5  185  150-386     5-216 (220)
 11 d1jeyb2 c.62.1.4 (B:6-241) Ku8  99.1 1.9E-09 1.4E-13   72.4  13.8  147  149-350     4-164 (236)
 12 d1tyeb2 c.62.1.1 (B:107-354) I  98.9 2.7E-08   2E-12   65.4  13.0  121  251-378    86-236 (248)
 13 d1yvra2 c.62.1.5 (A:364-537) 6  98.6 8.5E-07 6.2E-11   56.4  14.2   95  237-349    46-140 (174)
 14 d1geea_ c.2.1.2 (A:) Glucose d  48.1     5.9 0.00043   15.4   7.8   21  329-349   170-190 (261)
 15 d1gega_ c.2.1.2 (A:) meso-2,3-  45.1     6.6 0.00048   15.1   7.4   21  329-349   163-183 (255)
 16 d2bgka1 c.2.1.2 (A:11-278) Rhi  36.6       9 0.00066   14.3   7.5   20  329-348   169-188 (268)
 17 d1edoa_ c.2.1.2 (A:) beta-keto  36.2     9.2 0.00067   14.2   6.8   55  328-384   162-223 (244)
 18 d1kjna_ c.115.1.1 (A:) Hypothe  34.6     9.7 0.00071   14.1   5.5   15  339-353    98-112 (152)
 19 d2bd0a1 c.2.1.2 (A:2-241) Bact  33.6      10 0.00074   14.0   6.4   20  329-348   169-188 (240)
 20 d1yb1a_ c.2.1.2 (A:) 17-beta-h  27.4      13 0.00094   13.3   7.7   17  332-348   171-190 (244)
 21 d1yo6a1 c.2.1.2 (A:1-250) Puta  26.7      13 0.00097   13.3   6.2   19  330-348   185-203 (250)
 22 d1a9xa3 c.30.1.1 (A:1-127) Car  25.8      14   0.001   13.2   3.9   75  303-382     6-80  (127)
 23 d2rhca1 c.2.1.2 (A:5-261) beta  22.6      16  0.0012   12.8   7.4   20  330-349   166-185 (257)
 24 d1qqga2 b.55.1.2 (A:159-262) I  20.5      18  0.0013   12.5   2.7   34  358-391    69-103 (104)

No 1  
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.80  E-value=2.5e-19  Score=131.58  Aligned_cols=191  Identities=21%  Similarity=0.238  Sum_probs=135.3

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             54313575055666666766631012331023012688765403101343220112555333410002456655410220
Q gi|254781108|r  147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK  226 (398)
Q Consensus       147 ~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  226 (398)
                      .+|+++++|.||||...                                             +.+..+.++..+++.+..
T Consensus         1 slDivfvlD~SgSm~~~---------------------------------------------~~~~~k~~~~~li~~l~~   35 (209)
T d1q0pa_           1 SMNIYLVLDGSDSIGAS---------------------------------------------NFTGAKKSLVNLIEKVAS   35 (209)
T ss_dssp             CEEEEEEEECSTTTCHH---------------------------------------------HHHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHCCC
T ss_conf             90779999688998859---------------------------------------------999999999999996104


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCC--CCCCCCCHHHHHHHHHCCC-----CCCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             2768776521346541267765431--1235689999999973577-----88874458899999996113466666566
Q gi|254781108|r  227 AIQEKKNLSVRIGTIAYNIGIVGNQ--CTPLSNNLNEVKSRLNKLN-----PYENTNTYPAMHHAYRELYNEKESSHNTI  299 (398)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~lt~~~~~~~~~I~~l~-----~~G~T~~~~gl~~a~~~l~~~~~~~~~~~  299 (398)
                      ..     ...+.+.+.|........  .....++...+...|+.+.     ++|+|++..||.++.+.+.........  
T Consensus        36 ~~-----~~~rv~lv~f~~~~~~~~~l~~~~~~~~~~l~~~i~~i~~~~~~~~g~t~~~~al~~a~~~~~~~~~~~~~--  108 (209)
T d1q0pa_          36 YG-----VKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPE--  108 (209)
T ss_dssp             TT-----CCCEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHTCCTTSCSCTTCCCHHHHHHHHHHHHCCTTSSCCT--
T ss_pred             CC-----CCCEEEEEEECCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC--
T ss_conf             78-----87679999965850588647651166789999999972101366788854989999999999752224765--


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCHHHHH-------HHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCC---CCEEE
Q ss_conf             7666651699815887787777766314899-------9999997898899999547975589999985199---81899
Q gi|254781108|r  300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQ-------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS---GQFFA  369 (398)
Q Consensus       300 ~~~~~~k~iillTDG~~~~~~~~~~~~~~~~-------~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~---~~yy~  369 (398)
                      ..++.+|++||+|||..+.+..+........       .+..++..||.||+||+|.+ .+...|+.+|+.+   ++||.
T Consensus       109 ~~~~~~kvvvl~TDG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~i~~vgvg~~-~~~~~L~~iAs~~~~~~~~f~  187 (209)
T d1q0pa_         109 GWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPL-VNQVNINALASKKDNEQHVFK  187 (209)
T ss_dssp             TGGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCSCBTTBCCGGGEEEEEEECSSC-CCHHHHHHHSCCCTTCCCEEE
T ss_pred             CCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCC-CCHHHHHHHHCCCCCCEEEEE
T ss_conf             6677751899975787667898589999999854437899999866995598427766-899999999749899715999


Q ss_pred             ECCHHHHHHHHHHHHHHHHHC
Q ss_conf             469899999999999987512
Q gi|254781108|r  370 VNDSRELLESFDKITDKIQEQ  390 (398)
Q Consensus       370 a~~~~~L~~aF~~I~~~i~~~  390 (398)
                      +.+.++|.++|++|.++..++
T Consensus       188 ~~~~~~L~~~~~~ii~~~~s~  208 (209)
T d1q0pa_         188 VKDMENLEDVFYQMIDESQSL  208 (209)
T ss_dssp             TTC-----------------C
T ss_pred             ECCHHHHHHHHHHHHHHHCCC
T ss_conf             389999999999998852578


No 2  
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.77  E-value=6.9e-18  Score=122.97  Aligned_cols=174  Identities=20%  Similarity=0.266  Sum_probs=128.2

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .++|+++++|.|+||...+                                              ...+..+..++..+.
T Consensus         4 ~~~Div~llD~S~Sm~~~~----------------------------------------------~~~k~~~~~~~~~~~   37 (181)
T d1shux_           4 RAFDLYFVLDKSGSVANNW----------------------------------------------IEIYNFVQQLAERFV   37 (181)
T ss_dssp             SCEEEEEEEECSGGGGGGH----------------------------------------------HHHHHHHHHHHHHCC
T ss_pred             CCEEEEEEEECCCCCCCCH----------------------------------------------HHHHHHHHHHHHHHC
T ss_conf             8658999994788853379----------------------------------------------999999999999726


