BLAST/PSIBLAST alignment of GI: 254781108 and GI: 86359182 at iteration 1
>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42] Length = 411
>gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 411
 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 113/419 (26%), Positives = 184/419 (43%), Gaps = 58/419 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A D+A L+  A+ +++ TI+  TT+ +  
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAADSAALA-TATALANGTIQ--TTEAEAF 80

Query: 61  STIF-KKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENL 118
           +  F   Q+  +L+ G+       DI     +N+ T        Y       Y + T N 
Sbjct: 81  ARNFVAGQMANYLQSGT-------DIKSTTSVNVQTTTSGKSTSYQVTVSPAY-VLTVNP 132

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
            ++  +     +LS   T I   S    +IS+ + LD S SM +         +  T N+
Sbjct: 133 LMQA-VGFTTQHLSTSGTTIGGHSQTQGSISMFLALDKSGSMGE---------DTATVNE 182

Query: 179 YLLPPPPKKSF-----WSKNTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAI 228
                 P +S+        NT  +K+       +R     KI+ L  +AGNL + +  A 
Sbjct: 183 ----ESPTESYTYDCNLHYNTKNNKWVYDKCTGSRTNYYTKIEALKMAAGNLFSQLNSA- 237

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
            +     VR G ++Y+I    NQ  P  L+  +  V S +N L     TN+  AM+ AY 
Sbjct: 238 -DPNAQYVRTGAVSYDI----NQYAPSSLAWGITGVSSYVNALQANGGTNSSGAMNTAYT 292

Query: 287 ELY------NEKE-SSHNTIGSTRLKKFVIFITDGEN----SGASAYQNTLNTLQICEYM 335
            L       N+ E S+H        KK+++F+TDG+N    SG  +Y     T + C+  
Sbjct: 293 SLTAKNAAGNDVENSAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTA--TKKTCDDA 350

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           ++ G++IY++A  AP  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 351 KSKGIEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQLTRL 409