BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781108|ref|YP_003065521.1| von Willebrand factor type A
[Candidatus Liberibacter asiaticus str. psy62]
         (398 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL
Sbjct: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL
Sbjct: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT
Sbjct: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG
Sbjct: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
           STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC
Sbjct: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
Sbjct: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 138/402 (34%), Positives = 230/402 (57%), Gaps = 29/402 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M+A II VC +F+++ ID+ H+++++N +QS+LD A++SGC+ +VSD  I D   ++++ 
Sbjct: 27  MSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPKINDLNPQEERI 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + KK    ++ Q ++  E+A  I + A I+ +KD  N  +Y    +A++++  +N  L
Sbjct: 87  RDVIKKNAYVNMVQ-NFPAEHAAYIIENANISFSKDLTNKYEYKITMEAKHQLSGKNFIL 145

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+P+ +T++S  STGII++ S+  A S+ MVLD S SM D  +Q+  D ++     Y 
Sbjct: 146 GFLMPNVITHISSISTGIIQKPSDKKAFSVEMVLDCSGSMLD-SMQESCDLSSGRGGYY- 203

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F+SKN  K K          KI  L  ++ + VN IQ+ +Q    +S RIG 
Sbjct: 204 --------FYSKNNNKPK---------SKIYALKTASSDFVNLIQETVQTFPQISARIGL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN--EKESSHNT 298
           I +N  I+  Q + LSNN N +K  ++++ P   T+T+  M+ AY  L N   +  +HN 
Sbjct: 247 ITFNHYIM--QDSKLSNNFNVIKKTISRMKPKGGTDTFLPMNAAYEYLNNIPNETKAHNI 304

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--APPEGQDL 356
             +  LK+++I +TDGEN+  S     L T+ +C+  R  G+ IYS+ ++     +G +L
Sbjct: 305 SDNVPLKRYIILMTDGENNHPSY---DLKTINVCDNARKNGIIIYSIFLNYYEYTDGYEL 361

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
            RKC  S   FF  N+++ LL+SF  I   IQ+++VRIA N 
Sbjct: 362 ARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAVRIASNE 403


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 127/262 (48%), Gaps = 27/262 (10%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNT---TKSKYAPAP 203
           ++S+ + LD S SM D     + D    T      P   KK  W  +T   +++ Y    
Sbjct: 165 SVSMFLALDKSGSMGDPTETVNKDQPTETFTYDCNPHLNKKGKWVYDTCTGSRTNY---- 220

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP--LSNNLNE 261
                KI+ L  +AGNL   +  A  + +   VR G ++Y+I    +Q TP  L+   + 
Sbjct: 221 ---YTKIEALKMAAGNLFGQLTSADPDAQ--YVRTGAVSYDI----DQYTPSTLAWGTSG 271

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELY------NEKESSHNTIGSTRL-KKFVIFITDG 314
           V S +N L     TN+  AM  AY  L       N+ E + + + + ++ KK+++F+TDG
Sbjct: 272 VSSYVNALQAGGGTNSSGAMGTAYSSLTAKNAAGNDAEDAAHKLKTGQIPKKYIVFMTDG 331

Query: 315 ENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           +N+  S+   + +TL    C+  ++ G++IY++A  APP GQ LL+ C   +  +F    
Sbjct: 332 DNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPPGGQALLQYCASDAAHYFQAEQ 391

Query: 373 SRELLESFDKITDKIQEQSVRI 394
             +LL +F  I  K   Q  R+
Sbjct: 392 MEDLLAAFKAIGAKASAQLTRL 413


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 185/401 (46%), Gaps = 62/401 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TAI++ V F+ +   I+ +H  +++ ++   LD ++L     I++     +   +K+  
Sbjct: 20  LTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDF 79

Query: 61  S-----TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
           S      I++   +  L++  +  ++  +I +   ++I  D  +   Y   + ++YE+P 
Sbjct: 80  SYRIIKNIWQTDFRNELRENGF-AQDINNIERSTSLSIIIDDQHK-DYNLSAVSRYEMP- 136

Query: 116 ENLFLKGLIPSAL--TNLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNN 172
              F+    P     ++  L  T  ++ SS+ ++ + + MVLDVS SM D +        
Sbjct: 137 ---FIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHF-------- 185

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                                           P   K+ V   S   +++ I K+I +  
Sbjct: 186 -------------------------------GPGMDKLGVATRSIREMLDII-KSIPDVN 213

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
           N+ VR G + ++  IV  Q  PL+  +  ++ ++N+L     T + P + +AY ++++ K
Sbjct: 214 NV-VRSGLVTFSSKIV--QTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAK 270

Query: 293 ES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           E   H   G    KK++IF+TDGENS  +   +   +L  C   +  G  +Y++ V A  
Sbjct: 271 EKLEHIAKGHDDYKKYIIFLTDGENSSPNI--DNKESLFYCNEAKRRGAIVYAIGVQAEA 328

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             Q  L+ C  S  +F++V +SR+L ++F +I  ++ +Q +
Sbjct: 329 ADQ-FLKNCA-SPDRFYSVQNSRKLHDAFLRIGKEMVKQRI 367


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/390 (23%), Positives = 173/390 (44%), Gaps = 70/390 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  + V F+  + A+D  + M ++ ++Q+A+D+A L+  A +  +  +        Q 
Sbjct: 24  IAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAALATAARLSEEENLTAA-----QA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQYEIPTENLF 119
                K +   +K+         D       ++T   N +P++    +  +  +  E   
Sbjct: 79  QAFALKFVNGQVKE---------DFGAFNGFSVTPTVNIDPVETGGRTVWKVAVSMEGS- 128

Query: 120 LKGLIPSALT----NLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
            + L P A       L++   G  E + E   A S+ +VLD S SM+             
Sbjct: 129 -QSLTPMARIMGKDKLTVSVVGKSESAGEAQGAFSMALVLDRSGSMD------------- 174

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                          W+ N              +KI+VL  + G L+   ++A  E+K  
Sbjct: 175 ---------------WNLN------------GQKKINVLKTAVGGLIEQFEEADPERK-- 205

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
            VR+G  +YN  + G+  T L  N  + K  ++ L     T++  A   AY  + +++E+
Sbjct: 206 YVRLGASSYNSKLTGS--TKLRWNPGKTKEFVDALPASGGTDSTDAFDWAYTAVTHKREN 263

Query: 295 -SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
            +H+       KKF++F+TDG+N+ +SA  +T     +C+  ++ G+++Y+VA +AP  G
Sbjct: 264 NTHDAKSGQVPKKFIVFMTDGDNNYSSADSSTK---HLCDDAKDDGIEVYTVAFAAPNRG 320

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           + LL  C  +   FF   +S +L+E+F  I
Sbjct: 321 KQLLSYCASTEEHFFDAQNSAQLIEAFKNI 350


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 126/286 (44%), Gaps = 40/286 (13%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
           +LS   T +   S    +IS+ + LD S SM +     + D+             P +S+
Sbjct: 143 HLSTSGTTVGGHSQTQGSISMFLALDKSGSMGEATATVNADD-------------PTESY 189

Query: 190 -----WSKNTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                   N+  +K+       +R     KI+ L  +AGNL   +  A  +     VR G
Sbjct: 190 TYDCNLHYNSKNNKWVYDKCTGSRTNYYTKIEALKIAAGNLFGQLNSA--DPNAEYVRTG 247

Query: 240 TIAYNIGIVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------N 290
            ++Y+I    NQ TP  L+     V S +N L     TN+  AM  AY  L        +
Sbjct: 248 AVSYDI----NQYTPSNLAWGTAGVTSYVNALQANGGTNSSGAMSTAYSSLTAKNAAGND 303

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVS 348
            ++S+H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  
Sbjct: 304 AEDSAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFM 363

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           AP  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 364 APAGGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASAQMTRL 409


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/388 (22%), Positives = 180/388 (46%), Gaps = 66/388 (17%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           +AII  +  + +    ++++I   + ++Q+ +D A+L    +++  + I+D        +
Sbjct: 21  SAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLD-TVTMIKLKNIEDVVKNVGPVN 79

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           TI+ K +K  L+   +   +  ++     + +  D N     I  + +QY++P +   + 
Sbjct: 80  TIWTKNLKYELEHSDF-SSDVQNVIDDTSMKLESDSNFKTLSIT-AISQYKMPFKICNIH 137

Query: 122 GLIP-SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            L P +    + + S+  I R+ E   I + +VLDVS SM+D +++              
Sbjct: 138 LLCPKNKYVTVPVLSSMKIGRN-EGSDIDLMIVLDVSSSMDDNFMK-------------- 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS----- 235
                               P  AP +R     +E A     SI+K +++ + +      
Sbjct: 183 --------------------PEEAPCSR-----LEVAKK---SIRKMLEDFRKVPNYANV 214

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
            R G++ +N  +      PL   L  + + + K   + +TN+Y  M +A+ +LY   + +
Sbjct: 215 FRTGSVGFNDMV--QFPMPLKRGLKRIYNDIKKYRAFGSTNSYVGMKYAWEQLYGNPQDT 272

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            +       KK VIF+TDGEN   +A   T  T+++C  M+     IYS+A++   + ++
Sbjct: 273 KDR------KKIVIFLTDGENMIINA---TRKTIELCNDMKKKKAVIYSIALAV--DNKE 321

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKI 383
           +L+ C+ SSG  +A +D++ L++++  I
Sbjct: 322 VLQGCS-SSGNVYAADDAQSLVQAYSLI 348


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 122/264 (46%), Gaps = 31/264 (11%)

Query: 147 AISICMVLDVSRSM-EDLYLQKHNDNNNMTSNKYLLPPPPK-----KSFWSKNT-TKSKY 199
           +IS+ + LD S SM ED       D     +  Y  P  P      K  W   T +++ Y
Sbjct: 139 SISMYLALDKSGSMGEDTATVNEED----PTESYTYPCNPHYNRKGKEVWDTCTGSRANY 194

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                    KI+ L  +AGNL   +  A  +     VR G ++Y+I  V    + L+   
Sbjct: 195 -------YTKIEALKMAAGNLFAQLSGA--DPNAQYVRTGAVSYDI--VQYAPSSLAWGA 243

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELY------NEKESSHNTIGSTRL-KKFVIFIT 312
             V S +N L     TN+  AM  AY  L       N+ E S + + S ++ +K+++F+T
Sbjct: 244 IGVSSYVNALQAGGGTNSSGAMSTAYLSLTAKNAAGNDAEDSAHKLKSGQIPQKYIVFMT 303

Query: 313 DGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAV 370
           DG+N+  S+   + +TL    C+  ++ G++IY++A  APP GQ LL+ C   +  +F  
Sbjct: 304 DGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPPGGQALLQYCASDASHYFQA 363

Query: 371 NDSRELLESFDKITDKIQEQSVRI 394
               +L  +F  I  K   Q  R+
Sbjct: 364 EKMEDLFAAFKAIGAKASTQVTRL 387


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 117/251 (46%), Gaps = 16/251 (6%)

Query: 147 AISICMVLDVSRSM-EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
           ++S+ +VLD S SM ED      +D     + +Y      K  +   N TK K      P
Sbjct: 161 SVSMFLVLDRSGSMGEDTATVNASD----PTEEYNYDCSEKDRY--GNVTKKKTCTDTRP 214

Query: 206 AN-RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
               KI+ L  + G L   +     EK+   VR G ++YNI +   +   L      V  
Sbjct: 215 HYYTKIEALKLAVGTLTGELDAVDPEKE--YVRTGAVSYNIEM--QKAKALDWGTAHVTK 270

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL-KKFVIFITDGENSGASAYQ 323
            +NKL   + T++  A   AY +L +  E   +   + ++  K+++F+TDG+N+  SA  
Sbjct: 271 YVNKLTATDGTDSGEAFKTAYNKLADAAEDKAHVDKTGQVPTKYIVFMTDGDNNYTSA-- 328

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
               T   C+  R+A M++Y++A  AP  GQ LL  C  + G +F   D   LL++F +I
Sbjct: 329 -DTETKTWCDKARDAKMQVYTIAFMAPARGQALLSYCATAPGNYFPAGDMTALLKAFKEI 387

Query: 384 TDKIQEQSVRI 394
             K   Q  R+
Sbjct: 388 GMKASNQVTRL 398


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 113/419 (26%), Positives = 184/419 (43%), Gaps = 58/419 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A D+A L+  A+ +++ TI+  TT+ +  
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAADSAALA-TATALANGTIQ--TTEAEAF 80

Query: 61  STIF-KKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENL 118
           +  F   Q+  +L+ G+       DI     +N+ T        Y       Y + T N 
Sbjct: 81  ARNFVAGQMANYLQSGT-------DIKSTTSVNVQTTTSGKSTSYQVTVSPAY-VLTVNP 132

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
            ++  +     +LS   T I   S    +IS+ + LD S SM +         +  T N+
Sbjct: 133 LMQA-VGFTTQHLSTSGTTIGGHSQTQGSISMFLALDKSGSMGE---------DTATVNE 182

Query: 179 YLLPPPPKKSF-----WSKNTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAI 228
                 P +S+        NT  +K+       +R     KI+ L  +AGNL + +  A 
Sbjct: 183 ----ESPTESYTYDCNLHYNTKNNKWVYDKCTGSRTNYYTKIEALKMAAGNLFSQLNSA- 237

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
            +     VR G ++Y+I    NQ  P  L+  +  V S +N L     TN+  AM+ AY 
Sbjct: 238 -DPNAQYVRTGAVSYDI----NQYAPSSLAWGITGVSSYVNALQANGGTNSSGAMNTAYT 292

Query: 287 ELY------NEKE-SSHNTIGSTRLKKFVIFITDGEN----SGASAYQNTLNTLQICEYM 335
            L       N+ E S+H        KK+++F+TDG+N    SG  +Y     T + C+  
Sbjct: 293 SLTAKNAAGNDVENSAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTA--TKKTCDDA 350

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           ++ G++IY++A  AP  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 351 KSKGIEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQLTRL 409


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 111/409 (27%), Positives = 180/409 (44%), Gaps = 39/409 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A D+A L+  A+ +++ TI+  T++ +  
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLISKQQLQEAADSAALA-TATALANGTIQ--TSQAEAF 80

Query: 61  STIF-KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
           +  F   Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L 
Sbjct: 81  ARNFVAGQMANYLQSGVDIKSATGVTVQ------TNTSGNSTSYQVTVSPSYDLTVNPLM 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-EDLYLQKHNDNNNMTSNK 178
               +     +LS   T I   S    +IS+ + LD S SM ED      N+ +   S  
Sbjct: 135 QA--VGFTTQHLSTSGTTIGGHSQTQGSISMYLALDKSGSMGEDT--ATVNEEDPTESYT 190

Query: 179 YLLPPP-PKKSFWSKNT-TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
           Y       KK  W  +T T S+     A    KI+ L  +AGNL   +  A  +     V
Sbjct: 191 YDCNGHYNKKGKWIYDTCTGSR-----ANYYTKIEALKMAAGNLFGQLSSA--DPNAQYV 243

Query: 237 RIGTIAYNIGIVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY----- 289
           R G ++Y+I     Q TP  L+   + V + +N L     TN+  AM  AY  L      
Sbjct: 244 RTGAVSYDI----VQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAA 299

Query: 290 --NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSV 345
             + ++++H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++
Sbjct: 300 GNDAEDAAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTI 359

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           A  AP  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 360 AFMAPEGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRL 408


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 127/279 (45%), Gaps = 27/279 (9%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSM-EDLYLQKHNDNNNMTSNKYLLPPP-PKK 187
           +LS   T I   S    +IS+ + LD S SM ED      N+ +   S  Y       KK
Sbjct: 62  HLSTSGTTIGGHSQTQGSISMYLALDKSGSMGEDT--ATVNEEDPTESYTYDCNGHYNKK 119

Query: 188 SFWSKNT-TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
             W  +T T S+     A    KI+ L  +AGNL   +  A  +     VR G ++Y+I 
Sbjct: 120 GKWIYDTCTGSR-----ANYYTKIEALKMAAGNLFGQLSSA--DPNAQYVRTGAVSYDI- 171

Query: 247 IVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NEKESSHN 297
               Q TP  L+   + V + +N L     TN+  AM  AY  L        + ++++H 
Sbjct: 172 ---VQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAAGNDAEDAAHK 228

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQD 355
                  KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  AP  GQ 
Sbjct: 229 LKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPEGGQA 288

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 289 LLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRL 327


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 180/417 (43%), Gaps = 47/417 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA++  +       ++D+A+++  +NQ+Q A DAA L+  +++VSD    D    KD  
Sbjct: 25  MTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSDAR-PDIEEAKDLA 83

Query: 61  STIFKKQIKKHLK-----QGSYIRENAGDIAQ-------------KAQINITKDKNNP-- 100
               K Q           +G  I    G  A                +I+IT   N    
Sbjct: 84  RKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPRWEDVNATEIDITATPNGAKG 143

Query: 101 --LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSR 158
              Q    +K   +    N   + L P ++  +  RST      S+N A+S+ +VLD S 
Sbjct: 144 KSFQVTVANKHLLQF---NAMTRLLGPESI-EIETRSTAESATESKN-ALSMYLVLDRSG 198

Query: 159 SMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
           SM           N + + K   P   + + WSK        P       KID L  + G
Sbjct: 199 SMA-------WKTNTINTGKAKCPNYTEAN-WSKYPDLKATGPCYVT---KIDALKTAVG 247

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
           +L+  +  A  + ++  VR G I+YN     +  + LS         ++ L     T + 
Sbjct: 248 DLLAQLVTA--DPESAYVRTGAISYNS--AQDAASSLSWGTRGAAGYVDALVAIGGTASG 303

Query: 279 PAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
            A   A++++ N  E S H         K+++F+TDGEN+ A+   +T+ T Q C+  + 
Sbjct: 304 NAFKTAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHAN--DDTV-TRQWCDTAKA 360

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           + ++IYSVA  AP  GQ LL+ C  SS  +F   ++ +L+ +F  I ++      R+
Sbjct: 361 SKVQIYSVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGERAAASVSRL 417


>gi|218506715|ref|ZP_03504593.1| hypothetical protein RetlB5_03444 [Rhizobium etli Brasil 5]
          Length = 269

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           KI+ L  +AGNL + +  A  +     VR G ++Y++  V    + L+  +  V S +N 
Sbjct: 77  KIEALKIAAGNLFSQLNSA--DPNAEYVRTGAVSYDL--VEYTPSKLAWGITAVTSYVNA 132

Query: 269 LNPYENTNTYPAMHHAYRELY------NEKESSHNTIGSTRL-KKFVIFITDGENSGASA 321
           L     TN+  A++ AY  L       N+ E + + + + +L KK+++F+TDG+N+  S 
Sbjct: 133 LESGGGTNSSGAVNTAYTSLTAKNAAGNDAEDAAHKLKTGQLPKKYIVFMTDGDNNDDSR 192

Query: 322 YQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
              + +TL    C+  +  G++ Y++A  AP  GQ LL  C      +F      +LL +
Sbjct: 193 GGRSYDTLTKATCDTAKAKGIETYTIAFMAPEGGQALLHYCASDDAHYFQAEKMEDLLAA 252