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH---CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             027687765213465412677654311235689999999973---57788874458899999996113466666566766
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN---KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST  302 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~---~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~  302 (398)
                      .       ...+.+.+.|+...  ....+++.+...+...++   .+.++|+|+++.||.++.+.+....        ..
T Consensus        38 ~-------~~~rvglv~fs~~~--~~~~~l~~~~~~~~~~l~~l~~~~~~g~t~~~~al~~~~~~~~~~~--------~~  100 (181)
T d1shux_          38 S-------PEMRLSFIVFSSQA--TIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAG--------GL  100 (181)
T ss_dssp             C-------TTEEEEEEEESSSE--EEEEEEECCHHHHHHHHHHHHTCCCCSCCCHHHHHHHHHHHHHHHT--------GG
T ss_pred             C-------CCCEEEEEEEECCE--EEEEEECCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCC--------CC
T ss_conf             8-------99789999960423--7999724888999997653222367785068999999998763003--------57


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEECC-HHHHHHHHH
Q ss_conf             6651699815887787777766314899999999789889999954797558999998519981899469-899999999
Q gi|254781108|r  303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND-SRELLESFD  381 (398)
Q Consensus       303 ~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~yy~a~~-~~~L~~aF~  381 (398)
                      +..|+|||+|||+.+...    .......+..+|+.||.||+||+| + .+...|+.+|++|++.|.+.+ .++|.+.++
T Consensus       101 ~~~~~ivliTDG~~~~~~----~~~~~~~~~~~k~~gv~v~~vgig-~-~~~~~L~~ia~~~~~~~~~~~~~~~L~~~~~  174 (181)
T d1shux_         101 KTSSIIIALTDGKLDGLV----PSYAEKEAKISRSLGASVYCVGVL-D-FEQAQLERIADSKEQVFPVKGGFQALKGIIN  174 (181)
T ss_dssp             GSCEEEEEEECCCCCTTH----HHHHHHHHHHHHHTTCEEEEEECS-S-CCHHHHHHHSSSGGGEEESSSTTHHHHHHHH
T ss_pred             CCCEEEEEECCCCCCCCC----CHHHHHHHHHHHHCCCEEEEEEEC-C-CCHHHHHHHHCCCCCEEEECCCHHHHHHHHH
T ss_conf             875289992478778886----389999999999789889999968-5-4899999984899965994599999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999875
Q gi|254781108|r  382 KITDKIQ  388 (398)
Q Consensus       382 ~I~~~i~  388 (398)
                      +|.++|.
T Consensus       175 ~i~~~iC  181 (181)
T d1shux_         175 SILAQSC  181 (181)
T ss_dssp             HHHHTBC
T ss_pred             HHHHHHC
T ss_conf             9986339


No 3  
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.77  E-value=1.5e-17  Score=120.86  Aligned_cols=178  Identities=18%  Similarity=0.270  Sum_probs=128.9

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             43135750556666667666310123310230126887654031013432201125553334100024566554102202
Q gi|254781108|r  148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA  227 (398)
Q Consensus       148 ~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~  227 (398)
                      +|+++|+|.|+||..   +                                            +..+..+..++..+.- 
T Consensus         2 ~DivfvlD~S~S~~~---~--------------------------------------------~~~k~f~~~~i~~~~i-   33 (192)
T d1pt6a_           2 LDIVIVLDGSNSIYP---W--------------------------------------------DSVTAFLNDLLKRMDI-   33 (192)
T ss_dssp             EEEEEEEECCTTCCC---H--------------------------------------------HHHHHHHHHHHTTSCB-
T ss_pred             EEEEEEEECCCCCCC---H--------------------------------------------HHHHHHHHHHHHHHCC-
T ss_conf             489999979888777---9--------------------------------------------9999999999998254-


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC--CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             7687765213465412677654311235689999999973577888--74458899999996113466666566766665
Q gi|254781108|r  228 IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE--NTNTYPAMHHAYRELYNEKESSHNTIGSTRLK  305 (398)
Q Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G--~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~  305 (398)
                          .....|.+.+.|+.............+...+..+|+.+.+.|  +++.+.++.++...++....+.+     ++.+
T Consensus        34 ----~~~~~rv~vv~fs~~~~~~~~l~~~~~~~~~~~~i~~~~~~~g~~~~~~~al~~~~~~~~~~~~g~R-----~~~~  104 (192)
T d1pt6a_          34 ----GPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKIVQRGGRQTMTALGTDTARKEAFTEARGAR-----RGVK  104 (192)
T ss_dssp             ----STTSBEEEEEEESSSEEEEECTTTCSSHHHHHHHHHTCCCCCCSSCCHHHHHHHHHHTTTSGGGTCC-----TTCE
T ss_pred             ----CCCCCEEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCC-----CCCC
T ss_conf             ----8887379999984127899727764046899998865554422110157898777776301235898-----8861


Q ss_pred             EEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCC--------HHHHHHHHHCCC--CCEEEECCHHH
Q ss_conf             16998158877877777663148999999997898899999547975--------589999985199--81899469899
Q gi|254781108|r  306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE--------GQDLLRKCTDSS--GQFFAVNDSRE  375 (398)
Q Consensus       306 k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~--------~~~~l~~cAs~~--~~yy~a~~~~~  375 (398)
                      |++||+|||..+      +.......++.+|+.||+||+||+|...+        ..+.|+.+|+.|  .|+|.+++..+
T Consensus       105 kviillTDG~~~------d~~~~~~~a~~lk~~gi~v~~igvg~~~~~~~~~~~~~~~~L~~IAs~p~~~~~f~v~d~~~  178 (192)
T d1pt6a_         105 KVMVIVTDGESH------DNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELA  178 (192)
T ss_dssp             EEEEEEESSCCS------CSHHHHHHHHHHHHTTEEEEEEEECHHHHHTTCCCHHHHHHHHHHSCSSHHHHEEEESSGGG
T ss_pred             EEEEEEECCCCC------CCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCEEECCCHHH
T ss_conf             589999668877------63026999999997799699999705555454343136999999866998550898389999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999875
Q gi|254781108|r  376 LLESFDKITDKIQ  388 (398)
Q Consensus       376 L~~aF~~I~~~i~  388 (398)
                      |.+++++|.++|-
T Consensus       179 L~~i~~~i~~~I~  191 (192)
T d1pt6a_         179 LVTIVKTLGERIF  191 (192)
T ss_dssp             GGGGHHHHHHHHT
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999988852


No 4  
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.74  E-value=1.4e-16  Score=115.21  Aligned_cols=178  Identities=19%  Similarity=0.227  Sum_probs=130.3

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             43135750556666667666310123310230126887654031013432201125553334100024566554102202
Q gi|254781108|r  148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA  227 (398)
Q Consensus       148 ~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~  227 (398)
                      +|+++++|.|+||..   +                                            +..|..+..++..+.-.
T Consensus         2 ~DivfvlD~S~Sv~~---f--------------------------------------------~~~k~f~~~ii~~~~i~   34 (193)
T d1v7pc_           2 IDVVVVCDESNSIYP---W--------------------------------------------DAVKNFLEKFVQGLDIG   34 (193)
T ss_dssp             EEEEEEEECCTTCCC---H--------------------------------------------HHHHHHHHHHHHTSCBS
T ss_pred             EEEEEEEECCCCCCC---H--------------------------------------------HHHHHHHHHHHHHCCCC
T ss_conf             799999989998736---9--------------------------------------------99999999999972558