Query: 380 FDKITDKIQEQSVRI 394
           F  I  K   Q  R+
Sbjct: 253 FKAIGAKASAQVTRL 267


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 98/196 (50%), Gaps = 10/196 (5%)

Query: 198 KYAPAPAPAN-RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS 256
           +Y  A +P   +KI  L  + G L++ +  A  + K+  VR   IA++  +  +  + L+
Sbjct: 207 QYPKAKSPCYIKKIAALKTAVGTLLDQLDSA--DPKSQYVRTAAIAWSSEV--DSSSALA 262

Query: 257 NNLNEVKSR-LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI-GSTRLKKFVIFITDG 314
                 +S  ++ LN    T +   M  AY+ +    E++     G+T  +K ++ +TDG
Sbjct: 263 WGTTTTRSNVISGLNANGGTESSAPMALAYKNVSASSEATAQAAKGNTTFQKIIVLMTDG 322

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           EN+  S+   TL T   C+  ++AG+ IYSVA  AP  GQ LL+ C  S   +F      
Sbjct: 323 ENNATSSDTKTLAT---CKAAKDAGVLIYSVAFMAPDRGQTLLKNCASSPSNYFDAQQMS 379

Query: 375 ELLESFDKITDKIQEQ 390
           +L+ +F  I ++  +Q
Sbjct: 380 DLIAAFKTIGNQASKQ 395


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 171/384 (44%), Gaps = 33/384 (8%)

Query: 16  AIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK------ 69
           +ID+A+++  +NQ+Q A DAA L+  +++VSD    D    K+      K Q        
Sbjct: 40  SIDMANMLMTKNQLQDATDAAALAAASALVSDEQ-PDIAAAKEIARKFLKTQAGGTTTPD 98

Query: 70  ------KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
                 +    G+       D     ++NIT+  N     I +     +  TE   +  L
Sbjct: 99  APADSGEGASSGAASSTPDWDDVNTLEVNITETPNGTKGKIFQVTVINKRVTEFNAMTRL 158

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
           + +    L   ST      S+N A+S+ +VLD S SM      K N  N    +     P
Sbjct: 159 LGTDSIELEASSTAESATESKN-ALSMYLVLDRSGSMA----WKTNTINAAKKS----CP 209

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
              +S WS+    + +A +P     KID L  +  +L+   Q  + +   + VR   I+Y
Sbjct: 210 NYTESNWSRY--PNLWASSPCYVT-KIDALKTAVTDLL--AQLLVADPDQIYVRTAAISY 264

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIGST 302
           N   V +    L+   +   + +N L     T +  A   AY+++    E ++H      
Sbjct: 265 NS--VQDTAGTLAWGTSGAAAYVNALVATGGTASAGAFKTAYQKVIAATENTAHAAKNGQ 322

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
              K+++F+TDGEN+ A+   +T+ T Q C+  +   ++IYSVA  AP  GQ LL+ C  
Sbjct: 323 VPSKYMVFMTDGENNYAN--DDTV-TKQWCDTAKANKVEIYSVAFMAPERGQALLKYCAS 379

Query: 363 SSGQFFAVNDSRELLESFDKITDK 386
           SS  +F   +  +L+ +F  I ++
Sbjct: 380 SSSHYFEAEEVTDLVAAFKAIGER 403


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 193/439 (43%), Gaps = 86/439 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVS-------------D 47
            + I+IS+  LFI   I +    + +N M++A  +A+LSG + I+S              
Sbjct: 26  FSVILISI-LLFIGILIYVLDYYHKKNAMENANTSAILSGASKIISRISYFGDNMSSHTH 84

Query: 48  RTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQK------AQINITKDKN--- 98
           R I D  T+           IK ++K+   +  +  DI++K      ++++IT++ +   
Sbjct: 85  RAIVDDVTR----------FIKSYIKESLLMDSSVFDISEKNIISQNSKVSITREPHPNV 134

Query: 99  ----NPLQYIAESKAQYEIPTENL------FLKGLIPSALTN--LSLRSTGIIERSSENL 146
               N    +   K  Y I  E        F   L+   + +  +S     +   + E+ 
Sbjct: 135 FHEFNNQSILQNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFVPALVKIDTGEHP 194

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
              + +V+D+S SM  L          M S+       P+ +       KSK        
Sbjct: 195 FFFVQLVVDLSASMSCL----------MNSD-------PEHATEFSVCGKSK-------K 230

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
           N K+D L ++    ++S+ +  + +K+ +  IG   Y   +  N   P S    +V+  +
Sbjct: 231 NSKMDALKKAVLLFLDSVDRGSKTQKD-THYIGLTGYTTRVEKN-IEP-SWGTGKVRKYI 287

Query: 267 NK---LNPYENTNTYPAMHHAYRELYNEKESSH-NTIGSTRLK-------KFVIFITDGE 315
            +   +N    T++ PAM  AY+ L ++K+ +    I   R+K       KF+IF+TDGE
Sbjct: 288 VEEIDVNMLGQTDSTPAMKKAYQILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGE 347

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
           N+     ++ + T++ICE  +   +KI +++++A   G+ LL+KC  +   ++ V D+  
Sbjct: 348 NNDP---KSDVKTIKICEKAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGS 404

Query: 376 LLESFDKITDKIQEQSVRI 394
           LL  F  I+  I     ++
Sbjct: 405 LLRVFQDISTLITHYKYQV 423


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 95/408 (23%), Positives = 177/408 (43%), Gaps = 39/408 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++ V       A+D   ++  R+ +QS++DAA L+  +++ +  +  D        
Sbjct: 53  MTAVLLPVSIGVAGLAMDATEMVQSRSALQSSVDAAALAAASAMSNGMSEADAI------ 106

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQ------INITKDKNNPLQYIAESKAQYEIP 114
             + K  +   L       EN   + Q  Q      +  T+  ++   Y  E    Y I 
Sbjct: 107 -ALAKSFLSSQLANTMARDENTSSVDQITQAEPDISVKTTQVNSSSTSYDVELTGSYTI- 164

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHNDNN 172
           T N   + L       ++L++ G  +   ++    +S+ +VLD S SM        ND  
Sbjct: 165 TMNPLSRVL---GWETVTLKAYGKAQAATTASESPLSMYLVLDRSGSM--------NDET 213

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
             T              W+K TT + Y  +      KI+ L  +  +L   ++KA  +  
Sbjct: 214 ATTYTGTCTKTTTSGYGWNKKTTTTSY--SCTKNYTKIESLKLAVADLAAQLKKA--DPN 269

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--N 290
           +  VR G  +YN     +    +S     V + +N L+    T+   A+  AY  L   N
Sbjct: 270 SEYVRTGADSYNAS--ADTAQAMSWGTANVVTYVNALSATGGTDARGALSAAYSALQTSN 327

Query: 291 EKE-SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI---CEYMRNAGMKIYSVA 346
           + E ++HN    +++ ++++F+TDGE +G S+  ++     +   C  ++  G++IY+VA
Sbjct: 328 KTEITAHNVSSVSKIGRYIVFMTDGEMTGNSSSWSSSIDSAVRSQCTSIKADGIQIYTVA 387

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             AP  G+ LL  C   +  ++   D+  L+ +F +I  K    S R+
Sbjct: 388 FMAPANGKSLLSACASDASHYYEATDAASLVAAFGEIGKKATSTSTRL 435


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 69/118 (58%), Gaps = 11/118 (9%)

Query: 275 TNTYPAMHHAYRELYNEKESSHNT--------IGSTRLKKFVIFITDGENSGASAYQNTL 326
           T++ PAM  AY+ L ++K+ S  T        I S   +KF+IF+TDGEN+    +++ +
Sbjct: 292 TDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNN---FKSNV 348

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           NT++IC+  +   +KI +++++A P GQ LL+ C  S    + V ++  L+  F  I+
Sbjct: 349 NTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNIS 406


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 90/392 (22%), Positives = 151/392 (38%), Gaps = 66/392 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALD-AAVLSGCASIVSDRTIKDPTT-KKD 58
           +  I+I +    +T  ID++     R ++Q+A D AAV +G A +  + TI       KD
Sbjct: 85  LFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALLAEEITIAQANAYAKD 144

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKD-KNNPLQYIAESKAQYEIPTEN 117
             + I           GS      G +  K  + IT+    N   Y+ +     +IP   
Sbjct: 145 AFNRIASGLSAS--GDGSSGTSIFGTMTVKPAVQITETVDGNTTNYVVKVNGTAKIPASP 202

Query: 118 L---FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           L   F  G       +L   S     ++    ++S+ +VLD S SM              
Sbjct: 203 LSFMFFDGETGKNTISLGFESE-TTAKAEAGASLSMALVLDRSGSMG------------- 248

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ--EKK 232
                          W + +  S+   A                  V S+ K +Q  +  
Sbjct: 249 ---------------WERPSRMSELKKA------------------VRSLIKELQTVDPD 275

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
           +   R+G  AY+    G +   L+ N N V+S +N L     T   PA+  A  +L    
Sbjct: 276 DQFTRLGAYAYHWYYAGKK--ELTWNKNSVRSWVNSLPASGGTRAAPAIQKAKNDLLTNS 333

Query: 293 E-SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           E ++H          F++++TDG +   +  +        C   +NAG+ IY+VA  AP 
Sbjct: 334 ELNAHINKNEQEPDLFILYMTDGIDGDPNWAKRE------CTSAKNAGITIYTVAFKAPA 387

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
            G++LL+ C  S   ++   ++ EL + F  I
Sbjct: 388 SGRNLLKACATSDAHYYDAKNANELNKVFKDI 419


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 175/418 (41%), Gaps = 47/418 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+I  +       ++D+A+++  +NQ+Q A DAA L+  +++VSD          ++ 
Sbjct: 14  MTALIAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSD-----ARPDIEEA 68

Query: 61  STIFKKQIKKHLKQGSYIR---ENAGDIAQKAQINITKDKNNPLQYI-------AESKA- 109
             I +K +K  +   S      E  G +A       + D  N  + +        + K+ 
Sbjct: 69  KAIARKFLKTQMAATSSADVPGEAVGTMAAAGSTAPSWDDVNTSEVVIVETPNGTKGKSF 128

Query: 110 QYEIPTENLF----LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
           Q  +  ++L     +  L+      L  RST      S+N AIS+ +VLD S SM   + 
Sbjct: 129 QVSVANKHLLQFNAMTRLLGKESIELETRSTADSATESKN-AISMYLVLDRSGSMA--WK 185

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN-RKIDVLIESAGNLVNSI 224
               D +            P+   W+ +        A +P    KI  L  +   L   +
Sbjct: 186 TDTVDTSR-----------PRCINWTASNWGESNVRATSPCYVDKITTLKSAVDKLFTPL 234

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
            K   +  N  +R G  +YN     ++ + L+       + +  L+    T++  A   A
Sbjct: 235 AK--MDPGNEYLRAGAASYND--RQDRASKLTWGTKNASAHVQGLDATGGTDSSSAFAAA 290

Query: 285 YRELYNEKES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-------TLQICEYMR 336
             EL  + E+ +H        +K+++F+TDGEN+  +   +  +       T   C   +
Sbjct: 291 VEELLLDGENEAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAK 350

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           N G+ I++VA  AP  G+DLL+ C  S   +   +D+  L+  F+KI  K      R+
Sbjct: 351 NNGIAIFTVAFMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQKAAAMIARL 408


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 94/401 (23%), Positives = 173/401 (43%), Gaps = 37/401 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V        ++LA++M ++  MQ+  D+A      +  ++  +++     +Q 
Sbjct: 24  MTAILLPVLLGVAGAGMELANVMQVKADMQNTADSAA----LAAATEARLREGKLSDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQYEIPTENLF 119
             I K  I   +++ +   E   ++ + +   +T  +N     Y  E+  +++I    + 
Sbjct: 80  KEIAKNFIAAQMEK-NLTAEEKIELEKNSPTRVTTTENARGKTYAVETTIKHQIQLNPML 138

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
             G I +   +LS+  T    +S+ N    I M L + RS    +     D    +   Y
Sbjct: 139 --GFIGAKTLDLSVTGTA---KSTINKGAPISMYLALDRSGSMSFKTDTVDTTKTSCQNY 193

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA-----IQEKKNL 234
                     WSK    +K +P       K   L  + G LV ++ KA     +     L
Sbjct: 194 ------TSDNWSKYPNLAKTSPCYV---NKAASLKTAVGFLVATLNKADPTYTVNGGSEL 244

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL---NPYENTNTYPAMHHAYREL--Y 289
            VR G   Y       Q   +    + V S ++K     P   T+   +++ AY  L   
Sbjct: 245 -VRTGASVYTHETYVAQS--IGWGTSGVTSYVDKQIPEFPSGGTDARSSLNAAYNALKKA 301

Query: 290 NEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNT---LNTLQICEYMRNAGMKIYSV 345
           N  E+  H   GS   +++++ +TDGE +G SA  N+    +    CE  +  G+KI+SV
Sbjct: 302 NPDEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKKDGIKIFSV 361

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           A  AP +G+ LL+ C  S+  ++A  +  +++ +F +I  K
Sbjct: 362 AFMAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIARK 402


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score = 66.2 bits (160), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 89/191 (46%), Gaps = 18/191 (9%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ-------CTPLSNNLNE 261
           KID L ++A  L +++  A  +  +  VR G  +YN G++ N         + ++     
Sbjct: 197 KIDALKKAADALFDALDTA--DPDHSLVRTGAYSYNNGLIYNSQKTQIKSMSGMAWGTAT 254

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS------HNTIGSTRLKKFVIFITDGE 315
             + ++ +     T+    M  A   +    + S      H   G+T + +++I +TDGE
Sbjct: 255 TATYVSGITASGGTDATEPMRQATLSIAKASDGSDVETQAHAVKGNTIVSRYIILMTDGE 314

Query: 316 NSG-ASAYQNTL--NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
            +G    +Q++   N    C+  + AG+KI++VA  AP +G+ LL+ C    G ++    
Sbjct: 315 MTGNTGVWQSSFDQNVRNQCDATKTAGIKIFTVAFMAPDKGKQLLQYCASPGGNYYEAET 374

Query: 373 SRELLESFDKI 383
             +L+ SF  I
Sbjct: 375 MEKLVASFTSI 385


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 8/139 (5%)

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           PLS N + + S ++ +    NTNT   +   +  L      S     +  L K ++F+TD
Sbjct: 294 PLSTNWSALNSHIDAMASAGNTNTTIGLAWGWNMLTQGGPLSSAAAPAANLDKVIVFLTD 353

Query: 314 GENS--GASAYQNTLN--TLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFF 368
           G+N+    S   NT+N  T  IC  ++ AG+K+YSV V    EG   L+R C    G ++
Sbjct: 354 GDNTRNRWSNNSNTINARTTLICNNIKAAGIKVYSVRV---IEGNATLIRNCATEPGMYY 410

Query: 369 AVNDSRELLESFDKITDKI 387
           +V  + EL   F  I   +
Sbjct: 411 SVTTASELTSVFASIAQSL 429


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 96/407 (23%), Positives = 175/407 (42%), Gaps = 49/407 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V   F    ++LA++M ++  +Q+  D+A      +  ++  +K+     +Q 
Sbjct: 24  MTAILLPVLLGFAGAGMELANVMQVKADLQNTADSAA----LAAATEARLKEGALTDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLF 119
             I K  I   +++ +   E    + + + +NI T D      Y  ++   Y++    L 
Sbjct: 80  KEIAKAFIASQMEK-TLTEEEKKALEKNSPVNIGTTDDARGKTYTIQTTINYQMQLNPLL 138

Query: 120 LKGLIPSALTNLSLRSTGI-IERSSENLAISICMVLDVSRSME---DLYLQKHNDNNNMT 175
             G   +    L L +TG  +   ++   IS+ +VLD S SM    D    K     N T
Sbjct: 139 --GFFGAK--TLDLAATGTAVSTVNKGAPISMYLVLDRSGSMSFKTDTLNTKKTSCQNYT 194

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA----IQEK 231
            + +   P  K +             +P   N+    L  + G LV ++ KA        
Sbjct: 195 VDNWGSYPNLKNT-------------SPCYVNKATS-LKTAVGYLVATLNKADPTYTANG 240

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL---NPYENTNTYPAMHHAYREL 288
            +  VR G   Y       Q  P++   + V + ++K     P   T+   +++ AY  L
Sbjct: 241 GSELVRTGASVYTHETYAAQ--PITWGTSSVATYVDKQIPEFPSGGTDARSSLNAAYNAL 298

Query: 289 --YNEKES-SHNTIGSTRLKKFVIFITDGENSGASAY------QNTLNTLQICEYMRNAG 339
              N  E+  H    S   +++++ +TDGE +G S+       Q   NT   C+  +  G
Sbjct: 299 KKANTVEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNT---CDTAKKDG 355

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           +KI+SVA  AP +G+ LL+ C  S   ++A  +  +++ +F +I  K
Sbjct: 356 IKIFSVAFMAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIARK 402


>gi|218678237|ref|ZP_03526134.1| hypothetical protein RetlC8_04927 [Rhizobium etli CIAT 894]
          Length = 120

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 305 KKFVIFITDGEN----SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
           KK+++F+TDG+N    SG  +Y     T + C+  ++ G++IY++A  AP  GQ LL  C
Sbjct: 27  KKYIVFMTDGDNNNDSSGGRSYDTA--TKKTCDDAKSKGIEIYTIAFMAPAGGQALLHYC 84

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
                 +F      +LL +F+ I  K   Q  R+
Sbjct: 85  ASDDSHYFQAEKMEDLLAAFEAIGAKSAAQVTRL 118


>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 171/402 (42%), Gaps = 63/402 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81

Query: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
              +    +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 82  ILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139

Query: 116 ENLFLKGLIPSALT--NLSLRSTGIIERSSENLA-ISICMVLDVSRSMEDLYLQKHNDNN 172
           +       IP      ++ +  T  ++ +S+  A + + +VLDVSRSME           
Sbjct: 140 K---FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME----------- 185

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                          SF+  + TK             ID+ I+S   ++  + K I +  
Sbjct: 186 ---------------SFFDSSITK-------------IDMAIKSINAMLEEV-KLIPDVN 216

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYN- 290
           N+ V+ G + ++  I   +   L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ 
Sbjct: 217 NV-VQSGLVTFSNKI--EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
           +    H        KK ++F+TDGEN      Q    +L  C   +  G  +Y++ +   
Sbjct: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ---QSLYYCNEAKKRGAIVYAIGIRV- 329

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 330 IRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370


>gi|170751925|ref|YP_001758185.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658447|gb|ACB27502.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 568

 Score = 60.1 bits (144), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 80/200 (40%), Gaps = 56/200 (28%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-----YNEKE---SS 295
           N G        L+NN N +K+ +N + P  +TN +      +R L     + + +   SS
Sbjct: 362 NFGCTTQPLQRLTNNTNALKTLINNMAPSGSTNIHEGFMWGWRTLSPNSVFADGQPYASS 421

Query: 296 HNTIGSTRLKKFVIFITDGENSGAS------------------------------AYQNT 325
            N+  +T + K +I +TDG NS  +                              AYQNT
Sbjct: 422 ANSSNATNINKIIILMTDGTNSWGTNSSAPTGSLYFAAGYFRNANGTTPNPRLTTAYQNT 481

Query: 326 -----------LNTL--QICEYMRNAGMKIYSVAVSAPPE-----GQDLLRKCTDSSGQF 367
                      L+ L  + C   +   + IY++  S P +     GQ LLR C  S  QF
Sbjct: 482 NIADGNTARKALDALTAEACANTKAVNISIYTIGFSVPTDPIDSAGQTLLRNCASSPDQF 541

Query: 368 FAVNDSRELLESFDKITDKI 387
           +  N S +L+++F  I   I
Sbjct: 542 YLANSSDDLIKAFKSIQASI 561


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 11/141 (7%)

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITDG-ENSG 318
           EV S   + +    T+ +P +  AY +L+++ E   H    S  +KKF++ +TDG +N G
Sbjct: 325 EVSSHYKRKHENTATDIHPILQEAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTDGAQNEG 384

Query: 319 ASAYQNTLNTLQICEYMRNAGMKI----YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
             +     + L+IC+  +  G+KI    YSV  S   +  D L +C  S  +FF   D+ 
Sbjct: 385 VHSVD---SVLKICDAAKEEGIKIFTISYSVDSSERKKANDFLSRCA-SPDKFFEAYDAD 440

Query: 375 ELLESF-DKITDKIQEQSVRI 394
           +L   F + I D I E+ V+I
Sbjct: 441 KLNMIFKEHIGDAIFERLVKI 461


>gi|159044810|ref|YP_001533604.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
 gi|157912570|gb|ABV94003.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
          Length = 553

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
           NS A  Y     T QIC+ ++   + I+++   AP  GQDL+R C  SSG +F V +  E
Sbjct: 481 NSTADGY-----TEQICDQLKAQDVVIFTIGFEAPQRGQDLMRYCASSSGHYFDV-EGVE 534

Query: 376 LLESFDKITDKIQE 389
           + E+F  I + IQ+
Sbjct: 535 ISEAFSSIANTIQQ 548


>gi|322436225|ref|YP_004218437.1| VWFA-related domain protein [Acidobacterium sp. MP5ACTX9]
 gi|321163952|gb|ADW69657.1| VWFA-related domain protein [Acidobacterium sp. MP5ACTX9]
          Length = 304

 Score = 52.8 bits (125), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 73/151 (48%), Gaps = 22/151 (14%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           +    +N+   +++ LN+L   + T  Y A++ A + L           G  R ++ ++ 
Sbjct: 125 EVVSFTNDKKRIENGLNELRKGDATAVYDAVYLASQRL------GETNAGGGR-RRVLVL 177

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG---------QDLLRKCT 361
           ITDG+N+      + +   Q  E  + AG+ +Y++ V  P E            L++  T
Sbjct: 178 ITDGDNT-----VHGVGYDQAVEQAQRAGVMVYALIV-VPIEADAGRNTGGEHALIQMAT 231

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           D+ G ++ VND R+L + + K++D ++ Q V
Sbjct: 232 DTGGNYYYVNDPRDLAKVYAKVSDDLRTQYV 262


>gi|302382135|ref|YP_003817958.1| von Willebrand factor A [Brevundimonas subvibrioides ATCC 15264]
 gi|302192763|gb|ADL00335.1| von Willebrand factor type A [Brevundimonas subvibrioides ATCC
           15264]
          Length = 560

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 68/172 (39%), Gaps = 38/172 (22%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVIFITD 313
           L++N   +++ +N +    NTN        +  L  N         G+ RLKK +I +TD
Sbjct: 383 LTDNYTALRTAVNNMIASGNTNVPLGTMWGWHTLSPNAPFGDGRPYGTERLKKIIIIMTD 442

Query: 314 GENSGASA--------------YQNTLN-----------------------TLQICEYMR 336
           G N  +                +QN L                        T  +C  M+
Sbjct: 443 GANVMSDTTSPNDSTYNGLGYIWQNRLGIVSGNDTTRRTRMDNRFDHATAATEDMCGNMK 502

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           +  +++Y+VAV      Q LLR+C   +  +F V+ +  +  +FD+I   I+
Sbjct: 503 DKDIEVYTVAVQVDSTAQTLLRRCATDTDHYFPVDSAAGIGAAFDRIAGAIE 554


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 94/448 (20%), Positives = 192/448 (42%), Gaps = 70/448 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+++ V        +D+    Y  + ++ A   A+++    ++  +++++ +++   +
Sbjct: 25  ITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI--QSLEEVSSRAKNS 82

Query: 61  STIFKKQIKKHLKQG--SYIRENAGDIAQKAQINITKDKNNP----LQYIAESKAQYEIP 114
            T  K++I+++L +   + +++N  D   +  +  T  + NP     Q +  S+    + 
Sbjct: 83  FTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLN 142

Query: 115 TENLFLKGL-IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
             +LFL+ + I S L      +  +     +   +SI  V+D SRSM D       D+  
Sbjct: 143 PLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY----QRDSEG 198

Query: 174 MTSNKYLLPPPPK-KSFWSKN----TTKSKYAPA-------------PAPAN-------- 207
              N +  P     KS+ S+N        K +P              P P +        
Sbjct: 199 QPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHF 258

Query: 208 ----------RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                     +K  ++ ++  +++ SI+K   +  N +VR+G   +N  ++ +     S 
Sbjct: 259 VDSSSLRHVIKKKHLVRDALASVIRSIKKI--DNVNDTVRMGATFFNDRVISD--PSFSW 314

Query: 258 NLNE-----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFI 311
            +++     VK+     N   +T    AM  AY  + +  E   H    +   KK+++ +
Sbjct: 315 GVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLL 374

Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD----LLRKCTDSSGQF 367
           TDGEN+     Q+    + IC   ++ G++I ++A S     Q+     L  C  S   F
Sbjct: 375 TDGENT-----QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCA-SPNSF 428

Query: 368 FAVNDSRELLESF-DKITDKIQEQSVRI 394
           F  N + EL + F D+I ++I E+ +RI
Sbjct: 429 FEANSTHELNKIFRDRIGNEIFERVIRI 456


>gi|114704798|ref|ZP_01437706.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
 gi|114539583|gb|EAU42703.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
          Length = 545

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
           T L+ +L  V++ +NKL P  NTN    +      L      +    GS  ++K +I +T
Sbjct: 401 TGLTFDLQSVETAVNKLTPSGNTNVTIGVQWGMEALTAAAPLTGVRTGS-EVRKVMIVLT 459

Query: 313 DGENS----GASAYQNTLN--TLQICEYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSG 365
           DG N+      S  +N ++  TL  C   +  G+++Y+V +    EG +DLL+ C ++  
Sbjct: 460 DGLNTQNRWWGSRDRNKIDARTLAACNNAKAMGIELYTVRLV---EGNEDLLKTCAETED 516

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           ++  V  + +L  +F  +  ++  + VR+A
Sbjct: 517 KYHYVTSASQLKTTFADLARQV--KGVRLA 544


>gi|149922008|ref|ZP_01910450.1| hypothetical protein PPSIR1_18327 [Plesiocystis pacifica SIR-1]
 gi|149817173|gb|EDM76653.1| hypothetical protein PPSIR1_18327 [Plesiocystis pacifica SIR-1]
          Length = 996

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 74/166 (44%), Gaps = 21/166 (12%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAY-NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT 277
           +LV    +A     + S  IG IA+ N   V  +  P +N L  + S + +L+    TN 
Sbjct: 547 DLVKEAARATARTLDPSDEIGVIAFDNSPQVLVRLQPAANRLR-ISSSIRRLSAGGGTNA 605

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
            PA+  AY +L           GS  L K VI ++DGE+      +N +N L     MR 
Sbjct: 606 MPALREAYLQLA----------GSKALVKHVILLSDGESP-----ENGINAL--LGDMRQ 648

Query: 338 AGMKIYSVAVSAPPEGQD-LLRKCTDSSGQFFAVNDSRELLESFDK 382
           + + + SV V     G+D L+R      G++F   D  ++   F +
Sbjct: 649 SDITVSSVGVGD-GAGKDFLIRVAERGRGRYFYSEDGTDVPRIFSR 693


>gi|259416688|ref|ZP_05740608.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348127|gb|EEW59904.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 583

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 280 AMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAG 339
           ++ + YR+L+ +  S+ +     RL  +V     G+++  S       TL +C+  +  G
Sbjct: 481 SLRYLYRDLFGDWMSNASWYWYNRLYSYV-----GDSTKDS------RTLAVCDAAKEKG 529

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           + ++++   AP  GQ +L++C  S+  ++ V D  E+ ++F  I   I++
Sbjct: 530 IVVFTIGFEAPWRGQQVLQQCASSASHYYDV-DGLEISDAFASIASAIRQ 578


>gi|312793553|ref|YP_004026476.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180693|gb|ADQ40863.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 726

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           G    PL+ +   VK+ +++++ +  TN    +  A  +L +  +SS + I      K +
Sbjct: 84  GYLLQPLTTDFQTVKNAIDRIDSWGGTNIAEGIRIANHQLIS--QSSDDRI------KVI 135

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK-CTDSSGQF 367
           I +TDGE      Y N L T       +N G+ IY++ +    + ++LLR   T + G +
Sbjct: 136 ILLTDGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVD-ENLLRNIATQTGGMY 185

Query: 368 FAVNDSRELLESFDKITDKIQE 389
           F V+ + +L + F +IT+ + E
Sbjct: 186 FPVSSASQLPQVFKRITEIVTE 207


>gi|323493494|ref|ZP_08098616.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
 gi|323312317|gb|EGA65459.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
          Length = 393

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 69/134 (51%), Gaps = 7/134 (5%)

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR----LKKFVI 309
           PL++NLN+V   +N+L    +T +Y  +    R+L    +S+   +G  R    +++ ++
Sbjct: 249 PLTSNLNDVVDAVNRLQTIGSTASYQGLLWGLRQLTPNWQSAWR-VGPNRNQDNVQRKLV 307

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
            +TDG +   +++ + L    +C   ++ G+++  +         +   +C  S+G  F+
Sbjct: 308 LMTDGMDD--NSHLDELINAGLCTRAKDLGIELNFIGFGVQSWRLEQFTRCAGSAGAVFS 365

Query: 370 VNDSRELLESFDKI 383
            N++++L + F ++
Sbjct: 366 ANNTQDLDDYFSQL 379


>gi|312878233|ref|ZP_07738157.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311794982|gb|EFR11387.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 1221

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           G    PL+ +   VK+ +++++ +  TN    +  A  +L +  +SS + I      K +
Sbjct: 579 GYLLQPLTTDFQTVKNAIDRIDSWGGTNIAEGIRIANHQLIS--QSSDDRI------KVI 630

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK-CTDSSGQF 367
           I +TDGE      Y N L T       +N G+ IY++ +    + ++LLR   T + G +
Sbjct: 631 ILLTDGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVD-ENLLRNIATQTGGMY 680

Query: 368 FAVNDSRELLESFDKITDKIQE 389
           F V+ + +L + F +IT+ + E
Sbjct: 681 FPVSSASQLPQVFKRITEIVTE 702


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           G    PL+ +   VK+ +++++ +  TN    +  A ++L +   SS + I      K +
Sbjct: 545 GYLLQPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQQLIS--RSSEDRI------KVI 596

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK-CTDSSGQF 367
           I +TDGE      Y N L T       +N G+ IY++ +    + ++LLR   T + G +
Sbjct: 597 ILLTDGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVD-ENLLRDIATQTGGMY 646

Query: 368 FAVNDSRELLESFDKITDKIQE 389
           F V+ + +L + F +IT+ + E
Sbjct: 647 FPVSSASQLPQVFKRITEIVTE 668


>gi|315498201|ref|YP_004087005.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416213|gb|ADU12854.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 570

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 66/143 (46%), Gaps = 13/143 (9%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK---KFVIFI 311
           L+ ++  V++   KL P  NTN    +      L    E   NT      K   K++I I
Sbjct: 428 LTTDIAAVRAHAQKLTPAGNTNITIGVQWGMELL--SPELPFNTAKPYSDKTNYKYMIVI 485

Query: 312 TDGENSG--ASAYQNTLN--TLQICEYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQ 366
           TDGEN+    S   +T+N  TL  C+  ++ G+ +Y++ V    EG  D+L+ C      
Sbjct: 486 TDGENTQNRWSTSASTINARTLLACQAAKDLGITVYTIRVM---EGNSDMLKSCASRPEY 542

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           F+ V  S +L  +  K+   IQ 
Sbjct: 543 FYDVTASSQLTSTLAKVFYSIQS 565


>gi|225873423|ref|YP_002754882.1| hypothetical protein ACP_1808 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793805|gb|ACO33895.1| hypothetical protein ACP_1808 [Acidobacterium capsulatum ATCC
           51196]
          Length = 339

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 71/140 (50%), Gaps = 16/140 (11%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE-LYNEKESSHNTIGSTRLKKFVIFITDG 314
           SNNL+ + S +  L+P   T  Y A++ A R+ L N         G   +++ +I ++DG
Sbjct: 169 SNNLDTLSSAIQDLHPGGGTALYDAVYSACRDKLLNAAS------GPIYVRRAIILVSDG 222

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---GQDLLRK-CTDSSGQFFAV 370
           +++ + AY    + ++ C+  + A   IY+V+    P    G D+LRK   ++ G+ F  
Sbjct: 223 DDNQSHAYLT--DAIKECQRAQTA---IYAVSTDTDPTPDPGDDILRKMAEETGGRAFFP 277

Query: 371 NDSRELLESFDKITDKIQEQ 390
                L  SF+ + D+++ Q
Sbjct: 278 RVITNLPASFNSVEDELRSQ 297


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 7/127 (5%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVIFITD 313
           LS+N++  ++ +  L P   TN    +      L  N+  S     GST+ +KF+I +TD
Sbjct: 270 LSDNISSARNFIKTLQPGGYTNVTMGVQWGMEVLSPNQPFSDATEFGSTKARKFMIVVTD 329

Query: 314 GENSGA----SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           G+N+ +    SA      T   CE  +  G+ +Y+V +       ++LRKC  +   F+ 
Sbjct: 330 GDNTKSFTSWSASVIDKRTALACENAKAKGITVYTVKI--IQGNSNMLRKCASAPEYFYD 387

Query: 370 VNDSREL 376
           +  + +L
Sbjct: 388 LTSANQL 394


>gi|312622403|ref|YP_004024016.1| von willebrand factor type a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202870|gb|ADQ46197.1| von Willebrand factor type A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 1166

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 69/142 (48%), Gaps = 19/142 (13%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           G    PL+ +   VK+ +++++ +  TN    +  A ++L         ++ S    K +
Sbjct: 545 GYLLQPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQQLI--------SLSSEDRIKVI 596

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK-CTDSSGQF 367
           I +TDGE      Y N L T       +N G+ IY++ +    + ++LLR   T + G +
Sbjct: 597 ILLTDGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVD-ENLLRDIATQTGGMY 646

Query: 368 FAVNDSRELLESFDKITDKIQE 389
           F V+ + +L + F +IT+ + E
Sbjct: 647 FPVSSASQLPQVFKRITEIVTE 668


>gi|99081991|ref|YP_614145.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
 gi|99038271|gb|ABF64883.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
          Length = 582

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           TL ICE  +  G+ ++++   AP  GQ++L+ C  S+  ++ V D  E+ ++F  I   I
Sbjct: 517 TLDICEAAKAKGVVVFTIGFEAPSRGQEVLQACASSASHYYDV-DGLEISDAFASIASAI 575

Query: 388 QE 389
           ++
Sbjct: 576 RQ 577


>gi|118591415|ref|ZP_01548813.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
 gi|118436087|gb|EAV42730.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
          Length = 474

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 97/245 (39%), Gaps = 36/245 (14%)

Query: 161 EDLYLQKHNDNNNMTSNKYL-LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           ED+Y  ++ D   M  N Y+   PPPK  F+   + +        P     D L+++  +
Sbjct: 245 EDIYKVRYTD---MPYNYYVKTDPPPKDVFYGGGSNRCSGTSKMIPLTADRDTLLDAIAD 301

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY- 278
           L ++               G  A   G+V      +S N ++V    +K  PY+N +   
Sbjct: 302 LDDN---------------GGTAGQTGVVWG-WNSISPNYSDVWPLASKPEPYDNDDVLK 345

Query: 279 ------PAMHHAYRELYNEKESSH----NTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
                    ++ + E   E+E          G     + V      E S + +Y N  + 
Sbjct: 346 FAIIMTDGDNNRFYEFVKEREECDWVYSRRYGWQWTCEMVSVNQWQERSESESYNNNSSK 405

Query: 329 LQ--ICEYMRNAGMKIYSV--AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
            Q  +C+ M++ G+ I+ V    +    G   ++ C  S+G ++    S EL+ +F  I 
Sbjct: 406 AQRALCQAMKDEGISIFGVYFGTNDSSAGSKNMQSCA-STGNYYKATSSDELINAFANIA 464

Query: 385 DKIQE 389
            KIQ+
Sbjct: 465 KKIQQ 469


>gi|218528586|ref|YP_002419402.1| hypothetical protein Mchl_0543 [Methylobacterium chloromethanicum
           CM4]
 gi|218520889|gb|ACK81474.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 518

 Score = 45.1 bits (105), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 30/120 (25%)

Query: 300 GSTRLKKFVIFITDGENSGASA--------------YQNTLNTLQ--------------- 330
           G  + KKF++ +TDG+N  A +              +QN + T                 
Sbjct: 394 GEIKTKKFIVLMTDGQNQSAVSSSDNRSYYSGLGFIWQNRIGTTSNDNAVRTKAIDTRLT 453

Query: 331 -ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            +C+ +R A +++++V V        +L+ C  S   FF V +S  L   F  I D+I E
Sbjct: 454 LLCDNIRKARIQVFAVRVEVNDGDSAVLKACATSPNMFFDVKNSSGLPAVFRAIADQISE 513


>gi|89055932|ref|YP_511383.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
 gi|88865481|gb|ABD56358.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
          Length = 612

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 14/115 (12%)

Query: 279 PAMHHAYRELYNE--KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEY 334
           PA      + YN+  +  SHN IG         + +DG        Q+  +T  + IC+ 
Sbjct: 503 PADESEQWDFYNQLAENPSHNYIG---------WDSDGVRPDGVVGQSQADTNLMAICDV 553

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
              AG+ +Y++   AP  GQ ++  C      +F V + RE+ E+F  I   I +
Sbjct: 554 ANAAGIIVYAIGFEAPDRGQRVMEHCASVDANYFDV-EGREISEAFASIARSINQ 607


>gi|78776847|ref|YP_393162.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497387|gb|ABB43927.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 307

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 21/167 (12%)

Query: 231 KKNLSVRIGTIAY-NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
           +K LS  +G + Y +   + +  T   N + E+ S LN+    +NT    A+  + R   
Sbjct: 126 QKRLSDNVGIVLYGDFAFIASPITYEKNIIIEMLSYLNQGMAGQNTAIGEAIAMSLRAFK 185