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCCCCC--CCHHHHHHHHHCCCC--CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             76877652134654126776543112356--899999999735778--88744588999999961134666665667666
Q gi|254781108|r  228 IQEKKNLSVRIGTIAYNIGIVGNQCTPLS--NNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKESSHNTIGSTR  303 (398)
Q Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~~lt--~~~~~~~~~I~~l~~--~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~  303 (398)
                           ....|.+.+.|+....  ...+|+  .+...+..+|+.+.+  +|+|+++.+|.++.+.++...+..     .++
T Consensus        35 -----~~~~rv~vv~fs~~~~--~~~~l~~~~~~~~~~~~i~~~~~~~g~~t~~~~AL~~a~~~~f~~~~~~-----R~~  102 (193)
T d1v7pc_          35 -----PTKTQVGLIQYANNPR--VVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGG-----RRS  102 (193)
T ss_dssp             -----TTSEEEEEEEESSSEE--EEECTTTCSSHHHHHHHHHHCCCCCCSCCCHHHHHHHHHHHTTSGGGTC-----CTT
T ss_pred             -----CCCCEEEEEEEECCEE--EEECCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCC-----CCC
T ss_conf             -----8760799998520113--5504663036789999987444322576426889988887414612389-----888


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC--------CCHHHHHHHHHCCC--CCEEEECCH
Q ss_conf             65169981588778777776631489999999978988999995479--------75589999985199--818994698
Q gi|254781108|r  304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP--------PEGQDLLRKCTDSS--GQFFAVNDS  373 (398)
Q Consensus       304 ~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~--------~~~~~~l~~cAs~~--~~yy~a~~~  373 (398)
                      .+|++||+|||..+.      .......+..+|+.||++|+||++..        ....+.|+.+|+.|  .|+|.+++.
T Consensus       103 ~~kvvVllTDG~s~d------~~~~~~~~~~~~~~gv~v~~Igvg~~~~~~~~~~~~~~~~L~~Ias~p~~~~~f~v~d~  176 (193)
T d1v7pc_         103 ATKVMVVVTDGESHD------GSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDE  176 (193)
T ss_dssp             SEEEEEEEESSCCSC------GGGHHHHHHHHHHTTEEEEEEEECHHHHHTTCCCHHHHHHHHHHSCSSHHHHEEEESSS
T ss_pred             CCEEEEEEECCCCCC------CCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEECCCH
T ss_conf             735899995687678------73689999999868989999996775444444441259999998669871018981899


Q ss_pred             HHHHHHHHHHHHHHHHC
Q ss_conf             99999999999987512
Q gi|254781108|r  374 RELLESFDKITDKIQEQ  390 (398)
Q Consensus       374 ~~L~~aF~~I~~~i~~~  390 (398)
                      .+|.++.++|.++|.+.
T Consensus       177 ~~L~~i~~~l~~~Ic~~  193 (193)
T d1v7pc_         177 AALLEKAGTLGEQIFSI  193 (193)
T ss_dssp             GGGHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHCCCC
T ss_conf             99999999998651319


No 5  
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.73  E-value=3.1e-16  Score=113.04  Aligned_cols=183  Identities=10%  Similarity=0.184  Sum_probs=133.8

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .++|++|++|.|+||....                                             ....+..+..+++.+.
T Consensus        12 ~~~Dl~fvlD~S~S~~~~~---------------------------------------------f~~~k~fv~~~i~~l~   46 (202)
T d1ijba_          12 RLLDLVFLLDGSSRLSEAE---------------------------------------------FEVLKAFVVDMMERLR   46 (202)
T ss_dssp             SCEEEEEEEECBTTSCHHH---------------------------------------------HHHHHHHHHHHHHTBC
T ss_pred             CCEEEEEEEECCCCCCHHH---------------------------------------------HHHHHHHHHHHHHHHC
T ss_conf             8703899996979988789---------------------------------------------9999999999999732


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCC--CCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             0276877652134654126776543112356899999999735778887--44588999999961134666665667666
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN--TNTYPAMHHAYRELYNEKESSHNTIGSTR  303 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~--T~~~~gl~~a~~~l~~~~~~~~~~~~~~~  303 (398)
                      ..     ....|.+.+.|........-.....+...+...|+.+...|+  |+++.+|.++.+.++...       ..+.
T Consensus        47 ~~-----~~~~rvavv~y~~~~~~~~~l~~~~~~~~l~~~i~~l~~~~g~~~~~~~al~~~~~~~~~~~-------~r~~  114 (202)
T d1ijba_          47 VS-----QKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKI-------DRPE  114 (202)
T ss_dssp             BS-----TTSEEEEEEEESSSEEEEECTTCCCCHHHHHHHHHTCCCCCBSCCCHHHHHHHHHHHTSSSC-------SCTT
T ss_pred             CC-----CCCCEEEEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHC-------CCCC
T ss_conf             58-----88737999997423035227765206999999998665552001009999999999765520-------4777


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCC--CCEEEECCHHHHHHHHH
Q ss_conf             6516998158877877777663148999999997898899999547975589999985199--81899469899999999
Q gi|254781108|r  304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFD  381 (398)
Q Consensus       304 ~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~--~~yy~a~~~~~L~~aF~  381 (398)
                      ..|++|++|||.....    ........++.+|+.||+||+||+|.. .+...|+.+|+.|  +++|.+++.++|.+.+.
T Consensus       115 ~~k~vivitdg~~~~~----~~~~~~~~~~~l~~~gv~i~~Vgig~~-~~~~~L~~ia~~~~~~~~~~~~~~~~L~~~~~  189 (202)
T d1ijba_         115 ASRIALLLMASQEPQR----MSRNFVRYVQGLKKKKVIVIPVGIGPH-ANLKQIRLIEKQAPENKAFVLSSVDELEQQRD  189 (202)
T ss_dssp             SEEEEEEEECCCCCGG----GCTTHHHHHHHHHHTTEEEEEEEESTT-SCHHHHHHHHHHCTTCCCEEESSGGGHHHHHH
T ss_pred             CCCEEEEECCCCCCCC----CCHHHHHHHHHHHHCCCEEEEEEECCC-CCHHHHHHHHCCCCCCCEEEECCHHHHHHHHH
T ss_conf             7515788534688864----216899999999985996899985785-79999999851899676899589999999999


Q ss_pred             HHHHHHHHC
Q ss_conf             999987512
Q gi|254781108|r  382 KITDKIQEQ  390 (398)
Q Consensus       382 ~I~~~i~~~  390 (398)
                      +|.+.|...
T Consensus       190 ~i~~~iC~~  198 (202)
T d1ijba_         190 EIVSYLCDL  198 (202)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHCCC
T ss_conf             999987378


No 6  
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.73  E-value=1.6e-16  Score=114.77  Aligned_cols=179  Identities=11%  Similarity=0.107  Sum_probs=128.9

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .|+|+++++|.|+||...                                             +....+..+..+++.+.
T Consensus         1 ~PlDivfliD~S~s~~~~---------------------------------------------~f~~~k~~v~~~i~~~~   35 (184)
T d1atza_           1 QPLDVILLLDGSSSFPAS---------------------------------------------YFDEMKSFAKAFISKAN   35 (184)
T ss_dssp             CCEEEEEEEECSSSSCHH---------------------------------------------HHHHHHHHHHHHHHHSC
T ss_pred             CCEEEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHCC
T ss_conf             966899999488998879---------------------------------------------99999999999999658