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGE-NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
           + K  S          K V+ +TDGE NSG  + ++ L         +   +KIY++ + 
Sbjct: 186 HSKAKS----------KIVVLLTDGEHNSGDISPKDALVL------AKEENIKIYTIGMG 229

Query: 349 APPEGQD-LLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
              E  + LL+K  D S G+FF   +++EL E ++ I D+++   ++
Sbjct: 230 NRGEADEALLKKIADESGGEFFYATNAKELKEIYEHI-DELESSKIK 275


>gi|149909171|ref|ZP_01897828.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
 gi|149807695|gb|EDM67641.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
          Length = 402

 Score = 44.3 bits (103), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (45%), Gaps = 9/148 (6%)

Query: 254 PLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNE--KESSHNTIGSTRLKKFVIF 310
           PL+NNLN V   +  L+    +T +Y       R L ++  KE     + S+ L + +I 
Sbjct: 255 PLTNNLNRVIRYVESLDTSGGSTASYQGFIWGVRTLTDQWQKEWQVTPVQSSSLTQRLIL 314

Query: 311 ITDGENSGASAYQNTLNTLQICEYMR---NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQF 367
            TDG+++    Y N L +  +C+ ++   N  +      VSA    Q   ++C   +G  
Sbjct: 315 FTDGDDN-RRDYFNDLMSAGLCDVIQQDLNIQVSFIGFGVSADRIKQ--FKQCAGRNGSV 371

Query: 368 FAVNDSRELLESFDKITDKIQEQSVRIA 395
           F  N++ EL + F+   +   E  VRI 
Sbjct: 372 FDANNTAELADYFEDAININIETKVRIV 399


>gi|209884898|ref|YP_002288755.1| hypothetical protein OCAR_5764 [Oligotropha carboxidovorans OM5]
 gi|209873094|gb|ACI92890.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 600

 Score = 43.9 bits (102), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 78/158 (49%), Gaps = 18/158 (11%)

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL--YNEKESSHNTIGSTRLKKFVIF 310
           TP+SN    + S++N +NP  NTN    +   ++ L   N+   + +   +   + +++ 
Sbjct: 445 TPMSNQWATLNSKVNAMNPSGNTNQAIGLFWGWQTLNTANDPFKAPSKDPNWVYQDYIVI 504

Query: 311 ITDGENSGASAYQ-------NTLNTLQ--ICEYMRNAGMKIYSVAV---SAPPEGQDLLR 358
           ++DG N+    Y         T++  +  +C+ ++   + I+++ V   S  PE Q +L+
Sbjct: 505 LSDGLNTQNRWYTCPNAGPCPTIDGREKTLCDNIKADKITIFTIQVNINSKDPESQ-VLK 563

Query: 359 KCTDS-SGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            C  S SG F  +  + +   +FD + +KI +  +RIA
Sbjct: 564 DCASSGSGYFQLITSANDTATAFDNVLNKIAK--LRIA 599


>gi|87308177|ref|ZP_01090319.1| hypothetical protein DSM3645_21307 [Blastopirellula marina DSM
           3645]
 gi|87289259|gb|EAQ81151.1| hypothetical protein DSM3645_21307 [Blastopirellula marina DSM
           3645]
          Length = 1032

 Score = 43.5 bits (101), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 82/193 (42%), Gaps = 24/193 (12%)

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG-----NQCTPLS--NNLNEVKS 264
           ++++ +G++     +  Q     ++R    A   G++G      +  P+   +N     +
Sbjct: 461 LVLDKSGSMQGEKMQMTQGAALAAIRAMGAADFAGVIGFDSQAQRIVPIRKVDNPGMFVA 520

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
           ++ KL+    TN  P +   +R+L N               K +I ++DG+         
Sbjct: 521 QVRKLSASGGTNMTPGVALGFRDLQNVDAGV----------KHMIVLSDGQTEPG----- 565

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
             N  QI   M+  GM + +VAV +  + + +     +  G+F+AVN+ + +   F +  
Sbjct: 566 --NVAQIASDMKKMGMTVSAVAVGSDADQKLMATVARNGGGKFYAVNNPKAIPRIFMREA 623

Query: 385 DKIQEQSVRIAPN 397
            ++ +  V+ AP 
Sbjct: 624 RRVAQPLVKEAPG 636


>gi|126462813|ref|YP_001043927.1| hypothetical protein Rsph17029_2052 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104477|gb|ABN77155.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 566

 Score = 43.5 bits (101), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++A
Sbjct: 501 TRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYYA 542


>gi|221639828|ref|YP_002526090.1| hypothetical protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
 gi|221160609|gb|ACM01589.1| Hypothetical Protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
          Length = 566

 Score = 43.5 bits (101), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++A
Sbjct: 501 TRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYYA 542


>gi|254440702|ref|ZP_05054195.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
 gi|198250780|gb|EDY75095.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
          Length = 590

 Score = 43.5 bits (101), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           IC   R  G+ IY+VA  AP  GQ  L+ C  SS  +F V D  ++  +F  I   I+
Sbjct: 528 ICAAARAQGIVIYTVAFEAPSGGQTALQDCASSSSHYFDV-DGTDISGAFSAIASDIR 584


>gi|77463970|ref|YP_353474.1| hypothetical protein RSP_0399 [Rhodobacter sphaeroides 2.4.1]
 gi|77388388|gb|ABA79573.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 566

 Score = 43.5 bits (101), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++A
Sbjct: 501 TRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYYA 542


>gi|332558842|ref|ZP_08413164.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
 gi|332276554|gb|EGJ21869.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
          Length = 566

 Score = 43.1 bits (100), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++A
Sbjct: 501 TRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYYA 542


>gi|254459074|ref|ZP_05072497.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
 gi|207084345|gb|EDZ61634.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
          Length = 279

 Score = 43.1 bits (100), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 54/91 (59%), Gaps = 10/91 (10%)

Query: 306 KFVIFITDGE-NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK--CTD 362
           K ++ ++DGE NSG      +++  +  E  +  G+KIY++A+    E  + L +    D
Sbjct: 164 KVIVLLSDGEHNSG------SVSPKEATELAKEQGIKIYTIAMGNKGEADEALLETIAKD 217

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           S+G+FF+ + ++EL   +D+I DK++  +++
Sbjct: 218 SNGEFFSASSAKELKNIYDEI-DKLESSNIK 247


>gi|114705525|ref|ZP_01438428.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
 gi|114538371|gb|EAU41492.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
          Length = 461

 Score = 42.7 bits (99), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 16/101 (15%)

Query: 305 KKFVIFITDGEN---------------SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
           +K ++ +TDG N               SG    Q+  +T+ IC  ++ +G++I++V    
Sbjct: 356 RKALVLMTDGANTMVFNSSDGRHRNARSGTEVAQSDRDTISICNNIKRSGIEIFTVGFMV 415

Query: 350 -PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 DLL++C      +F      EL  +F +I D + +
Sbjct: 416 NSSSALDLLKECATDGEHYFDATSPEELHSAFGRIADGLTQ 456


>gi|90406741|ref|ZP_01214934.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
 gi|90312194|gb|EAS40286.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
          Length = 404

 Score = 42.7 bits (99), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 120/284 (42%), Gaps = 53/284 (18%)

Query: 119 FLKGLIPSALTN-----LSLRSTGIIERSSENLAISICMVLDVSRSMEDLY--------- 164
            LK L+P++  N     + ++ST  +   SE   + + +VLD+S SM             
Sbjct: 104 LLKDLLPASSQNKVHASVQIQSTSTLTVHSEIKPMDLSLVLDISGSMSGRIGLLKRIINQ 163

Query: 165 ----LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA--- 217
               +++ N  NN T  ++ + P      +S   + S    AP  A  K   L   A   
Sbjct: 164 AIQNIEQQNTKNN-TQIRFSIVP------FSSGVSISN---APWLAKSKGKALCVDAMSY 213

Query: 218 -GNLVNSIQKA-----------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
            GN++N+ Q             I+ K+ LS+      Y++ +      PL+NNL++V+  
Sbjct: 214 PGNVLNTAQTVADIDTHPSKLNIRAKEPLSLINDCNVYSLLL------PLTNNLSKVRKH 267

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI--GSTRLKKFVIFITDGENSGASAYQ 323
           ++ L+   +T +Y       R L    + + N     S+ L + +I  TDGE+     + 
Sbjct: 268 VDSLSILGSTASYQGFIWGVRTLLPNWQKAWNLQPETSSLLSQRLILFTDGEDDSRDQFD 327

Query: 324 NTLNTLQICEYMRN-AGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
             + +  +C+ +++   + I  +     P   D  +KC  S+G+
Sbjct: 328 KLVRS-GMCQRIQDDFNIDISFIGFGLSPRRLDQFKKCIGSNGK 370


>gi|86749514|ref|YP_486010.1| hypothetical protein RPB_2394 [Rhodopseudomonas palustris HaA2]
 gi|86572542|gb|ABD07099.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 25/159 (15%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF---VIFIT 312
           S+N   +K +++ L+P   TN    MH A+  L  +  +  NT       K+   +I ++
Sbjct: 303 SSNATTIKDKIDALSPNGGTNQPIGMHWAWMSL--QDGAPLNTPAKDADYKYTDAIILLS 360

Query: 313 DGENS------GASAYQNTLNTLQ--ICEYMRNAGMK------IYSVAVS--APPEGQDL 356
           DG N+        S++   ++  Q  +C+ +R A         IY++ V+    PE  ++
Sbjct: 361 DGMNTIDRWYGNGSSWSKDVDARQKLLCDNIRAASAASTTKTVIYTIQVNTDGDPE-SEV 419

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           L+ C D SG FFA   +  +  +F +I   + +  +RIA
Sbjct: 420 LKYCAD-SGNFFATTTASGISTAFAQIGASLSK--LRIA 455


>gi|86137906|ref|ZP_01056482.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
 gi|85825498|gb|EAQ45697.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
          Length = 543

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           T  +CE  +  G+ +Y++   AP  G  +LR C  S   +F V D  E+ ++F  I   I
Sbjct: 478 TRSVCEAAKAKGIVVYTIGFEAPSNGVAVLRDCASSDAHYFDV-DGLEIKDAFASIATSI 536

Query: 388 QE 389
           ++
Sbjct: 537 RQ 538


>gi|284166763|ref|YP_003405042.1| von Willebrand factor A [Haloterrigena turkmenica DSM 5511]
 gi|284016418|gb|ADB62369.1| von Willebrand factor type A [Haloterrigena turkmenica DSM 5511]
          Length = 853

 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 81/189 (42%), Gaps = 27/189 (14%)

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
           P P N   +  +E+  N+++ +  +         R+G   Y+    G    PLS++L   
Sbjct: 650 PHPGNDPTNQRVEATRNVIDELDPSAD-------RVG--VYDFASSGRALHPLSDDLESA 700

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           K  +     Y  TN    +  A  +        + T G+   ++ VI ++DG+NS  +  
Sbjct: 701 KESVVG-TAYGGTNMAAGLEAALND--------YATRGTDDRERIVILLSDGKNSNTA-- 749

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAP-----PEGQDLLRKCTDSSGQFFAVNDSRELL 377
            N     ++ +   +    +++V + A      PE + L    T++ G ++   D  ELL
Sbjct: 750 -NDERMDELADRSDDLDYTLHTVGLDALEHDSIPEDK-LEGWATETGGNYYQTADPDELL 807

Query: 378 ESFDKITDK 386
           + F++I D+
Sbjct: 808 DLFEEIVDE 816


>gi|148256121|ref|YP_001240706.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
 gi|146408294|gb|ABQ36800.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
          Length = 602

 Score = 41.6 bits (96), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 97/224 (43%), Gaps = 39/224 (17%)

Query: 195 TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP 254
           T+   A A +PA+  +  L  +  ++ N++Q       + S ++G           Q  P
Sbjct: 394 TQPNDANAVSPASSDVATLFPANQHMENNVQYC---SSSASTKLG-----------QIVP 439

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVIFITD 313
           LS N   +KS +N + P   TN    M  A + L  N    +     +T   + +I ++D
Sbjct: 440 LSYNWTSLKSAVNAMEPTGGTNQAIGMAWAVQSLIPNGVLGAPAEDANTTYNRVIILLSD 499

Query: 314 GENS-------GASAYQNTLNTLQ-----ICEYMR-------NAGMKIYSVAV--SAPPE 352
           G N+       G  + Q + N +      +C  ++       NA   IY++ V  S+P +
Sbjct: 500 GLNTEDRWPDYGNGSTQASGNPIDARQALLCSNLKNTKDSKGNAMYTIYTIQVNTSSPAD 559

Query: 353 -GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
               +L+ C  S  +F+ +  S +++ +F+ I   + +  +R+A
Sbjct: 560 PTSTVLQNCASSPDKFYMLTSSSQIVTTFNSIGTALSK--LRVA 601


>gi|110679843|ref|YP_682850.1| hypothetical protein RD1_2614 [Roseobacter denitrificans OCh 114]
 gi|109455959|gb|ABG32164.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 488

 Score = 41.2 bits (95), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 28/118 (23%)

Query: 299 IGSTRLKKFVIFITDGE---------------------------NSGASAYQNTLNTLQI 331
            G+T  +KF++ +TDG+                           ++ A+   N  N   I
Sbjct: 367 FGTTDTRKFIVLMTDGQITDQFRPEDKNDPKNDEIALNQRIGDRDTYATQSTNVANFYSI 426

Query: 332 CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           C   + AG+ +Y++A  AP      +R C  S   F+ V +  E+  +F  I  +I E
Sbjct: 427 CNKAKAAGITVYTIAFEAPANAITQMRTCATSPAFFYKV-EGVEIKTAFKSIARQINE 483


>gi|254460794|ref|ZP_05074210.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677383|gb|EDZ41870.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 480

 Score = 41.2 bits (95), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           IC   ++AG+ I+S+       G D++  C  S   FF V +  E+ E+FD I  +I +
Sbjct: 418 ICNASKDAGIVIWSIGFEVDDHGADVMANCASSPSHFFRV-EGIEISEAFDAIARQINQ 475


>gi|299139026|ref|ZP_07032203.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298599180|gb|EFI55341.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 318

 Score = 41.2 bits (95), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 72/151 (47%), Gaps = 24/151 (15%)

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
           ++    ++++ ++ S L +++  + T  Y A++ A + L         T  S   ++ ++
Sbjct: 137 DELVSFTSDVQKIDSGLGRIHHGDATALYDAVYLASQRL-------GETPTSAGQRRVLV 189

Query: 310 FITDGEN-SGASAYQNTLNTLQICEYMRNAGMKIYS---VAVSAPPEGQD------LLRK 359
            ITDGEN +   +Y   L   Q       AG  IY+   V VSA   G++      L++ 
Sbjct: 190 LITDGENTTHHGSYDAALEQAQ------RAGAMIYALIIVPVSADA-GRNTGGEHALIQL 242

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
             D+ G+++ V D  +L  +F  ++D ++ Q
Sbjct: 243 ARDTGGKYYYVEDKHDLAPAFQHVSDDLRTQ 273


>gi|254466920|ref|ZP_05080331.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687828|gb|EDZ48310.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 550

 Score = 41.2 bits (95), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           +T  IC+  ++ G+ +YSV   AP  G  +L  C  S   FF V +  E+ ++F  I   
Sbjct: 484 HTKTICDITKDQGVIVYSVGFEAPSAGIKVLEDCASSPAHFFDV-EGLEISDAFSSIATS 542

Query: 387 IQE 389
           I++
Sbjct: 543 IRQ 545


>gi|126730251|ref|ZP_01746062.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
 gi|126708984|gb|EBA08039.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
          Length = 614

 Score = 40.8 bits (94), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
           A Q   N   IC   +   + I+++ V AP  G + +R C  S+  ++ V+ S +L+++F
Sbjct: 542 ASQANTNLATICAKAKQQDVTIFTIGVEAPQAGLNAMRNCASSASHYYNVS-SNQLVDTF 600

Query: 381 DKITDKIQE 389
             I+D + E
Sbjct: 601 RSISDVVVE 609


>gi|260576512|ref|ZP_05844501.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021235|gb|EEW24542.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 529

 Score = 40.8 bits (94), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
           T+P +   +   Y  K+     +G +    F  F TD  + G    Q  +   QIC+  +
Sbjct: 418 TWPEVWAKWSVRYVAKDIYTKALGGSENSWFETF-TDEISYG----QKDVRLQQICDAAK 472

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF 368
           ++G+ I+S+   AP  G++ LR C      +F
Sbjct: 473 DSGIVIFSIGFEAPENGRNQLRDCASQPSNYF 504


>gi|116623283|ref|YP_825439.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226445|gb|ABJ85154.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 299

 Score = 40.0 bits (92), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 14/142 (9%)

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTY---PAMHHAYRELYNEKESSHNTIGSTRL-KKFVI 309
           PL+N+L ++   L    PY +T T+    A       LY+   ++   +   R  +K +I
Sbjct: 127 PLTNSLRQLSDSL----PYVDTPTFNQLRAQSGGGTLLYDAVVTASQEVMLNRTGRKALI 182

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-LLRKCTDSSGQFF 368
            +TDGE+ G+ A     +     E  + A   IYS+  +   +G+  L R   ++ G FF
Sbjct: 183 LLTDGEDYGSDA-----SVGDAIEAAQRADTLIYSILFADQGDGRRPLQRMSKETGGSFF 237

Query: 369 AVNDSRELLESFDKITDKIQEQ 390
            V+  +++ + F  I ++++ Q
Sbjct: 238 EVSKKQDIDQIFTAIQEELRSQ 259


>gi|56696619|ref|YP_166980.1| hypothetical protein SPO1742 [Ruegeria pomeroyi DSS-3]
 gi|56678356|gb|AAV95022.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 558

 Score = 40.0 bits (92), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           T  +C+  ++ G+ +Y+V   AP  G+ +L++C  S   ++   D  E+ ++F  I   I
Sbjct: 493 TDHVCDAAKDEGIIVYTVGFEAPYSGRRVLKRCASSDSHYYDA-DGLEISDAFTSIASSI 551

Query: 388 QE 389
           ++
Sbjct: 552 RK 553


>gi|294678572|ref|YP_003579187.1| hypothetical protein RCAP_rcc03056 [Rhodobacter capsulatus SB 1003]
 gi|294477392|gb|ADE86780.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 647

 Score = 40.0 bits (92), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 17/121 (14%)

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG------ASAYQNT----LNT 328
           P    +Y  LY  K  + NT+     K +      G ++G      A+A  +T      T
Sbjct: 529 PLYDVSYDHLYKTKNWNLNTVAGLLGKPY------GRSAGTQYELMANAVYDTSVKDART 582

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            ++C+  ++ G+ I+SVA  AP  G+ LL+ C+  +  ++ V  S  L  +F  I   I 
Sbjct: 583 KKLCDLAKSKGIYIFSVAADAPSGGKTLLKYCSSGTSYYYEVQGS-NLSTAFASIAASIS 641