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             0276877652134654126776543112356899999999735778-887445889999999611346666656676666
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRL  304 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~-~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~  304 (398)
                      -.     ....|.+.+.|..............+...+..+|+.+.. +|+|+++.++..+.+.++....+.+     ++.
T Consensus        36 i~-----~~~~rv~vv~f~~~~~~~~~l~~~~~~~~l~~~i~~l~~~gg~t~~~~al~~~~~~~~~~~~g~R-----~~~  105 (184)
T d1atza_          36 IG-----PRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGAR-----PGA  105 (184)
T ss_dssp             BS-----TTSEEEEEEEESSSEEEEECTTCCCCHHHHHHHHHTCCCCCCCCCHHHHHHHHHHHHHSCCTTCC-----TTS
T ss_pred             CC-----CCCCEEEEEEEECCCEEECCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCC-----CCC
T ss_conf             79-----88758999998422115515545663999999987301011000102466677887632431788-----898


Q ss_pred             CEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCC--CCEEEECCHHHHHHHHHH
Q ss_conf             516998158877877777663148999999997898899999547975589999985199--818994698999999999
Q gi|254781108|r  305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDK  382 (398)
Q Consensus       305 ~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~--~~yy~a~~~~~L~~aF~~  382 (398)
                      +|++||+|||..+.        ....+.+.+|+.||+||+||+|. ..+...|+.+|+.|  .+.|.+++.++|... .+
T Consensus       106 ~kvvvlltdg~~~d--------~~~~~a~~lk~~gi~v~~igiG~-~~~~~~L~~ias~~~~~~~~~~~~~~~L~~~-~~  175 (184)
T d1atza_         106 SKAVVILVTDVSVD--------SVDAAADAARSNRVTVFPIGIGD-RYDAAQLRILAGPAGDSNVVKLQRIEDLPTM-VT  175 (184)
T ss_dssp             EEEEEEEECSCCSS--------CCHHHHHHHHHTTEEEEEEEESS-SSCHHHHHHHTGGGGGGGCEEESSTTHHHHH-HH
T ss_pred             CEEEEEEEECCCCC--------HHHHHHHHHHHCCCEEEEEEECC-CCCHHHHHHHHCCCCCCCEEEECCHHHHHHH-HH
T ss_conf             15999998067653--------06689999997595899999588-5999999998578885638993798888889-99


Q ss_pred             HHHHHHH
Q ss_conf             9998751
Q gi|254781108|r  383 ITDKIQE  389 (398)
Q Consensus       383 I~~~i~~  389 (398)
                      |.+++.+
T Consensus       176 l~~~~~~  182 (184)
T d1atza_         176 LGNSFLH  182 (184)
T ss_dssp             SCSHHHH
T ss_pred             HHHHHHH
T ss_conf             9999984


No 7  
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.72  E-value=1.7e-17  Score=120.60  Aligned_cols=180  Identities=17%  Similarity=0.245  Sum_probs=128.2

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             54313575055666666766631012331023012688765403101343220112555333410002456655410220
Q gi|254781108|r  147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK  226 (398)
Q Consensus       147 ~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  226 (398)
                      ..|+++++|.|+||...                                             +....+..+..+++.+. 
T Consensus         2 e~DivfvlD~S~Sm~~~---------------------------------------------~~~~~k~~~~~~i~~l~-   35 (189)
T d1n3ya_           2 EQDIVFLIDGSGSISSR---------------------------------------------NFATMMNFVRAVISQFQ-   35 (189)
T ss_dssp             CEEEEEEEECCTTSCHH---------------------------------------------HHHHHHHHHHHHHTTSC-
T ss_pred             CCCEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHHC-
T ss_conf             74199999697998869---------------------------------------------99999999999999708-


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCCCCC--CHHHHHHHHHCCC-CCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             2768776521346541267765431123568--9999999973577-888744588999999961134666665667666
Q gi|254781108|r  227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN--NLNEVKSRLNKLN-PYENTNTYPAMHHAYRELYNEKESSHNTIGSTR  303 (398)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~--~~~~~~~~I~~l~-~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~  303 (398)
                            ....+.+.+.|+......  .+|+.  +..++...|+.+. .+|+|+++.+|.++.+.++....+.     .++
T Consensus        36 ------~~~~rv~vv~fs~~~~~~--~~l~~~~~~~~~~~~i~~~~~~~g~t~~~~al~~a~~~~f~~~~~~-----r~~  102 (189)
T d1n3ya_          36 ------RPSTQFSLMQFSNKFQTH--FTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGA-----RRD  102 (189)
T ss_dssp             ------TTTEEEEEEEESSSEEEE--ECHHHHHHCSSGGGGGTTCCCCCSCBCHHHHHHHHHTTTTSGGGTC-----CTT
T ss_pred             ------CCCCEEEEEEEECCCEEE--CCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCC-----CCC
T ss_conf             ------998789999953121010--0235400288999998754343300138999999999984111278-----888


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC---CCHHHHHHHHHCCC--CCEEEECCHHHHHH
Q ss_conf             65169981588778777776631489999999978988999995479---75589999985199--81899469899999
Q gi|254781108|r  304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP---PEGQDLLRKCTDSS--GQFFAVNDSRELLE  378 (398)
Q Consensus       304 ~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~---~~~~~~l~~cAs~~--~~yy~a~~~~~L~~  378 (398)
                      .+|++||+|||..+....     ....++..+|+.||.||+||++.+   ......|+.+|+.|  +++|.+++.++|.+
T Consensus       103 ~~kvivllTDG~~~~~~~-----~~~~~~~~~~~~gv~i~~Vgig~~~~~~~~~~~L~~ias~~~~~~~~~~~~~~~l~~  177 (189)
T d1n3ya_         103 AAKILIVITDGKKEGDSL-----DYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKD  177 (189)
T ss_dssp             SEEEEEEEESSCCBSCSS-----CHHHHHHHHHHTTCEEEEEEESGGGGSSTTHHHHHHHSCSSSGGGEEEESSGGGGGG
T ss_pred             CCEEEEEEECCCCCCCCC-----CHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHCCCCCCEEEEECCHHHHHH
T ss_conf             732799995689888832-----399999999987994389833655566333999999966998660898289999999


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999987512
Q gi|254781108|r  379 SFDKITDKIQEQ  390 (398)
Q Consensus       379 aF~~I~~~i~~~  390 (398)
                      .+++|.++|..+
T Consensus       178 i~~~i~~~ic~~  189 (189)
T d1n3ya_         178 IQNQLKEKIFAI  189 (189)
T ss_dssp             GHHHHHHHHHTC
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999751439


No 8  
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.68  E-value=1.2e-16  Score=115.60  Aligned_cols=180  Identities=18%  Similarity=0.248  Sum_probs=129.3

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .++|+++++|.|+||...                                             +....+..+..+++.+.
T Consensus         4 ~~~DivfvlD~S~s~~~~---------------------------------------------~~~~~k~f~~~iv~~l~   38 (194)
T d1mf7a_           4 EDSDIAFLIDGSGSIIPH---------------------------------------------DFRRMKEFVSTVMEQLK   38 (194)
T ss_dssp             CCEEEEEEEECCTTSCHH---------------------------------------------HHHHHHHHHHHHHHHHC
T ss_pred             CCEEEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHCC
T ss_conf             871699999798998879---------------------------------------------99999999999999718


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCC--CCHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             0276877652134654126776543112356--899999999735778-8874458899999996113466666566766
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS--NNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGST  302 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt--~~~~~~~~~I~~l~~-~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~  302 (398)
                      .       ..++.+.+.|.......  .+|.  .+..+++++|+.+.+ +|+|++..++.++.+.+.......     .+
T Consensus        39 ~-------~~~rv~vv~fs~~~~~~--~~l~~~~~~~~~~~~i~~i~~~~~~t~~~~al~~~~~~~~~~~~~~-----~~  104 (194)
T d1mf7a_          39 K-------SKTLFSLMQYSEEFRIH--FTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGA-----RK  104 (194)
T ss_dssp             C-------TTEEEEEEEESSSEEEE--ECHHHHHHSCCHHHHHTTCCCCCSCBCHHHHHHHHHHTTTSGGGTC-----CT
T ss_pred             C-------CCCEEEEEEEECCCEEE--EECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCC-----CC
T ss_conf             6-------78369999972240257--7526657789999997645553210157799999999987564257-----88


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC---CCHHHHHHHHHCCC--CCEEEECCHHHHH
Q ss_conf             665169981588778777776631489999999978988999995479---75589999985199--8189946989999
Q gi|254781108|r  303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP---PEGQDLLRKCTDSS--GQFFAVNDSRELL  377 (398)
Q Consensus       303 ~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~---~~~~~~l~~cAs~~--~~yy~a~~~~~L~  377 (398)
                      ..+|++||+|||..+...     .....+...+|..||+||+||++..   ......|+.+|+.|  .++|.+++.++|.
T Consensus       105 ~~~kvvvliTDG~~~~~~-----~~~~~~~~~~~~~gv~i~~VGi~~~~~~~~~~~~L~~ias~~~~~~~~~~~~~~~L~  179 (194)
T d1mf7a_         105 NAFKILVVITDGEKFGDP-----LGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALK  179 (194)
T ss_dssp             TSEEEEEEEESSCCBSCS-----SCGGGTHHHHHHTTEEEEEEEESGGGCSHHHHHHHHHHSCSSHHHHEEEESSGGGGG
T ss_pred             CCCEEEEEEECCCCCCCC-----HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCCEEEEECCHHHHH
T ss_conf             973599998268989980-----559999999998599059980577666525699999996599877199959999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999998751
Q gi|254781108|r  378 ESFDKITDKIQE  389 (398)
Q Consensus       378 ~aF~~I~~~i~~  389 (398)
                      +.+++|.++|.-
T Consensus       180 ~~~~~l~~~i~c  191 (194)
T d1mf7a_         180 TIQNQLREKIFC  191 (194)
T ss_dssp             GGHHHHHHHHHT
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999887626


No 9  
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.61  E-value=3.3e-16  Score=112.92  Aligned_cols=171  Identities=16%  Similarity=0.232  Sum_probs=121.9

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      +++|+++++|.|+||....                                             ....+..+..++..+.
T Consensus         1 g~~DivfllD~S~Si~~~~---------------------------------------------f~~~k~f~~~~i~~i~   35 (179)
T d1mjna_           1 GNVDLVFLFDGSMSLQPDE---------------------------------------------FQKILDFMKDVMKKCS   35 (179)
T ss_dssp             CCEEEEEEEECBTTCCHHH---------------------------------------------HHHHHHHHHHHHHHTT
T ss_pred             CCEEEEEEEECCCCCCHHH---------------------------------------------HHHHHHHHHHHHHHHC
T ss_conf             9768999997989989899---------------------------------------------9999999999999828


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCC--CCHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             0276877652134654126776543112356--899999999735778-8874458899999996113466666566766
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS--NNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGST  302 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt--~~~~~~~~~I~~l~~-~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~  302 (398)
                             ...+|.+.+.|.......  .+|+  .+...+..+|+.+.. +|+|++..+|.++.+.++....+..     +
T Consensus        36 -------~~~~rvgvv~fs~~~~~~--~~l~~~~~~~~~~~~i~~i~~~~g~t~~~~AL~~~~~~~f~~~~g~R-----~  101 (179)
T d1mjna_          36 -------NTSYQFAAVQFSTSYKTE--FDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGAR-----P  101 (179)
T ss_dssp             -------TSSEEEEEEEESSSEEEE--ECHHHHHHHCCHHHHHTTCCCCCBCCCHHHHHHHHHHHTSSGGGTCC-----T
T ss_pred             -------CCCEEEEEEEEEEEEEEE--ECHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCHHCCCC-----C
T ss_conf             -------775289999974234688--51143063688999986331015863499999999998716101889-----9


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCC---HHHHHHHHHCCC--CCEEEECCHHHHH
Q ss_conf             66516998158877877777663148999999997898899999547975---589999985199--8189946989999
Q gi|254781108|r  303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---GQDLLRKCTDSS--GQFFAVNDSRELL  377 (398)
Q Consensus       303 ~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~---~~~~l~~cAs~~--~~yy~a~~~~~L~  377 (398)
                      +..|++||||||..+...            ...+.+|+.+|+||++....   ....|+.+|+.|  .|+|.+++.++|.
T Consensus       102 ~~~kvvvllTDG~s~d~~------------~~~~~~~i~~~~igvg~~~~~~~~~~~L~~ias~p~~~~~~~~~~~~~L~  169 (179)
T d1mjna_         102 DATKVLIIITDGEATDSG------------NIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLK  169 (179)
T ss_dssp             TSEEEEEEEESSCCSSCS------------CCGGGTTSEEEEEEESGGGCSHHHHHTTGGGSCSCHHHHEEEESSGGGSC
T ss_pred             CCCEEEEEEECCCCCCCC------------HHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECCCHHHHH
T ss_conf             997499999789986540------------69997417440698524456400499999985799622399749999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999987
Q gi|254781108|r  378 ESFDKITDKI  387 (398)
Q Consensus       378 ~aF~~I~~~i  387 (398)
                      +.+++|.++|
T Consensus       170 ~i~~~l~~~I  179 (179)
T d1mjna_         170 DLCTELQKKI  179 (179)
T ss_dssp             CHHHHHHHHC
T ss_pred             HHHHHHHHHC
T ss_conf             9999998439


No 10 
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.30  E-value=6.6e-12  Score=87.10  Aligned_cols=185  Identities=12%  Similarity=0.108  Sum_probs=106.1