Query: 389 E 389
            
Sbjct: 642 S 642


>gi|126730249|ref|ZP_01746060.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
 gi|126708982|gb|EBA08037.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
          Length = 666

 Score = 39.7 bits (91), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 324 NTLNTLQI-CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           N L+ L   C+  R+ G+ +++VA        D LR C  S   FF V  + E++++FD 
Sbjct: 596 NNLDNLHTQCQLARDLGVTVFAVAFETTDADADELRLCASSDSHFFHVQGT-EIIDAFDT 654

Query: 383 ITDKI 387
           I  +I
Sbjct: 655 IARQI 659


>gi|254292617|ref|YP_003058640.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
 gi|254041148|gb|ACT57943.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
          Length = 514

 Score = 39.7 bits (91), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 76/182 (41%), Gaps = 58/182 (31%)

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG-----------STRLKKFVI 309
           ++  +LN+LNP  NT+    +   YR +++++ + +N  G           ST+ +K +I
Sbjct: 329 QIIKKLNQLNPSGNTHADIGLMWGYR-MFSQQANWNNFFGYNSDTKPDSFHSTKSRKIMI 387

Query: 310 FITDGENS-----GASAY----------------------------------QNTLNTLQ 330
            +TDGEN+     G S Y                                   N LN+L 
Sbjct: 388 MLTDGENTATNSEGYSYYGWCTYTNHYNKWGRYTGSTKDCEVPKGINKDEISNNDLNSLM 447

Query: 331 I--CEYMRNAGMKIYSVAVSA----PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +  CE +R+  ++++++A+            LLR+C  S    + +    EL E+F ++ 
Sbjct: 448 LDACEVIRSKDVELFTIALDLHSYYDSTAIALLRECAGSDSHAYNIK-GNELDETFQELA 506

Query: 385 DK 386
            K
Sbjct: 507 SK 508


>gi|323135758|ref|ZP_08070841.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
 gi|322398849|gb|EFY01368.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
          Length = 588

 Score = 39.7 bits (91), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAP-----PEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           TLQ C   +NAG++++++  S        +G +LL+ C  +   +FAV ++ +L  +F  
Sbjct: 517 TLQACTNAKNAGVEVFTIGFSTSTDPIDAQGLELLKSCATNVDHYFAVENANQLNAAFSS 576

Query: 383 I 383
           I
Sbjct: 577 I 577


>gi|332982109|ref|YP_004463550.1| von Willebrand factor type A [Mahella australiensis 50-1 BON]
 gi|332699787|gb|AEE96728.1| von Willebrand factor type A [Mahella australiensis 50-1 BON]
          Length = 948

 Score = 39.7 bits (91), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 17/113 (15%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           +++L E++  +  + P   TN YPA+  AY+ L             T+LK  +I +TDG+
Sbjct: 465 ADDLAEIQDSIGTIRPGGGTNMYPALDLAYKALEE---------ADTKLKH-IIVLTDGQ 514

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF 368
           ++       T +   I   M   G+ + SVAV    +   L R     +G+++
Sbjct: 515 SA-------TGDFDGIAHRMAEDGITLSSVAVGMDADKNLLSRLAEIGNGRYY 560


>gi|303240108|ref|ZP_07326629.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302592377|gb|EFL62104.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 323

 Score = 39.3 bits (90), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 33/114 (28%)

Query: 298 TIGSTRLKK------FVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           ++G  RLKK       +I +TDG+N+  S   NT +TL      +++G+KIY++ V +  
Sbjct: 169 SVGLNRLKKSTSPSKIMILLTDGDNNAGSIDPNTASTLA-----KDSGIKIYTIGVGSDK 223

Query: 352 E--------GQ-------------DLLRKCTDSS-GQFFAVNDSRELLESFDKI 383
                    GQ             DLL+K  +++ GQ++   DS  L + F  I
Sbjct: 224 TIIPGTNEFGQTVYQEYESGLLNEDLLKKIAETTNGQYYRAKDSNALSQVFANI 277


>gi|254486311|ref|ZP_05099516.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043180|gb|EEB83818.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 476

 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 327 NTLQ--ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           NTL   IC   ++ G+ I+++       G D+++KC  S   FF V +  EL ++F  I 
Sbjct: 408 NTLMDNICSAAKDEGIVIWTIGFEVNDTGADVMKKCASSPSHFFRV-EGVELTDAFSAIA 466

Query: 385 DKIQE 389
            +I +
Sbjct: 467 SQINQ 471


>gi|328541712|ref|YP_004301821.1| hypothetical protein SL003B_0088 [polymorphum gilvum SL003B-26A1]
 gi|326411464|gb|ADZ68527.1| hypothetical protein SL003B_0088 [Polymorphum gilvum SL003B-26A1]
          Length = 454

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 317 SGASAYQNTLNTLQ--ICEYMRNAGMKIYSV--AVSAPPEGQDLLRKCTDSSGQ-FFAVN 371
           S A+ Y N  +T    +C  ++  G+++YS+    +A   G  +++ C  S+ + FF   
Sbjct: 372 SEAAGYSNVSSTRAKTLCAAIKQTGIQVYSIYFGSNANSAGAKVMKDCASSTKETFFMAT 431

Query: 372 DSRELLESFDKITDKIQ 388
              EL+ +F KI +KIQ
Sbjct: 432 SDSELIAAFAKIANKIQ 448


>gi|328953621|ref|YP_004370955.1| hypothetical protein Desac_1940 [Desulfobacca acetoxidans DSM
          11109]
 gi|328453945|gb|AEB09774.1| hypothetical protein Desac_1940 [Desulfobacca acetoxidans DSM
          11109]
          Length = 376

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 1  MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSG 40
          +TA+++ V   F   AID+ ++  I+ +MQSA+DAAV  G
Sbjct: 16 ITALLLPVLIGFTGLAIDIGNLYVIKTRMQSAVDAAVCGG 55


>gi|312133821|ref|YP_004001160.1| von willebrand factor (vwf) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773110|gb|ADQ02598.1| Von Willebrand factor (VWF) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
          Length = 794

 Score = 38.9 bits (89), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 131

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 132 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 177

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 178 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 230

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 231 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 277


>gi|23466092|ref|NP_696695.1| hypothetical protein BL1539 [Bifidobacterium longum NCC2705]
 gi|322691915|ref|YP_004221485.1| cell surface protein [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|23326823|gb|AAN25331.1| hypothetical protein with gram positive cell wall anchoring domain
           [Bifidobacterium longum NCC2705]
 gi|320456771|dbj|BAJ67393.1| putative cell surface protein [Bifidobacterium longum subsp. longum
           JCM 1217]
          Length = 794

 Score = 38.9 bits (89), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 131

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 132 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 177

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 178 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 230

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 231 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 277


>gi|239620965|ref|ZP_04663996.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239516066|gb|EEQ55933.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 816

 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 98  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 153

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 154 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 199

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 200 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 252

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 253 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 299


>gi|46190503|ref|ZP_00121395.2| COG2304: Uncharacterized protein containing a von Willebrand factor
           type A (vWA) domain [Bifidobacterium longum DJO10A]
 gi|189440499|ref|YP_001955580.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
 gi|189428934|gb|ACD99082.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
          Length = 794

 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 131

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 132 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 177

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 178 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 230

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 231 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 277


>gi|322689979|ref|YP_004209713.1| cell surface protein [Bifidobacterium longum subsp. infantis 157F]
 gi|320461315|dbj|BAJ71935.1| putative cell surface protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 794

 Score = 38.9 bits (89), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 131

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 132 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 177

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 178 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 230

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 231 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 277


>gi|290769676|gb|ADD61455.1| putative protein [uncultured organism]
          Length = 816

 Score = 38.9 bits (89), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G    AL     +S G  E  + N  + I +VLDVS SM +      N    + S K   
Sbjct: 98  GTYTVALNVTGAKSAGTGEIVT-NQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLK--- 153

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRI 238
                       T  +K+  A A  N KI    +S  N +  ++ A  EK ++     R 
Sbjct: 154 ------------TAVNKFINATAAENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYRE 199

Query: 239 GTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           G  +YN   IV N    L+ +++ + S +N L+    T+   A + A   L  +  +   
Sbjct: 200 GWSSYNYTQIVSN----LTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--- 252

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
                  KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V
Sbjct: 253 -----NAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 299


>gi|254450361|ref|ZP_05063798.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|254450938|ref|ZP_05064375.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198264767|gb|EDY89037.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198265344|gb|EDY89614.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 75

 Score = 38.5 bits (88), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           IC   R  G+ IY+VA  AP  GQ  L+ C  S    F VN + ++  +F  I   I+
Sbjct: 13  ICAAARAQGVVIYTVAFEAPSGGQSALQDCASSPSHHFDVNGT-DISSAFSAIASDIR 69


>gi|126738776|ref|ZP_01754472.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
 gi|126719957|gb|EBA16664.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
          Length = 530

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 57/119 (47%), Gaps = 12/119 (10%)

Query: 272 YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV-IFITDGENSGASAYQNTLNTLQ 330
           Y +   Y ++ + Y+ +Y +   S+    S R + +  ++   G ++     +NT  T  
Sbjct: 418 YPDLFAYTSLKYLYKYIYADWMGSY----SARSEWYYGVYDYHGNST-----KNT-RTSN 467

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +C   +  G+ +Y++   AP  G  +L+ C  S   +F V D  E+ ++F+ I   I++
Sbjct: 468 VCSAAKAQGIIVYTIGFEAPSNGVAVLQDCASSDSHYFDV-DGLEIRDAFESIATSIRK 525


>gi|163742980|ref|ZP_02150363.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
 gi|161383663|gb|EDQ08049.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
          Length = 560

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 318 GASAYQNT----LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           G   Y NT      T  +C   +N G+ +Y++   AP  G  +L+ C  S    F V   
Sbjct: 481 GVYDYWNTSTKDARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVR-G 539

Query: 374 RELLESFDKITDKIQE 389
            E+ ++F  I   I++
Sbjct: 540 LEIRDAFASIATSIRQ 555


>gi|163738634|ref|ZP_02146048.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
 gi|161387962|gb|EDQ12317.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
          Length = 558

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 318 GASAYQNT----LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           G   Y NT      T  +C   +N G+ +Y++   AP  G  +L+ C  S    F V   
Sbjct: 479 GVYDYWNTSTKDARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVR-G 537

Query: 374 RELLESFDKITDKIQE 389
            E+ ++F  I   I++
Sbjct: 538 LEIRDAFASIATSIRQ 553


>gi|303238997|ref|ZP_07325527.1| ATPase, P-type (transporting), HAD superfamily, subfamily IC
           [Acetivibrio cellulolyticus CD2]
 gi|302593335|gb|EFL63053.1| ATPase, P-type (transporting), HAD superfamily, subfamily IC
           [Acetivibrio cellulolyticus CD2]
          Length = 905

 Score = 38.1 bits (87), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 12  FITYAIDLA-HIMYIRNQMQSALDAAVLSGCASIV-SDRTIKDPTTKKDQTSTIFKKQIK 69
            +T A+ L    M  RN +   L A    GCAS++ SD+T          T T  K  ++
Sbjct: 287 IVTIALALGVQKMLKRNSLVRKLPAVETLGCASVICSDKT---------GTLTENKMTVR 337

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQ 102
           K    GS +  N G ++ + +  IT  K +PLQ
Sbjct: 338 KVYTGGSVVEINGGSLSSEGEFTITGKKADPLQ 370


>gi|315499132|ref|YP_004087936.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315417144|gb|ADU13785.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 519

 Score = 38.1 bits (87), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVIFITD 313
           L+++   V + L+ L+P  NTN    +      L   E  +     G T +KK++I +TD
Sbjct: 377 LTSDFTSVNTYLSSLSPGGNTNITLGVQFGMEMLSPAEPYTKATAFGDTDVKKYMIIVTD 436

Query: 314 GENSG--ASAYQNTLN--TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           G N+    S   + +N  T   C   +  G+ ++ V V        LL  C   S  ++ 
Sbjct: 437 GANTQNRWSTSNSAINARTALACTAAKAQGITLFVVRV--EDGDSSLLEACASQSSYYYD 494

Query: 370 VNDSRELLESFDKI 383
           ++ + +L ++   I
Sbjct: 495 LSQASDLTKTMQDI 508


>gi|306821351|ref|ZP_07454960.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550638|gb|EFM38620.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 467

 Score = 38.1 bits (87), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 14/132 (10%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
            ++N  ++   ++K+     TN   A+  AY +L+N  +++       +  KF+I +TDG
Sbjct: 80  FTSNKEKLHDAVDKIRSDGGTNIGRAVSIAY-DLFNNLDNNR----KEKYPKFLILLTDG 134

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           +   +  Y             + AG+KIY++ +      + L      + G++F   D+ 
Sbjct: 135 DGDYSEEY---------TILAKKAGIKIYTIGLGNGVSEKLLKDIAKGTDGEYFHAKDAS 185

Query: 375 ELLESFDKITDK 386
           +L + F+KI DK
Sbjct: 186 KLNKIFEKIADK 197


>gi|281333774|gb|ADA61127.1| capsid protein [Hepatitis E virus]
          Length = 671

 Score = 37.7 bits (86), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 45/113 (39%), Gaps = 20/113 (17%)

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
           Y+LPP  K SFW   TTK+ Y     P N           N   S Q  I+      V I
Sbjct: 548 YVLPPRGKLSFWEAGTTKAGY-----PYNY----------NTTASDQTLIENAAGHRVCI 592

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
            T   N+G       P+S +   V +  + L   E+T  YPA  H + +   E
Sbjct: 593 STYTTNLG-----SGPVSISAVGVLAPHSALAALEDTADYPARAHTFDDFCPE 640


>gi|260778153|ref|ZP_05887046.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606166|gb|EEX32451.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 397

 Score = 37.7 bits (86), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--NEKESSHNTIGSTRLKKFVIF 310
            PL++N++EVK+ +N L     T +Y  +    R+L     +E  +N   S   K+ +I 
Sbjct: 247 VPLTDNMSEVKTAINALTTTGGTRSYQGVIWGARQLIPRWRQEWGYNPY-SLAPKQKLIL 305

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNA-GMKIYSVAVSAPPEGQDLLRKCTDSS----- 364
           +TDG +SG     + L    +C+ + N   +++  +  +         + C +++     
Sbjct: 306 MTDGVDSG--YVLDDLIDAGLCDRLANEFAIELNFIGFNVQDSRLAQFQSCINAANTDGI 363

Query: 365 -GQFFAVNDSRELLESFDKI 383
            GQ F+  ++ +L E F KI
Sbjct: 364 KGQVFSATNTEKLDEYFSKI 383


>gi|225377140|ref|ZP_03754361.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
 gi|225211045|gb|EEG93399.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
          Length = 1406

 Score = 37.7 bits (86), Expect = 3.3,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 12/132 (9%)

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           N NE+   +N L     T+    + HAY EL   ++ +         KK+VI  +DGE S
Sbjct: 875 NKNEMLKSVNALFADGGTSPQKGLEHAYSELQKAEDGN---------KKYVILFSDGEPS 925

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL 377
            ++   + + T      ++ AG  + +V +    E    L +   S+G  F  + + EL 
Sbjct: 926 DSN---DKMETEASAVKLKEAGYTVITVGLGLNNETATWLGEKVASAGCAFTADTAEELN 982

Query: 378 ESFDKITDKIQE 389
           + F  I   I +
Sbjct: 983 KIFQNIQSTITQ 994


>gi|317483048|ref|ZP_07942050.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915549|gb|EFV36969.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 813

 Score = 37.4 bits (85), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 89/209 (42%), Gaps = 38/209 (18%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
           N  + I +VLDVS SM D                  L   PKK   +  T  + +  A A
Sbjct: 120 NQPLDIVLVLDVSGSMADN-----------------LSGGPKK-IDALKTAVNGFIDATA 161

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRIGTIAYN-IGIVGNQCTPLSNNLN 260
             N KI    +S  N +  ++ A  EK ++     R G  +YN   IV N    L+ +++
Sbjct: 162 DENAKI--TDQSQRNRIALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSN----LTYDVS 215

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
            + S +N L+    T+   A + A   L  +  +          KK VIF TDGE +  S
Sbjct: 216 GLTSTVNGLSASGATSADYAFNRAQAALTYQPRA--------NAKKVVIFFTDGEPNHGS 267

Query: 321 AYQNTLNTLQI--CEYMRNAGMKIYSVAV 347
            +  T+    +   + +++AG  IYS+ V
Sbjct: 268 GFDPTVAATAVNKAKSLKDAGTTIYSIGV 296


>gi|121534326|ref|ZP_01666150.1| signal transduction histidine kinase regulating citrate/malate
           metabolism [Thermosinus carboxydivorans Nor1]
 gi|121307096|gb|EAX48014.1| signal transduction histidine kinase regulating citrate/malate
           metabolism [Thermosinus carboxydivorans Nor1]
          Length = 544

 Score = 37.4 bits (85), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
           + P  AP  R++  ++   G L+NS+Q+A+Q+ KNL      +   IG++G      S  
Sbjct: 140 FTPVFAPDGRQVGAVV--VGILLNSVQQAVQQSKNLVYIATALGLAIGVIGAMLLARS-- 195

Query: 259 LNEVKSRLNKLNP 271
              +K  L  L P
Sbjct: 196 ---IKKTLFGLEP 205


>gi|262196446|ref|YP_003267655.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
 gi|262079793|gb|ACY15762.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
          Length = 903

 Score = 37.4 bits (85), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 20/144 (13%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           ++N   + + + +L     TN YPA+  AY  L           G+    K VI ++DG+
Sbjct: 513 ASNRMRIATDIARLQAGGGTNIYPALREAYEILQ----------GANAKVKHVIVLSDGQ 562

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSR 374
               + Y    +   +C+ MR+A + + +V +      ++LL   TD   G+ +  +D  
Sbjct: 563 ----APYDGIAD---LCQEMRSARITVSAVGIG--DADRNLLNLITDNGDGRLYMTDDLA 613

Query: 375 ELLESFDKITDKIQEQSVRIAPNR 398
            L   F K T + Q  ++  +P R
Sbjct: 614 ALPRIFMKETTEAQRSALVESPVR 637


>gi|307943467|ref|ZP_07658811.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773097|gb|EFO32314.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 466

 Score = 37.4 bits (85), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 330 QICEYMRNAGMKIYSV--AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           ++C+ M++  ++I++V         G DL+  C   S  ++  ++S EL+++F  I ++I
Sbjct: 400 KLCDEMKSKNIEIFTVYFDTGGATFGDDLMSYCASGSRNYYRADNSNELIQAFSNIANEI 459

Query: 388 QEQSVRIA 395
             QS+ IA
Sbjct: 460 --QSIYIA 465


>gi|162449863|ref|YP_001612230.1| hypothetical protein sce1592 [Sorangium cellulosum 'So ce 56']
 gi|161160445|emb|CAN91750.1| hypothetical protein sce1592 [Sorangium cellulosum 'So ce 56']
          Length = 368

 Score = 37.4 bits (85), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 77/188 (40%), Gaps = 21/188 (11%)