Q ss_pred             CEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             13575055666666766631012331023012688765403101343220112555333410002456655410220276
Q gi|254781108|r  150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ  229 (398)
Q Consensus       150 i~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~  229 (398)
                      +++++|.|+||.......                                      ...+......++..++..+-... 
T Consensus         5 ivf~ID~S~SM~~~d~~~--------------------------------------~~s~~~~~~~~~~~~~~~~i~~~-   45 (220)
T d1jeya2           5 LIFLVDASKAMFESQSED--------------------------------------ELTPFDMSIQCIQSVYISKIISS-   45 (220)
T ss_dssp             EEEEEECSGGGGCCCSSS--------------------------------------SCCHHHHHHHHHHHHHHHHHHTT-
T ss_pred             EEEEEECCCCCCCCCCCC--------------------------------------CCCHHHHHHHHHHHHHHHHHHCC-
T ss_conf             999998980307455678--------------------------------------87789999999999999985079-


Q ss_pred             CCCCCCEEEEEEECCCCCCCCC--------CCCCCCCHH-------------HHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             8776521346541267765431--------123568999-------------9999973577888744588999999961
Q gi|254781108|r  230 EKKNLSVRIGTIAYNIGIVGNQ--------CTPLSNNLN-------------EVKSRLNKLNPYENTNTYPAMHHAYREL  288 (398)
Q Consensus       230 ~~~~~~~~~~~~~~~~~~~~~~--------~~~lt~~~~-------------~~~~~I~~l~~~G~T~~~~gl~~a~~~l  288 (398)
                       +   ..+.+.+.|+......+        ..++.....             ......+...+.|+|+++.+|..+.+.+
T Consensus        46 -~---~d~vglv~f~t~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~l~~al~~a~~~~  121 (220)
T d1jeya2          46 -D---RDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLF  121 (220)
T ss_dssp             -C---CCEEEEEEESCSSCBSTTCCTTEEEEEEEECCCHHHHHHHHTTSHHHHHHHHHHHHCCSCCCCHHHHHHHHHHHH
T ss_pred             -C---CCEEEEEEECCCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             -9---877999995466666877653035530134742889876655323444444320246788862999999999998


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCC--H----HHHHHHHHC
Q ss_conf             1346666656676666516998158877877777663148999999997898899999547975--5----899999851
Q gi|254781108|r  289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE--G----QDLLRKCTD  362 (398)
Q Consensus       289 ~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~--~----~~~l~~cAs  362 (398)
                      .....        ....|+|||+|||+++.+............+..+++.||.||+|+++.+..  .    .++++.- .
T Consensus       122 ~~~~~--------~~~~k~IiliTDg~~~~~~~~~~~~~~~~~a~~~~~~gv~i~~i~ig~~~~~d~~~f~~~~l~~~-~  192 (220)
T d1jeya2         122 SDVQF--------KMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIA-E  192 (220)
T ss_dssp             HTCSS--------CEEEEEEEEEESCSCTTTTCHHHHHHHHHHHHHHHHHTEEEEEEEBCCTTCCCTTTTGGGTCC----
T ss_pred             HHCCC--------CCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCHHHHHHHHHHHC-C
T ss_conf             74013--------45775899980599888885124577999988776306517999837878755116689987211-3


Q ss_pred             CCCCEEEECCHHHHHHHHHHHHHH
Q ss_conf             998189946989999999999998
Q gi|254781108|r  363 SSGQFFAVNDSRELLESFDKITDK  386 (398)
Q Consensus       363 ~~~~yy~a~~~~~L~~aF~~I~~~  386 (398)
                      ++.+.+...+.++|.+..++|..+
T Consensus       193 ~~~~~~~~~~~~~l~~l~~~i~~k  216 (220)
T d1jeya2         193 DEDLRVHFEESSKLEDLLRKVRAK  216 (220)
T ss_dssp             -----CCCCCBCSHHHHHHHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             666761068646699999999875


No 11 
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.10  E-value=1.9e-09  Score=72.38  Aligned_cols=147  Identities=10%  Similarity=0.005  Sum_probs=94.1

Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             31357505566666676663101233102301268876540310134322011255533341000245665541022027
Q gi|254781108|r  149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI  228 (398)
Q Consensus       149 di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~  228 (398)
                      .+++++|+|+||......                                       ..++++..+.++..++.......
T Consensus         4 aiv~~lD~S~SM~~~~~~---------------------------------------~~srl~~ak~~~~~~v~~~~~~~   44 (236)
T d1jeyb2           4 AVVLCMDVGFTMSNSIPG---------------------------------------IESPFEQAKKVITMFVQRQVFAE   44 (236)
T ss_dssp             EEEEEEECCGGGGCCBTT---------------------------------------BCCHHHHHHHHHHHHHHHHHHTT
T ss_pred             EEEEEEECCHHHCCCCCC---------------------------------------CCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             199999898443657789---------------------------------------99989999999999999984289


Q ss_pred             CCCCCCCEEEEEEECCCCCCCC------------CCCCCCCCHHHHHHHHHCCC--CCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             6877652134654126776543------------11235689999999973577--888744588999999961134666
Q gi|254781108|r  229 QEKKNLSVRIGTIAYNIGIVGN------------QCTPLSNNLNEVKSRLNKLN--PYENTNTYPAMHHAYRELYNEKES  294 (398)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~------------~~~~lt~~~~~~~~~I~~l~--~~G~T~~~~gl~~a~~~l~~~~~~  294 (398)
                           ...+.+.+.|.......            ...++..........+..+.  .++.|+...++..+...+......
T Consensus        45 -----~~d~vglV~f~~~~t~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~~a~~~~~~~~~~  119 (236)
T d1jeyb2          45 -----NKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIG  119 (236)
T ss_dssp             -----CCCEEEEEEESCSSCBSTTCTTTCSTTEEEEEEEECCCHHHHHHHHTTCCCCSSCCCHHHHHHHHHHHHHHHSSS
T ss_pred             -----CCCEEEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             -----997599999737776566565566304799741322015677777653024655555047889999887776404


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             66566766665169981588778777776631489999999978988999995479
Q gi|254781108|r  295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP  350 (398)
Q Consensus       295 ~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~  350 (398)
                            .+..+|.|||+|||+++...     .....+++.+|+.||+||+||++..
T Consensus       120 ------~~~~~r~IiL~TDG~~~~~~-----~~~~~~a~~l~~~~I~i~~ig~g~~  164 (236)
T d1jeyb2         120 ------KKFEKRHIEIFTDLSSRFSK-----SQLDIIIHSLKKCDISLQFFLPFSL  164 (236)
T ss_dssp             ------SCCSEEEEEEECCCCSCCCC-----TTHHHHHHHHHHTTEEEEEEESSCC
T ss_pred             ------CCCCCCEEEEEECCCCCCCH-----HHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             ------66565179999369987683-----7899999999875988999944776


No 12 
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=98.89  E-value=2.7e-08  Score=65.42  Aligned_cols=121  Identities=12%  Similarity=0.153  Sum_probs=72.5

Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCC-CCCCCCCCCCCCCCCEEEEECCCCCCCC-----------
Q ss_conf             1123568999999997357788874458899999996113-4666665667666651699815887787-----------
Q gi|254781108|r  251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN-EKESSHNTIGSTRLKKFVIFITDGENSG-----------  318 (398)
Q Consensus       251 ~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~-~~~~~~~~~~~~~~~k~iillTDG~~~~-----------  318 (398)
                      ...++|.+...++..|+.+.+.||....++..-|...... ...-.|.    .+.+|+|||+||.-.-.           
T Consensus        86 ~~~~~t~d~~~f~~~l~~~~~~GggD~pE~~~~Al~~a~~~~~~i~Wr----~~a~r~viliTDA~~H~~~d~~l~g~~~  161 (248)
T d1tyeb2          86 HVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWR----NDASHLLVFTTDAKTHIALDGRLAGIVQ  161 (248)
T ss_dssp             EEEEEESCHHHHHHHHTTCCCCCCSSSSBCHHHHHHHHHHCHHHHTCC----TTSEEEEEEEESSCBCCTTGGGGGTCCS
T ss_pred             ECCCCCCCHHHHHHHHHHEECCCCCCCCCHHHHHHHHHHHHHHHCCCC----CCCCEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             037777799999999850113168897503899999999876307988----8860899998878755453123323345


Q ss_pred             ---CCCCC-----C-------CHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHC-CCCCEEEE--CCHHHHHH
Q ss_conf             ---77776-----6-------31489999999978988999995479755899999851-99818994--69899999
Q gi|254781108|r  319 ---ASAYQ-----N-------TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAV--NDSRELLE  378 (398)
Q Consensus       319 ---~~~~~-----~-------~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs-~~~~yy~a--~~~~~L~~  378 (398)
                         +..+.     +       -.....+++.+++++|.++.+   .......+++..+. .+|.++..  .+.+.+.+
T Consensus       162 ~~d~~~~~~~~~~~~~~~~~dyps~~ql~~~l~~~~i~~ifa---vt~~~~~~Y~~l~~~~~g~~~~~l~~dssNi~~  236 (248)
T d1tyeb2         162 PNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFA---VTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQ  236 (248)
T ss_dssp             CCCCCCCBCTTSBBGGGGTSCCCCHHHHHHHHHHTTEEEEEE---ECGGGHHHHHHHHHTSTTCEEEECSSCCHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEEE---ECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
T ss_conf             677755467778535654345788899999999829579999---883156899999985698579870553444999


No 13 
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
Probab=98.65  E-value=8.5e-07  Score=56.44  Aligned_cols=95  Identities=15%  Similarity=0.132  Sum_probs=54.9

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             34654126776543112356899999999735778887445889999999611346666656676666516998158877
Q gi|254781108|r  237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN  316 (398)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~  316 (398)
                      +.+.+.|.+....-+ .........+...+... ++|||++..++.|+.+...              ..++|||+|||++
T Consensus        46 ~~~vv~F~~~~~~~~-~~~~~~~~~~~~~~~~~-~~ggT~i~~al~~a~~~~~--------------~~~~ivllTDg~~  109 (174)
T d1yvra2          46 DSHMVAFSDEMLPCP-ITVNMLLHEVVEKMSDI-TMGSTDCALPMLWAQKTNT--------------AADIFIVFTDCET  109 (174)
T ss_dssp             SEEEEEESSSEECCS-CCTTSCHHHHHHHHTTC-CCSCCCTTHHHHHHHHTTC--------------CCSEEEEEECCCC
T ss_pred             CEEEEEECCCCCCCC-CCCCCHHHHHHHHHHCC-CCCCCCHHHHHHHHHHHHC--------------CCCEEEEEECCCC
T ss_conf             489999667740154-67311299999976325-6666308899999986301--------------5787999967875


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             877777663148999999997898899999547
Q gi|254781108|r  317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA  349 (398)
Q Consensus       317 ~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~  349 (398)
                      +.+....  ........+....+++++.|++..
T Consensus       110 ~~g~~~~--~~~l~~y~~~~~~~~~~~~i~l~~  140 (174)
T d1yvra2         110 NVEDVHP--ATALKQYREKMGIPAKLIVCAMTS  140 (174)
T ss_dssp             CSSSCCH--HHHHHHHHHHHTCCCEEEEEECSS
T ss_pred             CCCCCCH--HHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             6788798--999999998708994899998768


No 14 
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}
Probab=48.14  E-value=5.9  Score=15.37  Aligned_cols=21  Identities=10%  Similarity=0.191  Sum_probs=15.4

Q ss_pred             HHHHHHHHHCCCEEEEEEECC
Q ss_conf             999999997898899999547
Q gi|254781108|r  329 LQICEYMRNAGMKIYSVAVSA  349 (398)
Q Consensus       329 ~~~c~~~K~~gi~IytIg~~~  349 (398)
                      ..++.++...||++..|.-|.
T Consensus       170 ~~lA~e~~~~gIrVN~I~PG~  190 (261)
T d1geea_         170 ETLALEYAPKGIRVNNIGPGA  190 (261)
T ss_dssp             HHHHHHHGGGTCEEEEEEECS
T ss_pred             HHHHHHHHHHCCEEEEEEECC
T ss_conf             999999622495899985286


No 15 
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}
Probab=45.08  E-value=6.6  Score=15.08  Aligned_cols=21  Identities=5%  Similarity=0.071  Sum_probs=15.9

Q ss_pred             HHHHHHHHHCCCEEEEEEECC
Q ss_conf             999999997898899999547
Q gi|254781108|r  329 LQICEYMRNAGMKIYSVAVSA  349 (398)
Q Consensus       329 ~~~c~~~K~~gi~IytIg~~~  349 (398)
                      ..++.++...||++.+|.-|.
T Consensus       163 k~lA~el~~~gIrVN~I~PG~  183 (255)
T d1gega_         163 QTAARDLAPLGITVNGYCPGI  183 (255)
T ss_dssp             HHHHHHHGGGTEEEEEEEECS
T ss_pred             HHHHHHHHHHCCEEEEEECCC
T ss_conf             999999602296899986074


No 16 
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}
Probab=36.59  E-value=9  Score=14.28  Aligned_cols=20  Identities=15%  Similarity=0.423  Sum_probs=14.3

Q ss_pred             HHHHHHHHHCCCEEEEEEEC
Q ss_conf             99999999789889999954
Q gi|254781108|r  329 LQICEYMRNAGMKIYSVAVS  348 (398)
Q Consensus       329 ~~~c~~~K~~gi~IytIg~~  348 (398)
                      ..++.++...||++.+|.-|
T Consensus       169 ~~lA~el~~~gIrVN~I~PG  188 (268)
T d2bgka1         169 TSLCTELGEYGIRVNCVSPY  188 (268)
T ss_dssp             HHHHHHHGGGTEEEEEEEES
T ss_pred             HHHHHHHCHHCEEEEECCCC
T ss_conf             99999957018489845878


No 17 
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}
Probab=36.22  E-value=9.2  Score=14.24  Aligned_cols=55  Identities=7%  Similarity=0.053  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCC------HHHHHHHHHC-CCCCEEEECCHHHHHHHHHHHH
Q ss_conf             8999999997898899999547975------5899999851-9981899469899999999999
Q gi|254781108|r  328 TLQICEYMRNAGMKIYSVAVSAPPE------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKIT  384 (398)
Q Consensus       328 ~~~~c~~~K~~gi~IytIg~~~~~~------~~~~l~~cAs-~~~~yy~a~~~~~L~~aF~~I~  384 (398)
                      +..++.++...||++-.|.-|.=.+      ..+..+.... .|-+  ..-+++|+.++..-++
T Consensus       162 tk~lA~el~~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~pl~--R~~~p~dvA~~v~fLa  223 (244)
T d1edoa_         162 SKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLG--RTGQPENVAGLVEFLA  223 (244)
T ss_dssp             HHHHHHHHHTTTEEEEEEEECSBCSHHHHTTCHHHHHHHHTSCTTC--SCBCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCEEEEEECCEECCHHHHHHHHHHHHHHHHCCCCC--CCCCHHHHHHHHHHHH
T ss_conf             6999999710292799986141335777775088999998369988--9809999999999997


No 18 
>d1kjna_ c.115.1.1 (A:) Hypothetical protein MTH777 (MT0777) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
Probab=34.63  E-value=9.7  Score=14.09  Aligned_cols=15  Identities=0%  Similarity=0.065  Sum_probs=9.7

Q ss_pred             CCEEEEEEECCCCCH
Q ss_conf             988999995479755
Q gi|254781108|r  339 GMKIYSVAVSAPPEG  353 (398)
Q Consensus       339 gi~IytIg~~~~~~~  353 (398)
                      +...|.|-||-+..+
T Consensus        98 ~~~~~aiVFG~~~~~  112 (152)
T d1kjna_          98 NTETLAIIFDRDADV  112 (152)
T ss_dssp             CSEEEEEEECSCHHH
T ss_pred             CCCEEEEEECCCCHH
T ss_conf             776289982476226


No 19 
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}
Probab=33.60  E-value=10  Score=13.98  Aligned_cols=20  Identities=20%  Similarity=0.283  Sum_probs=14.0

Q ss_pred             HHHHHHHHHCCCEEEEEEEC
Q ss_conf             99999999789889999954
Q gi|254781108|r  329 LQICEYMRNAGMKIYSVAVS  348 (398)
Q Consensus       329 ~~~c~~~K~~gi~IytIg~~  348 (398)
                      ..+..+++..||++.+|.-|
T Consensus       169 ~~la~el~~~gIrvn~i~PG  188 (240)
T d2bd0a1         169 ETMRLYARKCNVRITDVQPG  188 (240)
T ss_dssp             HHHHHHHTTTTEEEEEEEEC
T ss_pred             HHHHHHHCCCCEEEEEEEEC
T ss_conf             99999957588299995208


No 20 
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}
Probab=27.36  E-value=13  Score=13.34  Aligned_cols=17  Identities=12%  Similarity=0.245  Sum_probs=11.1

Q ss_pred             HHHHHH---CCCEEEEEEEC
Q ss_conf             999997---89889999954
Q gi|254781108|r  332 CEYMRN---AGMKIYSVAVS  348 (398)
Q Consensus       332 c~~~K~---~gi~IytIg~~  348 (398)
                      +.++..   +||++.+|.=|
T Consensus       171 a~El~~~~~~gI~V~~i~PG  190 (244)
T d1yb1a_         171 TDELAALQITGVKTTCLCPN  190 (244)
T ss_dssp             HHHHHHTTCTTEEEEEEEET
T ss_pred             HHHHHHHCCCCEEEEEEECC
T ss_conf             99988666998799999739


No 21 
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}
Probab=26.73  E-value=13  Score=13.27  Aligned_cols=19  Identities=0%  Similarity=0.142  Sum_probs=14.0

Q ss_pred             HHHHHHHHCCCEEEEEEEC
Q ss_conf             9999999789889999954
Q gi|254781108|r  330 QICEYMRNAGMKIYSVAVS  348 (398)
Q Consensus       330 ~~c~~~K~~gi~IytIg~~  348 (398)
                      .+..+++..||.+.+|.=|
T Consensus       185 ~la~el~~~gI~v~~i~PG  203 (250)
T d1yo6a1         185 TLAVDLKDDNVLVVNFCPG  203 (250)
T ss_dssp             HHHHHTGGGTCEEEEEECC
T ss_pred             HHHHHHCCCCEEEEEEECC
T ss_conf             9999964468399999648


No 22 
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
Probab=25.82  E-value=14  Score=13.17  Aligned_cols=75  Identities=13%  Similarity=0.262  Sum_probs=42.2

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEECCHHHHHHHHHH
Q ss_conf             66516998158877877777663148999999997898899999547975589999985199818994698999999999
Q gi|254781108|r  303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK  382 (398)
Q Consensus       303 ~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~yy~a~~~~~L~~aF~~  382 (398)
                      +.+|++ ++.-|-+.-+....-++-...+|..+|+.|+++.-|  ..+..  +...+=-.++--||+.=+.+.+.++.+.
T Consensus         6 ~~kkvl-ilGsGp~~IGq~~EfDy~~~~a~~alke~g~~~ili--N~NP~--TVstd~d~aD~lYfePlt~e~v~~Ii~~   80 (127)
T d1a9xa3           6 DIKSIL-ILGAGPIVIGQACEFDYSGAQACKALREEGYRVINV--NSNPA--TIMTDPEMADATYIEPIHWEVVRKIIEK   80 (127)
T ss_dssp             SCCEEE-EECCCSCBTTBCTHHHHHHHHHHHHHHHHTCEEEEE--CSCTT--CGGGCGGGSSEEECSCCCHHHHHHHHHH
T ss_pred             CCCEEE-EECCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEE--CCCHH--HHHCCHHHCCEEEEECCCHHHHHHHHHH
T ss_conf             887799-988884702663015789999999999769847984--58667--5315865502146534889999999998


No 23 
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
Probab=22.58  E-value=16  Score=12.79  Aligned_cols=20  Identities=10%  Similarity=0.175  Sum_probs=12.8

Q ss_pred             HHHHHHHHCCCEEEEEEECC
Q ss_conf             99999997898899999547
Q gi|254781108|r  330 QICEYMRNAGMKIYSVAVSA  349 (398)
Q Consensus       330 ~~c~~~K~~gi~IytIg~~~  349 (398)
                      .++.++...||++.+|.-|.
T Consensus       166 ~lA~el~~~gIrVN~I~PG~  185 (257)
T d2rhca1         166 ALGLELARTGITVNAVCPGF  185 (257)
T ss_dssp             HHHHHTTTSEEEEEEEEECS
T ss_pred             HHHHHHHHHCCEEEEEEECC
T ss_conf             99999605591899883287


No 24 
>d1qqga2 b.55.1.2 (A:159-262) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=20.55  E-value=18  Score=12.54  Aligned_cols=34  Identities=24%  Similarity=0.403  Sum_probs=23.4

Q ss_pred             HHHHCCCCCE-EEECCHHHHHHHHHHHHHHHHHCE
Q ss_conf             9985199818-994698999999999999875124
Q gi|254781108|r  358 RKCTDSSGQF-FAVNDSRELLESFDKITDKIQEQS  391 (398)
Q Consensus       358 ~~cAs~~~~y-y~a~~~~~L~~aF~~I~~~i~~~r  391 (398)
                      +.|.+.+|.| |++++.......++.|...++.+.
T Consensus        69 r~~~~G~G~f~~~t~d~~~a~~~h~~~l~~mkal~  103 (104)
T d1qqga2          69 RSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMS  103 (104)
T ss_dssp             TTSTTCSEEEEEECSCHHHHHHHHHHHHHHHHGGG
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99998983699986987999999999999998741


Done!