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
           D L+++A +  + + K        S ++G  A++  +  +   P +     V+  L  L 
Sbjct: 112 DALVDAAQSFSDRVGK--------SQKVGVYAFDGEVKIHSVVPFTEAQGSVQGGLEGLR 163

Query: 271 PYE----NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
            Y+    +TN +  +    REL  + +     +   +    V+F    + +   + ++ L
Sbjct: 164 SYKPKDTSTNLHGGVVEGIRELKKQLDKDRRPL---KFGTLVVFSDGTDRANRVSREDML 220

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           N L+  EY      +I+ V V A  E   L     D  G   A  D  ++ ESFDKI  K
Sbjct: 221 NELKKEEYEN---YQIFVVGVGAEIEKARLDEIGRD--GTELAA-DQAKVKESFDKIAAK 274

Query: 387 IQEQSVRI 394
           I+    R 
Sbjct: 275 IEAHMKRF 282


>gi|329848392|ref|ZP_08263420.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328843455|gb|EGF93024.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 434

 Score = 37.4 bits (85), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 90/378 (23%), Positives = 159/378 (42%), Gaps = 73/378 (19%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPT-------T 55
            + + V FL I  A+D + +M ++ ++Q A D A +   A  V+    K  T       T
Sbjct: 21  GLALPVVFLAIGGAVDFSRVMQLKKELQDAADVASVGSVA--VNSYAYKANTKGHSSFKT 78

Query: 56  KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
            ++Q   IF   +KKH         +  +I  KA+I   K   N +  I  + A Y  P 
Sbjct: 79  GENQALAIFNSNVKKH--------NDLNNIKVKAKIK--KQSTNLVSEIGVT-ADYR-P- 125

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
              +L GL+      ++++ST     S+    I   ++LD S SM      K  D + M 
Sbjct: 126 ---YLLGLMGMNTMPITIKST---SSSTFPPYIDFYLLLDNSPSMGVGATTK--DIDTMV 177

Query: 176 SNKYLLPPPPKKSFWSKNTTKSK---YAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEK 231
           +N        K +F      K+    YA A       +IDV+ ++  NL+ + +      
Sbjct: 178 ANT-----SDKCAFACHQMDKAGNDYYALAKKLKVTTRIDVVRQATQNLMTTAK----NT 228

Query: 232 KNLSVRIGTIAYNIGIVGNQ----------CTPLSNNLNEVKSRLNKLN----PYENTNT 277
           + L+ +     Y+ G+  +Q           + L+ NL+   S   K++    PY+N N+
Sbjct: 229 QTLTDQYRMAIYHFGMAADQIDSKNPAPYEVSALTTNLSTSASNAAKIDLMTIPYQNYNS 288

Query: 278 -----YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS-AYQNTLNTLQI 331
                +P+      ++     SS +   S++ ++ + F++DG N G   AY N  +  +I
Sbjct: 289 DRQTNFPSYLLGMNKVI---PSSGDGSSSSKPQQVLFFVSDGANDGYDCAYSNGASCRRI 345

Query: 332 -------CEYMRNAGMKI 342
                  C+ M+  G+KI
Sbjct: 346 SPLDTPQCKAMKARGVKI 363


>gi|156843858|ref|XP_001644994.1| hypothetical protein Kpol_1072p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115649|gb|EDO17136.1| hypothetical protein Kpol_1072p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 416

 Score = 37.0 bits (84), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 76/200 (38%), Gaps = 63/200 (31%)

Query: 50  IKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA 109
           I+DP T KD+T+ +FKK          Y+RE A    +  QI+I                
Sbjct: 37  IQDPNTTKDKTTQLFKK----------YLRETA----KANQISI---------------- 66

Query: 110 QYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICMVLDVSRSM--E 161
             E P  N  L GLIP A  N S R    I+R  E      N +I    +  V  S+  +
Sbjct: 67  --ENPDLNRILDGLIPKAENNASRRDKSSIQRVKEIYNNIKNKSIQDDEIYQVISSVVKK 124

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
           DLY               +LP        SKNT   K      P +  + + + S G L 
Sbjct: 125 DLY-------------NIILP--------SKNTQSKKDHIKTKPKSADLKIHMSSHGKLN 163

Query: 222 NSIQ--KAIQEKKNLSVRIG 239
           N I   K  Q+   LS  IG
Sbjct: 164 NIIDELKINQDGSGLSKNIG 183


>gi|90019771|ref|YP_525598.1| inter-alpha-trypsin inhibitor domain-containing protein
           [Saccharophagus degradans 2-40]
 gi|89949371|gb|ABD79386.1| von Willebrand factor, type A [Saccharophagus degradans 2-40]
          Length = 763

 Score = 37.0 bits (84), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 89/193 (46%), Gaps = 19/193 (9%)

Query: 207 NRKIDVLIESAGNLVN-SIQKAIQEKK------NLSVRIGTIAYNIGIVGNQCTPLS--- 256
           +R I  +++++G++   SIQ+A +  +      N S     I ++      +  P+S   
Sbjct: 385 SRDIVFVVDTSGSMQGTSIQQAKRSLQFALRGLNPSDTFNIIEFDTSFSRFRSRPVSATA 444

Query: 257 NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN-EKESSHNTIGSTRLKKFVIFITDGE 315
           +N+    S +N LN    T  Y A+  A+ +L +     + N+  S  L++ V+FITD  
Sbjct: 445 SNVQAAVSWVNNLNADNGTEMYAALEEAFDQLASINPNGTENSKSSNNLQQ-VVFITD-- 501

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
             GA   +  L +L I   + NA  ++++VA+ + P    + +      G    + D+ E
Sbjct: 502 --GAVGNEQALLSL-IHRRLNNA--RLFTVAIGSAPNSYFMRKAAQFGKGANVFIGDTAE 556

Query: 376 LLESFDKITDKIQ 388
           +    + +  K++
Sbjct: 557 VTHKMNALLSKLK 569


>gi|77735935|ref|NP_001029664.1| complement C2 precursor [Bos taurus]
 gi|115311857|sp|Q3SYW2|CO2_BOVIN RecName: Full=Complement C2; AltName: Full=C3/C5 convertase;
           Contains: RecName: Full=Complement C2b fragment;
           Contains: RecName: Full=Complement C2a fragment; Flags:
           Precursor
 gi|74267667|gb|AAI03358.1| Complement component 2 [Bos taurus]
          Length = 750

 Score = 37.0 bits (84), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
            ++  +SA  +V+ I      +  +SV I T A    I+ +     S ++ EV++ L  +
Sbjct: 271 FEIFKDSASRMVDRI---FSFEIKVSVAIITFASKPKIIMSVLEDRSRDVTEVENSLRNI 327

Query: 270 N--PYEN---TNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGE-NSGAS-- 320
           N   +EN   TN Y A+H  Y  + N+    H   G+ + ++  +I +TDG+ N G S  
Sbjct: 328 NYKDHENGTGTNIYEALHAVYIMMNNQMNRPHMNPGAWQEIRHAIILLTDGKSNMGGSPK 387

Query: 321 -AYQNTLNTLQICEYMRNAGMKIYSVAV-SAPPEGQDL--LRKCTDSSGQFFAVNDSREL 376
            A  N    L I    R   + IY++ V S   + ++L  L    D     F + D + L
Sbjct: 388 VAVDNIKEVLNI-NQKRKDYLDIYAIGVGSLHVDWKELNNLGSKKDGERHAFILKDVQAL 446

Query: 377 LESFDKITDKIQ 388
            + F+ + D  Q
Sbjct: 447 SQVFEHMLDVSQ 458


>gi|87310694|ref|ZP_01092822.1| BatA [Blastopirellula marina DSM 3645]
 gi|87286675|gb|EAQ78581.1| BatA [Blastopirellula marina DSM 3645]
          Length = 355

 Score = 37.0 bits (84), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS----APPEGQDLLRKCT 361
           K +I +TDGEN+        L  +Q  E  +  G+K+Y++ V     AP    D+  +  
Sbjct: 204 KIIILLTDGENNAGD-----LEPIQAAELAQTMGIKVYTIGVGTKGRAPMPVTDMFGR-- 256

Query: 362 DSSGQFFAVNDSRELLESFDKIT 384
             S Q+ +VN   E L+    IT
Sbjct: 257 -QSMQWMSVNIDEETLQKVASIT 278


>gi|119775138|ref|YP_927878.1| inter-alpha-trypsin inhibitor domain-containing protein [Shewanella
           amazonensis SB2B]
 gi|119767638|gb|ABM00209.1| inter-alpha-trypsin inhibitor domain protein [Shewanella
           amazonensis SB2B]
          Length = 753

 Score = 36.6 bits (83), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
           RL++ V+FITDG  +G  A  N +         R    +++ VA+ A P G  + R    
Sbjct: 496 RLRQ-VLFITDGAVNGEDALFNLIER-------RLGTSRLFPVAIGAAPNGYFMSRAAAA 547

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             G F  +    E+ E  +++  +I+   V
Sbjct: 548 GRGSFTFIGHGGEVAEKMNQLLSRIEHPVV 577


>gi|260434111|ref|ZP_05788082.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417939|gb|EEX11198.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 600

 Score = 36.6 bits (83), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 305 KKFVIFITDGENSGASAYQNT----LNTLQ-------ICEYMRNAGMKIYSVAVSAPPEG 353
           K + IF T    S A+ + NT    LN +Q       IC+  ++  + I+S+A  AP   
Sbjct: 499 KIYDIFKTAFGTSYANEWYNTSTTVLNQVQKDPRLTSICQKAKDEKIIIFSIAFDAPDGV 558

Query: 354 QDLLRKCTDSSGQFFAVND-SRELLESFDKITDKIQ 388
           + LL+ C    G ++   D  ++++  F  I   IQ
Sbjct: 559 KPLLKGCVSDDGAYYEAKDNDKDIISVFSSIGSTIQ 594


>gi|296474257|gb|DAA16372.1| complement component 2 precursor [Bos taurus]
          Length = 750

 Score = 36.6 bits (83), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
            ++  +SA  +V+ I      +  +SV I T A    I+ +     S ++ EV++ L  +
Sbjct: 271 FEIFKDSASRMVDRI---FSFEIKVSVAIITFASKPKIIMSVLEDRSRDVTEVENSLRNI 327

Query: 270 N--PYEN---TNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGE-NSGAS-- 320
           N   +EN   TN Y A+H  Y  + N+    H   G+ + ++  +I +TDG+ N G S  
Sbjct: 328 NYKDHENGTGTNIYEALHAVYIMMNNQMNRPHMNPGAWQEIRHAIILLTDGKSNMGGSPK 387

Query: 321 -AYQNTLNTLQICEYMRNAGMKIYSVAV-SAPPEGQDL--LRKCTDSSGQFFAVNDSREL 376
            A  N    L I    R   + IY++ V S   + ++L  L    D     F + D + L
Sbjct: 388 VAVDNIKEVLNI-NQKRKDYLDIYAIGVGSLHVDWKELNNLGSKKDGERHAFILKDVQAL 446

Query: 377 LESFDKITDKIQ 388
            + F+ + D  Q
Sbjct: 447 SQVFEHMLDVSQ 458


>gi|113970537|ref|YP_734330.1| vault protein inter-alpha-trypsin subunit [Shewanella sp. MR-4]
 gi|113885221|gb|ABI39273.1| Vault protein inter-alpha-trypsin domain protein [Shewanella sp.
           MR-4]
          Length = 759

 Score = 36.6 bits (83), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 21/154 (13%)

Query: 241 IAYNIGIVGNQCTPL---SNNLNEVKSRLNKLNPYENTNTYPAMHHAY-RELYNEKESSH 296
           I +N  +     TPL   + NL   +  +N+L     T    A++ A  R+ +N      
Sbjct: 417 IEFNSDVSLLSSTPLPATATNLAMARQFVNRLQADGGTEMAQALNSALPRQAFNTAS--- 473

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPPEGQ 354
              G  +  + VIF+TDG     SA         + E +RN     ++++V + + P   
Sbjct: 474 ---GEDKSLRQVIFMTDGSVGNESA---------LFELIRNQIGDNRLFTVGIGSAPNSH 521

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            + R      G F  + D  E+ +   K+  KIQ
Sbjct: 522 FMQRAAELGRGTFTYIGDVDEVEQKISKLLAKIQ 555


>gi|114562801|ref|YP_750314.1| vault protein inter-alpha-trypsin subunit [Shewanella frigidimarina
           NCIMB 400]
 gi|114334094|gb|ABI71476.1| Vault protein inter-alpha-trypsin domain protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 722

 Score = 36.6 bits (83), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 103/231 (44%), Gaps = 36/231 (15%)

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
           +NNM S   L+PP  + S         ++  A     R++ ++I+++G++  S Q   Q 
Sbjct: 320 DNNMYSLVMLMPPSVEVS--------EQHLIA-----RELILVIDTSGSM--SGQSITQA 364

Query: 231 KKNLSVRIG---------TIAYNIGIVGNQCTPLS---NNLNEVKSRLNKLNPYENTNTY 278
           K+ L   +           I +N  +     TPLS    N+ +    +  L+    T   
Sbjct: 365 KQALQFALAGLRDIDSFNIIEFNSDVTMLSATPLSANSRNIGKANRFIQSLDADGGTEMR 424

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
            A+  A  +  + ++ S  T   + + + VIF+TDG    A   ++ L  L I + + ++
Sbjct: 425 SALQTALVD--SVQQDSDQTDAHSEMLRQVIFMTDG----AVGNEHELYQL-INDQLGDS 477

Query: 339 GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
             ++++V + + P    + R  T   G F  + +  E+ +  +++ +KI++
Sbjct: 478 --RLFTVGIGSAPNSDFMRRAATMGRGTFTYIGNESEVQQKIEQLLNKIEQ 526


>gi|111120280|gb|ABH06325.1| complement component 2 precursor [Bos taurus]
          Length = 787

 Score = 36.6 bits (83), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
            ++  +SA  +V+ I      +  +SV I T A    I+ +     S ++ EV++ L  +
Sbjct: 271 FEIFKDSASRMVDRI---FSFEIKVSVAIITFASKPKIIMSVLEDRSRDVTEVENSLRNI 327

Query: 270 N--PYEN---TNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGE-NSGAS-- 320
           N   +EN   TN Y A+H  Y  + N+    H   G+ + ++  +I +TDG+ N G S  
Sbjct: 328 NYKDHENGTGTNIYEALHAVYIMMNNQMNRPHMNPGAWQEIRHAIILLTDGKSNMGGSPK 387

Query: 321 -AYQNTLNTLQICEYMRNAGMKIYSVAV-SAPPEGQDL--LRKCTDSSGQFFAVNDSREL 376
            A  N    L I    R   + IY++ V S   + ++L  L    D     F + D + L
Sbjct: 388 VAVDNIKEVLNI-NQKRKDYLDIYAIGVGSLHVDWKELNNLGSKKDGERHAFILKDVQAL 446

Query: 377 LESFDKITDKIQ 388
            + F+ + D  Q
Sbjct: 447 SQVFEHMLDVSQ 458


>gi|315498202|ref|YP_004087006.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416214|gb|ADU12855.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 489

 Score = 36.2 bits (82), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 66/164 (40%), Gaps = 30/164 (18%)

Query: 254 PLSNN----LNEVKSRLNKLNPYENTNTYPA-MHHAYRELYNE---KESSHNTIGSTRLK 305
           PLSN+     N +K  +N +  Y+     P  +H     L      KE       +   K
Sbjct: 319 PLSNDKTVVTNSIKGLVNSIGSYKPDTFIPGGLHWGVNTLSPPAPFKEGMAYDSKNKEPK 378

Query: 306 KFVIFITDGEN-----------SGASAYQNTLNTLQI----------CEYMRNAGMKIYS 344
           K ++ +TDG N           S A+    T+++  +          C+Y +   ++++ 
Sbjct: 379 KVIVLMTDGANTLYTNSSGQIVSAATGSPPTISSSLVAPTYTAQDNACKYAKGKNIEVFV 438

Query: 345 VAVSAP-PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           + +    P     L+ C   +  +F   ++ +L+E+F+ I  K+
Sbjct: 439 IGLGVTDPTALSALKSCATDAQHYFDAQNANDLIEAFEIIGGKL 482


>gi|145596437|ref|YP_001160734.1| translation elongation factor G [Salinispora tropica CNB-440]
 gi|189027970|sp|A4XBP9|EFG_SALTO RecName: Full=Elongation factor G; Short=EF-G
 gi|145305774|gb|ABP56356.1| translation elongation factor 2 (EF-2/EF-G) [Salinispora tropica
           CNB-440]
          Length = 698

 Score = 36.2 bits (82), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 25  IRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGD 84
           + + + S LD   + G A+      ++ P+T +      FK Q  KHL + +Y+R  +G 
Sbjct: 276 VVDYLPSPLDVPAIEGTATDGETPMLRKPSTSEPFAGLAFKIQTDKHLGKLTYVRVYSGV 335

Query: 85  IAQKAQ-INITKDKNNPLQYIAESKA 109
           +   +Q +N TKD+   +  I +  A
Sbjct: 336 VETGSQVVNSTKDRKERIGKIYQMHA 361


>gi|315649108|ref|ZP_07902201.1| von Willebrand factor type A [Paenibacillus vortex V453]
 gi|315275543|gb|EFU38898.1| von Willebrand factor type A [Paenibacillus vortex V453]
          Length = 983

 Score = 36.2 bits (82), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 52/126 (41%), Gaps = 16/126 (12%)

Query: 257 NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            N  EV S +  +     TN YPA+  A  E+   K            ++ +I +TDG++
Sbjct: 463 GNKEEVLSSIQSIPSAGGTNIYPAVSSALEEMLKIKSQ----------RRHIILMTDGQS 512

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSREL 376
           +  S YQ+  +T      M    + + SVAV    +   L      + G+++ V D   L
Sbjct: 513 AMNSGYQDLTDT------MVENKITMSSVAVGTDADTHLLQSLAEAAKGRYYFVEDETTL 566

Query: 377 LESFDK 382
              F +
Sbjct: 567 PAVFSR 572


Searching..................................................done


Results from round 2




>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL
Sbjct: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL
Sbjct: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT
Sbjct: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG
Sbjct: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
           STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC
Sbjct: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
Sbjct: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score =  333 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 137/402 (34%), Positives = 229/402 (56%), Gaps = 29/402 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M+A II VC +F+++ ID+ H+++++N +QS+LD A++SGC+ +VSD  I D   ++++ 
Sbjct: 27  MSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPKINDLNPQEERI 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + KK    ++ Q  +  E+A  I + A I+ +KD  N  +Y    +A++++  +N  L
Sbjct: 87  RDVIKKNAYVNMVQN-FPAEHAAYIIENANISFSKDLTNKYEYKITMEAKHQLSGKNFIL 145

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+P+ +T++S  STGII++ S+  A S+ MVLD S SM D  +Q+  D ++     Y 
Sbjct: 146 GFLMPNVITHISSISTGIIQKPSDKKAFSVEMVLDCSGSMLDS-MQESCDLSSGRGGYY- 203

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F+SKN  K K          KI  L  ++ + VN IQ+ +Q    +S RIG 
Sbjct: 204 --------FYSKNNNKPK---------SKIYALKTASSDFVNLIQETVQTFPQISARIGL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN--EKESSHNT 298
           I +N  I+ +  + LSNN N +K  ++++ P   T+T+  M+ AY  L N   +  +HN 
Sbjct: 247 ITFNHYIMQD--SKLSNNFNVIKKTISRMKPKGGTDTFLPMNAAYEYLNNIPNETKAHNI 304

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--APPEGQDL 356
             +  LK+++I +TDGEN+  S     L T+ +C+  R  G+ IYS+ ++     +G +L
Sbjct: 305 SDNVPLKRYIILMTDGENNHPSYD---LKTINVCDNARKNGIIIYSIFLNYYEYTDGYEL 361

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
            RKC  S   FF  N+++ LL+SF  I   IQ+++VRIA N 
Sbjct: 362 ARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAVRIASNE 403


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score =  331 bits (849), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 97/404 (24%), Positives = 166/404 (41%), Gaps = 29/404 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A D+   +  A+  +       T++ +  
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLISKQQLQEAADS---AALATATALANGTIQTSQAEAF 80

Query: 61  -STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                  Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L 
Sbjct: 81  ARNFVAGQMANYLQSGVDIKSATGVTVQ------TNTSGNSTSYQVTVSPSYDLTVNPLM 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
               +     +LS   T I   S    +IS+ + LD S SM +     + ++   +    
Sbjct: 135 QA--VGFTTQHLSTSGTTIGGHSQTQGSISMYLALDKSGSMGEDTATVNEEDPTESYTYD 192

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                 KK  W  +T       + A    KI+ L  +AGNL   +  A  +     VR G
Sbjct: 193 CNGHYNKKGKWIYDT----CTGSRANYYTKIEALKMAAGNLFGQLSSA--DPNAQYVRTG 246

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NEK 292
            ++Y+  IV    + L+   + V + +N L     TN+  AM  AY  L        + +
Sbjct: 247 AVSYD--IVQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAAGNDAE 304

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAP 350
           +++H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  AP
Sbjct: 305 DAAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAP 364

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 365 EGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRL 408


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 97/409 (23%), Positives = 169/409 (41%), Gaps = 34/409 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A      +  A++ +   + + T +  Q 
Sbjct: 24  MTAILAPVLLGAAGLAIQVGDMLLSKQQLQEA------ADSAALATATALGNGTIQTSQA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLF 119
               +  +   +       +N  DI     +N+ T +      Y       Y++    L 
Sbjct: 78  EAFARNFVAGQMANYL---QNGVDIKNATAVNVQTSNSGKSASYQVTVTPSYDLTVNPLM 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSE-----NLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
               +  +  +LS  ST +   S         ++S+ + LD S SM D     + D    
Sbjct: 135 QA--VGFSTQHLSTSSTTVSGPSQTPGSNSQGSVSMFLALDKSGSMGDPTETVNKDQPTE 192

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           T      P   KK  W  +T       +      KI+ L  +AGNL   +  A  +    
Sbjct: 193 TFTYDCNPHLNKKGKWVYDT----CTGSRTNYYTKIEALKMAAGNLFGQLTSA--DPDAQ 246

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY----- 289
            VR G ++Y+  I     + L+   + V S +N L     TN+  AM  AY  L      
Sbjct: 247 YVRTGAVSYD--IDQYTPSTLAWGTSGVSSYVNALQAGGGTNSSGAMGTAYSSLTAKNAA 304

Query: 290 --NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSV 345
             + ++++H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++
Sbjct: 305 GNDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTI 364

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           A  APP GQ LL+ C   +  +F      +LL +F  I  K   Q  R+
Sbjct: 365 AFMAPPGGQALLQYCASDAAHYFQAEQMEDLLAAFKAIGAKASAQLTRL 413


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score =  316 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 92/405 (22%), Positives = 161/405 (39%), Gaps = 30/405 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  +M  + Q+Q A      +  A++ +   + + T +  Q 
Sbjct: 24  MTAIMAPVLLGVAGVAIQVGDMMLSKQQLQEA------ADSAALATATALANGTIQTSQA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLF 119
               +  +   +       ++  D      +N+ T        Y       Y++    L 
Sbjct: 78  EAFAQNFVAGQMANYV---QSGVDFKSGTSVNVQTSTSGKSTSYQVTVSPSYDLTVNPLM 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
               +     +LS   T +   S    +IS+ + LD S SM +     + D+   +    
Sbjct: 135 QA--VGFKTQHLSTSGTTVGGHSQTQGSISMFLALDKSGSMGEATATVNADDPTESYTYD 192

Query: 180 LLPPPPKKSF-WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                  K+  W  +    K   +      KI+ L  +AGNL   +  A  +     VR 
Sbjct: 193 CNLHYNSKNNKWVYD----KCTGSRTNYYTKIEALKIAAGNLFGQLNSA--DPNAEYVRT 246

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NE 291
           G ++Y+  I     + L+     V S +N L     TN+  AM  AY  L        + 
Sbjct: 247 GAVSYD--INQYTPSNLAWGTAGVTSYVNALQANGGTNSSGAMSTAYSSLTAKNAAGNDA 304

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSA 349
           ++S+H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  A
Sbjct: 305 EDSAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMA 364

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           P  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 365 PAGGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASAQMTRL 409


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 94/405 (23%), Positives = 163/405 (40%), Gaps = 30/405 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A D+A L+   ++ +       T  +   
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAADSAALATATALANGT--IQTTEAEAFA 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLF 119
                 Q+  +L+ G+       DI     +N+ T        Y       Y +    L 
Sbjct: 82  RNFVAGQMANYLQSGT-------DIKSTTSVNVQTTTSGKSTSYQVTVSPAYVLTVNPLM 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
               +     +LS   T I   S    +IS+ + LD S SM +     + ++   +    
Sbjct: 135 QA--VGFTTQHLSTSGTTIGGHSQTQGSISMFLALDKSGSMGEDTATVNEESPTESYTYD 192

Query: 180 LLPPPPKKSF-WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                  K+  W  +    K   +      KI+ L  +AGNL + +  A  +     VR 
Sbjct: 193 CNLHYNTKNNKWVYD----KCTGSRTNYYTKIEALKMAAGNLFSQLNSA--DPNAQYVRT 246

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK------ 292
           G ++Y+I       + L+  +  V S +N L     TN+  AM+ AY  L  +       
Sbjct: 247 GAVSYDINQYA--PSSLAWGITGVSSYVNALQANGGTNSSGAMNTAYTSLTAKNAAGNDV 304

Query: 293 -ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSA 349
             S+H        KK+++F+TDG+N+   +   + +T   + C+  ++ G++IY++A  A
Sbjct: 305 ENSAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTATKKTCDDAKSKGIEIYTIAFMA 364

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           P  GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 365 PAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQLTRL 409


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 168/405 (41%), Gaps = 30/405 (7%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TAI+  V       A+ +  ++  + Q+Q A D+A L+   ++ + +     +  +    
Sbjct: 1   TAILAPVLLGAAGMAVHVGDMLLSKQQLQEAADSAALATATALANGK--IQTSEAEAYAR 58

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L   
Sbjct: 59  NFVAGQMANYLQSGVDIKSATGVSVQ------TNTSGNSTSYQVTVSPSYDLTVNPLMQA 112

Query: 122 GLIPSALTNLSLRSTGIIERSSE---NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
             +     +LS   T I    S+     +IS+ + LD S SM +     + ++   +   
Sbjct: 113 --VGFTTQHLSTSGTTIGGGHSQTQGQGSISMYLALDKSGSMGEDTATVNEEDPTESYTY 170

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
              P   +K     +T       + A    KI+ L  +AGNL   +  A  +     VR 
Sbjct: 171 PCNPHYNRKGKEVWDT----CTGSRANYYTKIEALKMAAGNLFAQLSGA--DPNAQYVRT 224

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NE 291
           G ++Y+  IV    + L+     V S +N L     TN+  AM  AY  L        + 
Sbjct: 225 GAVSYD--IVQYAPSSLAWGAIGVSSYVNALQAGGGTNSSGAMSTAYLSLTAKNAAGNDA 282

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSA 349
           ++S+H        +K+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  A
Sbjct: 283 EDSAHKLKSGQIPQKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMA 342

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           PP GQ LL+ C   +  +F      +L  +F  I  K   Q  R+
Sbjct: 343 PPGGQALLQYCASDASHYFQAEKMEDLFAAFKAIGAKASTQVTRL 387


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 99/413 (23%), Positives = 170/413 (41%), Gaps = 39/413 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA++  +       ++D+A+++  +NQ+Q A DAA L+  +++VSD    D    KD  
Sbjct: 25  MTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSDAR-PDIEEAKDLA 83

Query: 61  STIFKKQIKKHLK------------------QGSYIRENAGDIAQKAQINITKDKNNPLQ 102
               K Q                                  +     +I+IT   N    
Sbjct: 84  RKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPRWEDVNATEIDITATPNGAKG 143

Query: 103 YIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMED 162
              +     +   +   +  L+      +  RST      S+N A+S+ +VLD S SM  
Sbjct: 144 KSFQVTVANKHLLQFNAMTRLLGPESIEIETRSTAESATESKN-ALSMYLVLDRSGSMA- 201

Query: 163 LYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                    N + + K   P    ++ WSK        P       KID L  + G+L+ 
Sbjct: 202 ------WKTNTINTGKAKCP-NYTEANWSKYPDLKATGPCYV---TKIDALKTAVGDLLA 251

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
            +  A  + ++  VR G I+YN     +  + LS         ++ L     T +  A  
Sbjct: 252 QLVTA--DPESAYVRTGAISYNS--AQDAASSLSWGTRGAAGYVDALVAIGGTASGNAFK 307

Query: 283 HAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMK 341
            A++++ N  E S H         K+++F+TDGEN+ A+   +   T Q C+  + + ++
Sbjct: 308 TAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHAN---DDTVTRQWCDTAKASKVQ 364

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           IYSVA  AP  GQ LL+ C  SS  +F   ++ +L+ +F  I ++      R+
Sbjct: 365 IYSVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGERAAASVSRL 417


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 99/397 (24%), Positives = 163/397 (41%), Gaps = 26/397 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V F     AI +  ++  + Q+Q A D+   +  A+  +       T++ +  
Sbjct: 25  MTAIVLPVLFGAAGMAIQVGDLLLSKQQLQEAADS---AALATATALANGTIQTSQAEAF 81

Query: 61  -STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                  Q+  +L+ G  I+   G   +      T        Y       Y I    L 
Sbjct: 82  ARDFVAGQMANYLQSGIDIKSTTGVDVR------TTTSGKSTSYQVTVSPDYNIAVNPLM 135

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
               I     N+S  ST     S    ++S+ +VLD S SM +     +  +    + +Y
Sbjct: 136 QT--IGFTTQNISTSSTTTSGNSQTQGSVSMFLVLDRSGSMGEDTATVNASD---PTEEY 190

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPAN-RKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                 K  +   N TK K      P    KI+ L  + G L   +     + +   VR 
Sbjct: 191 NYDCSEKDRY--GNVTKKKTCTDTRPHYYTKIEALKLAVGTLTGELDAV--DPEKEYVRT 246

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES-SHN 297
           G ++YNI +   +   L      V   +NKL   + T++  A   AY +L +  E  +H 
Sbjct: 247 GAVSYNIEM--QKAKALDWGTAHVTKYVNKLTATDGTDSGEAFKTAYNKLADAAEDKAHV 304

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                   K+++F+TDG+N+  SA      T   C+  R+A M++Y++A  AP  GQ LL
Sbjct: 305 DKTGQVPTKYIVFMTDGDNNYTSADT---ETKTWCDKARDAKMQVYTIAFMAPARGQALL 361

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             C  + G +F   D   LL++F +I  K   Q  R+
Sbjct: 362 SYCATAPGNYFPAGDMTALLKAFKEIGMKASNQVTRL 398


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 84/343 (24%), Positives = 140/343 (40%), Gaps = 25/343 (7%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L  
Sbjct: 1   RNFVAGQMANYLQSGVDIKSATGVTVQ------TNTSGNSTSYQVTVSPSYDLTVNPLMQ 54

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +     +LS   T I   S    +IS+ + LD S SM +     + ++   +     
Sbjct: 55  A--VGFTTQHLSTSGTTIGGHSQTQGSISMYLALDKSGSMGEDTATVNEEDPTESYTYDC 112

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                KK  W  +T       + A    KI+ L  +AGNL   +  A  +     VR G 
Sbjct: 113 NGHYNKKGKWIYDT----CTGSRANYYTKIEALKMAAGNLFGQLSSA--DPNAQYVRTGA 166

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NEKE 293
           ++Y+  IV    + L+   + V + +N L     TN+  AM  AY  L        + ++
Sbjct: 167 VSYD--IVQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAAGNDAED 224

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPP 351
           ++H        KK+++F+TDG+N+  S+   + +TL    C+  ++ G++IY++A  AP 
Sbjct: 225 AAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPE 284

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            GQ LL  C      +F      +LL +F  I  K   Q  R+
Sbjct: 285 GGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRL 327


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 93/418 (22%), Positives = 169/418 (40%), Gaps = 47/418 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+I  +       ++D+A+++  +NQ+Q A DAA L+  +++VS     D     ++ 
Sbjct: 14  MTALIAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVS-----DARPDIEEA 68

Query: 61  STIFKKQIKKHLKQGSYIR---------------ENAGDIAQKAQINITKDKNNPLQYIA 105
             I +K +K  +   S                    + D    +++ I +  N       
Sbjct: 69  KAIARKFLKTQMAATSSADVPGEAVGTMAAAGSTAPSWDDVNTSEVVIVETPNGTKGKSF 128

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
           +     +   +   +  L+      L  RST      S+N AIS+ +VLD S SM   + 
Sbjct: 129 QVSVANKHLLQFNAMTRLLGKESIELETRSTADSATESKN-AISMYLVLDRSGSMA--WK 185

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN-RKIDVLIESAGNLVNSI 224
               D +            P+   W+ +        A +P    KI  L  +   L   +
Sbjct: 186 TDTVDTSR-----------PRCINWTASNWGESNVRATSPCYVDKITTLKSAVDKLFTPL 234

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
            K   +  N  +R G  +YN     ++ + L+       + +  L+    T++  A   A
Sbjct: 235 AKM--DPGNEYLRAGAASYNDR--QDRASKLTWGTKNASAHVQGLDATGGTDSSSAFAAA 290

Query: 285 YRELYNEKES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-------TLQICEYMR 336
             EL  + E+ +H        +K+++F+TDGEN+  +   +  +       T   C   +
Sbjct: 291 VEELLLDGENEAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAK 350

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           N G+ I++VA  AP  G+DLL+ C  S   +   +D+  L+  F+KI  K      R+
Sbjct: 351 NNGIAIFTVAFMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQKAAAMIARL 408


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 90/401 (22%), Positives = 183/401 (45%), Gaps = 62/401 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TAI++ V F+ +   I+ +H  +++ ++   LD ++L     I++     +   +K+  
Sbjct: 20  LTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDF 79

Query: 61  -----STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
                  I++   +  L++  +  ++  +I +   ++I  D  +   Y   + ++YE+P 
Sbjct: 80  SYRIIKNIWQTDFRNELRENGF-AQDINNIERSTSLSIIIDDQHK-DYNLSAVSRYEMP- 136

Query: 116 ENLFLKGLIPSALT--NLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNN 172
              F+    P      +  L  T  ++ SS+ ++ + + MVLDVS SM D +        
Sbjct: 137 ---FIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHF-------- 185

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                                           P   K+ V   S   +++ I K+I +  
Sbjct: 186 -------------------------------GPGMDKLGVATRSIREMLD-IIKSIPDVN 213

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
           N+ VR G + ++  IV  Q  PL+  +  ++ ++N+L     T + P + +AY ++++ K
Sbjct: 214 NV-VRSGLVTFSSKIV--QTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAK 270

Query: 293 ES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           E   H   G    KK++IF+TDGENS  +   +   +L  C   +  G  +Y++ V A  
Sbjct: 271 EKLEHIAKGHDDYKKYIIFLTDGENSSPNI--DNKESLFYCNEAKRRGAIVYAIGVQAEA 328

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             Q  L+ C  S  +F++V +SR+L ++F +I  ++ +Q +
Sbjct: 329 ADQ-FLKNCA-SPDRFYSVQNSRKLHDAFLRIGKEMVKQRI 367


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 88/408 (21%), Positives = 165/408 (40%), Gaps = 35/408 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V        ++LA++M ++  MQ+       S   +  ++  +++     +Q 
Sbjct: 24  MTAILLPVLLGVAGAGMELANVMQVKADMQNTA----DSAALAAATEARLREGKLSDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQYEIPTENLF 119
             I K  I   +++     E   ++ + +   +T  +N     Y  E+  +++I    + 
Sbjct: 80  KEIAKNFIAAQMEKN-LTAEEKIELEKNSPTRVTTTENARGKTYAVETTIKHQIQLNPML 138

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
             G I +   +LS+  T      ++   IS+ + LD S SM            +      
Sbjct: 139 --GFIGAKTLDLSVTGTAKS-TINKGAPISMYLALDRSGSMSFKTDTVDTTKTS------ 189

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE----KKNLS 235
                     WSK    +K +P       K   L  + G LV ++ KA         +  
Sbjct: 190 --CQNYTSDNWSKYPNLAKTSPCYV---NKAASLKTAVGFLVATLNKADPTYTVNGGSEL 244

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEK 292
           VR G   Y       Q   +    + V S ++K  P      T+   +++ AY  L    
Sbjct: 245 VRTGASVYTHETYVAQ--SIGWGTSGVTSYVDKQIPEFPSGGTDARSSLNAAYNALKKAN 302

Query: 293 ESS---HNTIGSTRLKKFVIFITDGENSGASAYQNT---LNTLQICEYMRNAGMKIYSVA 346
                 H   GS   +++++ +TDGE +G SA  N+    +    CE  +  G+KI+SVA
Sbjct: 303 PDEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKKDGIKIFSVA 362

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             AP +G+ LL+ C  S+  ++A  +  +++ +F +I  K       +
Sbjct: 363 FMAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIARKAAGSIATL 410


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 102/407 (25%), Positives = 173/407 (42%), Gaps = 33/407 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+   +       +ID+A+++  +NQ+Q A DAA L+  +++VSD    D    K+  
Sbjct: 25  MTAVAAPLLLAAGGVSIDMANMLMTKNQLQDATDAAALAAASALVSDEQ-PDIAAAKEIA 83

Query: 61  STIFKKQIK------------KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
               K Q              +    G+       D     ++NIT+  N     I +  
Sbjct: 84  RKFLKTQAGGTTTPDAPADSGEGASSGAASSTPDWDDVNTLEVNITETPNGTKGKIFQVT 143

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH 168
              +  TE   +  L+ +    L   ST      S+N A+S+ +VLD S SM      K 
Sbjct: 144 VINKRVTEFNAMTRLLGTDSIELEASSTAESATESKN-ALSMYLVLDRSGSMA----WKT 198

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
           N  N    +     P   +S WS+       +P       KID L  +  +L+  +   +
Sbjct: 199 NTINAAKKSC----PNYTESNWSRYPNLWASSPCYV---TKIDALKTAVTDLLAQL--LV 249

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
            +   + VR   I+YN   V +    L+   +   + +N L     T +  A   AY+++
Sbjct: 250 ADPDQIYVRTAAISYNS--VQDTAGTLAWGTSGAAAYVNALVATGGTASAGAFKTAYQKV 307

Query: 289 YNEKES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
               E+ +H         K+++F+TDGEN+ A+   +   T Q C+  +   ++IYSVA 
Sbjct: 308 IAATENTAHAAKNGQVPSKYMVFMTDGENNYAN---DDTVTKQWCDTAKANKVEIYSVAF 364

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            AP  GQ LL+ C  SS  +F   +  +L+ +F  I ++      R+
Sbjct: 365 MAPERGQALLKYCASSSSHYFEAEEVTDLVAAFKAIGERAAAVVSRL 411


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 84/408 (20%), Positives = 162/408 (39%), Gaps = 35/408 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V   F    ++LA++M ++  +Q+       S   +  ++  +K+     +Q 
Sbjct: 24  MTAILLPVLLGFAGAGMELANVMQVKADLQNTA----DSAALAAATEARLKEGALTDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLF 119
             I K  I   +++     E    + + + +NI T D      Y  ++   Y++    L 
Sbjct: 80  KEIAKAFIASQMEKT-LTEEEKKALEKNSPVNIGTTDDARGKTYTIQTTINYQMQLNPLL 138

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
             G   +   +L+   T +    ++   IS+ +VLD S SM   +     +    +   Y
Sbjct: 139 --GFFGAKTLDLAATGTAVS-TVNKGAPISMYLVLDRSGSMS--FKTDTLNTKKTSCQNY 193

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE----KKNLS 235
                     W         +P       K   L  + G LV ++ KA         +  
Sbjct: 194 ------TVDNWGSYPNLKNTSPCYV---NKATSLKTAVGYLVATLNKADPTYTANGGSEL 244

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEK 292
           VR G   Y       Q  P++   + V + ++K  P      T+   +++ AY  L    
Sbjct: 245 VRTGASVYTHETYAAQ--PITWGTSSVATYVDKQIPEFPSGGTDARSSLNAAYNALKKAN 302

Query: 293 E---SSHNTIGSTRLKKFVIFITDGENSGASAYQN---TLNTLQICEYMRNAGMKIYSVA 346
                 H    S   +++++ +TDGE +G S+  +          C+  +  G+KI+SVA
Sbjct: 303 TVEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNTCDTAKKDGIKIFSVA 362

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             AP +G+ LL+ C  S   ++A  +  +++ +F +I  K       +
Sbjct: 363 FMAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIARKAAGSLATL 410


>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 76/402 (18%), Positives = 167/402 (41%), Gaps = 63/402 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81

Query: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
              +    +    +  L+   ++  +  DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 82  ILCRIKNTWNMSFRNELRDNGFVN-DIDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139

Query: 116 ENLFLKGLIPSALT--NLSLRSTGIIERSSENLA-ISICMVLDVSRSMEDLYLQKHNDNN 172
           +       IP      ++ +  T  ++ +S+  A + + +VLDVSRSME  +        
Sbjct: 140 K---FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI---- 192

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                                               KID+ I+S   ++  + K I +  
Sbjct: 193 -----------------------------------TKIDMAIKSINAMLEEV-KLIPDVN 216

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYN- 290
           N+ V+ G + ++  I   +   L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ 
Sbjct: 217 NV-VQSGLVTFSNKI--EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
           +    H        KK ++F+TDGEN      Q    +L  C   +  G  +Y++ +   
Sbjct: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ---QSLYYCNEAKKRGAIVYAIGIRV- 329

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 330 IRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 88/398 (22%), Positives = 154/398 (38%), Gaps = 62/398 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALD-AAVLSGCASIVSDRTIKDPTT-KKD 58
           +  I+I +    +T  ID++     R ++Q+A D AAV +G A +  + TI       KD
Sbjct: 85  LFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALLAEEITIAQANAYAKD 144

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKD-KNNPLQYIAESKAQYEIPTEN 117
             + I           GS      G +  K  + IT+    N   Y+ +     +IP   
Sbjct: 145 AFNRIASGLSAS--GDGSSGTSIFGTMTVKPAVQITETVDGNTTNYVVKVNGTAKIPASP 202

Query: 118 L---FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           L   F  G       +L   S     ++    ++S+ +VLD S SM              
Sbjct: 203 LSFMFFDGETGKNTISLGFESETT-AKAEAGASLSMALVLDRSGSMG------------- 248

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                          W + +  S+              L ++  +L+  +Q    +  + 
Sbjct: 249 ---------------WERPSRMSE--------------LKKAVRSLIKELQTV--DPDDQ 277

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE- 293
             R+G  AY+    G +   L+ N N V+S +N L     T   PA+  A  +L    E 
Sbjct: 278 FTRLGAYAYHWYYAGKK--ELTWNKNSVRSWVNSLPASGGTRAAPAIQKAKNDLLTNSEL 335

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
           ++H          F++++TDG +   +  +        C   +NAG+ IY+VA  AP  G
Sbjct: 336 NAHINKNEQEPDLFILYMTDGIDGDPNWAKRE------CTSAKNAGITIYTVAFKAPASG 389

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           ++LL+ C  S   ++   ++ EL + F  I  +  +  
Sbjct: 390 RNLLKACATSDAHYYDAKNANELNKVFKDIARETTKSI 427


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 91/401 (22%), Positives = 174/401 (43%), Gaps = 70/401 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  + V F+  + A+D  + M ++ ++Q+A+D+A L+  A +  +  +        Q 
Sbjct: 24  IAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAALATAARLSEEENLTAA-----QA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQYEIPTENLF 119
                K +   +K+         D       ++T   N +P++    +  +  +  E   
Sbjct: 79  QAFALKFVNGQVKE---------DFGAFNGFSVTPTVNIDPVETGGRTVWKVAVSMEG-- 127

Query: 120 LKGLIPSALT----NLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
            + L P A       L++   G  E + E   A S+ +VLD S SM+             
Sbjct: 128 SQSLTPMARIMGKDKLTVSVVGKSESAGEAQGAFSMALVLDRSGSMD------------- 174

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                          W+ N              +KI+VL  + G L+   ++A  + +  
Sbjct: 175 ---------------WNLN------------GQKKINVLKTAVGGLIEQFEEA--DPERK 205

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
            VR+G  +YN  + G   T L  N  + K  ++ L     T++  A   AY  + +++E+
Sbjct: 206 YVRLGASSYNSKLTG--STKLRWNPGKTKEFVDALPASGGTDSTDAFDWAYTAVTHKREN 263

Query: 295 -SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
            +H+       KKF++F+TDG+N+ +SA  +   T  +C+  ++ G+++Y+VA +AP  G
Sbjct: 264 NTHDAKSGQVPKKFIVFMTDGDNNYSSADSS---TKHLCDDAKDDGIEVYTVAFAAPNRG 320

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           + LL  C  +   FF   +S +L+E+F  I     +   R+
Sbjct: 321 KQLLSYCASTEEHFFDAQNSAQLIEAFKNIGYAASKVVSRL 361


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 93/448 (20%), Positives = 190/448 (42%), Gaps = 70/448 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+++ V        +D+    Y  + ++ A   A+++    ++  +++++ +++   +
Sbjct: 25  ITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI--QSLEEVSSRAKNS 82

Query: 61  STIFKKQIKKHLKQG--SYIRENAGDIAQKAQINITKDKNNP----LQYIAESKAQYEIP 114
            T  K++I+++L +   + +++N  D   +  +  T  + NP     Q +  S+    + 
Sbjct: 83  FTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLN 142

Query: 115 TENLFLKGL-IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
             +LFL+ + I S L      +  +     +   +SI  V+D SRSM D       D+  
Sbjct: 143 PLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY----QRDSEG 198

Query: 174 MTSNKYLLPPPPK-KSFWSKN----TTKSKYAPAPAPANR-------------------- 208
              N +  P     KS+ S+N        K +P     N+                    
Sbjct: 199 QPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHF 258

Query: 209 -----------KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                      K  ++ ++  +++ SI+K   +  N +VR+G   +N  ++ +     S 
Sbjct: 259 VDSSSLRHVIKKKHLVRDALASVIRSIKKI--DNVNDTVRMGATFFNDRVISDP--SFSW 314

Query: 258 NLNE-----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFI 311
            +++     VK+     N   +T    AM  AY  + +  E   H    +   KK+++ +
Sbjct: 315 GVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLL 374

Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD----LLRKCTDSSGQF 367
           TDGEN+     Q+    + IC   ++ G++I ++A S     Q+     L  C  S   F
Sbjct: 375 TDGENT-----QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCA-SPNSF 428

Query: 368 FAVNDSRELLESF-DKITDKIQEQSVRI 394
           F  N + EL + F D+I ++I E+ +RI
Sbjct: 429 FEANSTHELNKIFRDRIGNEIFERVIRI 456


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 89/406 (21%), Positives = 167/406 (41%), Gaps = 35/406 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++ V       A+D   ++  R+ +QS++DAA L+  +++ +  +  D        
Sbjct: 53  MTAVLLPVSIGVAGLAMDATEMVQSRSALQSSVDAAALAAASAMSNGMSEADAI------ 106

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKA------QINITKDKNNPLQYIAESKAQYEIP 114
             + K  +   L       EN   + Q         +  T+  ++   Y  E    Y I 
Sbjct: 107 -ALAKSFLSSQLANTMARDENTSSVDQITQAEPDISVKTTQVNSSSTSYDVELTGSYTIT 165

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
              L    ++      L          ++    +S+ +VLD S SM        ND    
Sbjct: 166 MNPL--SRVLGWETVTLKAYGKAQAATTASESPLSMYLVLDRSGSM--------NDETAT 215

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           T              W+K TT + Y  +      KI+ L  +  +L   ++KA  +  + 
Sbjct: 216 TYTGTCTKTTTSGYGWNKKTTTTSY--SCTKNYTKIESLKLAVADLAAQLKKA--DPNSE 271

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
            VR G  +YN     +    +S     V + +N L+    T+   A+  AY  L    ++
Sbjct: 272 YVRTGADSYNAS--ADTAQAMSWGTANVVTYVNALSATGGTDARGALSAAYSALQTSNKT 329

Query: 295 ---SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI---CEYMRNAGMKIYSVAVS 348
              +HN    +++ ++++F+TDGE +G S+  ++     +   C  ++  G++IY+VA  
Sbjct: 330 EITAHNVSSVSKIGRYIVFMTDGEMTGNSSSWSSSIDSAVRSQCTSIKADGIQIYTVAFM 389

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           AP  G+ LL  C   +  ++   D+  L+ +F +I  K    S R+
Sbjct: 390 APANGKSLLSACASDASHYYEATDAASLVAAFGEIGKKATSTSTRL 435


>gi|218506715|ref|ZP_03504593.1| hypothetical protein RetlB5_03444 [Rhizobium etli Brasil 5]
          Length = 269

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 70/274 (25%), Positives = 118/274 (43%), Gaps = 16/274 (5%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
           + S     +   S    +IS+ + LD S SM D     + D+          P   KK  
Sbjct: 1   HHSTSGRTVSGHSQSQGSISMFLALDKSGSMGDPTATVNADDPTEPFTYDCNPHLNKKGT 60

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
                T +    + A    KI+ L  +AGNL + +  A  +     VR G ++Y+  +V 
Sbjct: 61  KIIYDTCT---GSRAHYYTKIEALKIAAGNLFSQLNSA--DPNAEYVRTGAVSYD--LVE 113

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NEKESSHNTIGST 302
              + L+  +  V S +N L     TN+  A++ AY  L        + ++++H      
Sbjct: 114 YTPSKLAWGITAVTSYVNALESGGGTNSSGAVNTAYTSLTAKNAAGNDAEDAAHKLKTGQ 173

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
             KK+++F+TDG+N+  S    + +TL    C+  +  G++ Y++A  AP  GQ LL  C
Sbjct: 174 LPKKYIVFMTDGDNNDDSRGGRSYDTLTKATCDTAKAKGIETYTIAFMAPEGGQALLHYC 233

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
                 +F      +LL +F  I  K   Q  R+
Sbjct: 234 ASDDAHYFQAEKMEDLLAAFKAIGAKASAQVTRL 267


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 85/389 (21%), Positives = 180/389 (46%), Gaps = 56/389 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           +AII  +  + +    ++++I   + ++Q+ +D A+L    +++  + I+D        +
Sbjct: 21  SAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLD-TVTMIKLKNIEDVVKNVGPVN 79

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           TI+ K +K  L+   +   +  ++     + +  D N        + +QY++P +   + 
Sbjct: 80  TIWTKNLKYELEHSDF-SSDVQNVIDDTSMKLESDSNFKTL-SITAISQYKMPFKICNIH 137

Query: 122 GLIP-SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            L P +    + + S+  I R+ E   I + +VLDVS SM+D +++              
Sbjct: 138 LLCPKNKYVTVPVLSSMKIGRN-EGSDIDLMIVLDVSSSMDDNFMK-------------- 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                               P  AP +R ++V  +S   ++   +K +    N+  R G+
Sbjct: 183 --------------------PEEAPCSR-LEVAKKSIRKMLEDFRK-VPNYANVF-RTGS 219

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           + +N  +      PL   L  + + + K   + +TN+Y  M +A+ +LY   + + +   
Sbjct: 220 VGFNDMV--QFPMPLKRGLKRIYNDIKKYRAFGSTNSYVGMKYAWEQLYGNPQDTKDR-- 275

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
               KK VIF+TDGEN   +A   T  T+++C  M+     IYS+A++   + +++L+ C
Sbjct: 276 ----KKIVIFLTDGENMIINA---TRKTIELCNDMKKKKAVIYSIALAV--DNKEVLQGC 326

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQE 389
             SSG  +A +D++ L++++  I   + +
Sbjct: 327 -SSSGNVYAADDAQSLVQAYSLIGKDVMK 354


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 93/429 (21%), Positives = 183/429 (42%), Gaps = 66/429 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            + I+IS+   FI   I +    + +N M++A  +A+LSG + I+S  +           
Sbjct: 26  FSVILISILL-FIGILIYVLDYYHKKNAMENANTSAILSGASKIISRISYFGDNMSSHTH 84

Query: 61  STI---FKKQIKKHLKQGSYIRENAGD------IAQKAQINITKDKN-------NPLQYI 104
             I     + IK ++K+   +  +  D      I+Q ++++IT++ +       N    +
Sbjct: 85  RAIVDDVTRFIKSYIKESLLMDSSVFDISEKNIISQNSKVSITREPHPNVFHEFNNQSIL 144

Query: 105 AESKAQYEIPTENL------FLKGLIPSALTN--LSLRSTGIIERSSENLAISICMVLDV 156
              K  Y I  E        F   L+   + +  +S     +   + E+    + +V+D+
Sbjct: 145 QNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFVPALVKIDTGEHPFFFVQLVVDL 204

Query: 157 SRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
           S SM  L                     P+ +       KSK        N K+D L ++
Sbjct: 205 SASMSCLMNSD-----------------PEHATEFSVCGKSK-------KNSKMDALKKA 240

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK---LNPYE 273
               ++S+ +  + +K+ +  IG   Y   +  N     S    +V+  + +   +N   
Sbjct: 241 VLLFLDSVDRGSKTQKD-THYIGLTGYTTRVEKNIEP--SWGTGKVRKYIVEEIDVNMLG 297

Query: 274 NTNTYPAMHHAYRELYNEKESSHNT--------IGSTRLKKFVIFITDGENSGASAYQNT 325
            T++ PAM  AY+ L ++K+ +           I     +KF+IF+TDGEN+     ++ 
Sbjct: 298 QTDSTPAMKKAYQILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDP---KSD 354

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           + T++ICE  +   +KI +++++A   G+ LL+KC  +   ++ V D+  LL  F  I+ 
Sbjct: 355 VKTIKICEKAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDIST 414

Query: 386 KIQEQSVRI 394
            I     ++
Sbjct: 415 LITHYKYQV 423


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score =  225 bits (573), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 75/410 (18%), Positives = 149/410 (36%), Gaps = 53/410 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V       AID +++   + ++Q A D+A L+   ++ S         +    
Sbjct: 24  MTAIMMPVLLGAAGLAIDYSNMALSKRELQEATDSAALAAATALASGAASTTADAEA-IA 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  ++     I       +    ++ T        Y       Y I       
Sbjct: 83  KDFVSGQMANYV-DTDAISSIKAGTSVDIDVSATAT---SKSYKVTVATSYGIAATPFM- 137

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++     N+   ++     S    A+S+ +VLD S SM +                  
Sbjct: 138 -SVLGYKTLNIGASTSTSSGTSDTKTALSMELVLDQSGSMGEKTTTCA------------ 184

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                           +           KID L ++A  L +++  A  +  +  VR G 
Sbjct: 185 ----------------TYNGKNCKTYVTKIDALKKAADALFDALDTA--DPDHSLVRTGA 226

Query: 241 IAYNIGIVGNQ-------CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
            +YN G++ N         + ++       + ++ +     T+    M  A   +    +
Sbjct: 227 YSYNNGLIYNSQKTQIKSMSGMAWGTATTATYVSGITASGGTDATEPMRQATLSIAKASD 286

Query: 294 S------SHNTIGSTRLKKFVIFITDGENSGASAYQNT---LNTLQICEYMRNAGMKIYS 344
                  +H   G+T + +++I +TDGE +G +    +    N    C+  + AG+KI++
Sbjct: 287 GSDVETQAHAVKGNTIVSRYIILMTDGEMTGNTGVWQSSFDQNVRNQCDATKTAGIKIFT 346

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           VA  AP +G+ LL+ C    G ++      +L+ SF  I  +  +    +
Sbjct: 347 VAFMAPDKGKQLLQYCASPGGNYYEAETMEKLVASFTSIAKEATKAVTLL 396


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 85/400 (21%), Positives = 163/400 (40%), Gaps = 31/400 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TAI I V       A+D+ ++    +Q+Q A         A++ +   + +        
Sbjct: 25  LTAIAIPVVAATAGVAVDVTNMTVSNSQLQQAT------DAAALATATALANGNATTSNA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQ---KAQINITKDKNNPLQYIAESKAQYEIPTEN 117
             +  + +   +        N  D  +    A +    + +    Y     A Y++    
Sbjct: 79  QQLATQFVTGQMSNYLSGDTNTADALKAGTTANVTSATNSSGGTSYTVAVNASYDMSVNG 138

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           +     I +   + +  ST     +++  A+S+ + LD S SM  L      D +  +  
Sbjct: 139 MSQLLGIKTMHVSAASTSTSGSAAAAKQAALSMEIALDKSGSM--LLNTDVIDTSQKSCT 196

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPAN-RKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
           +Y                  +Y  A +P   +KI  L  + G L++ +  A  + K+  V
Sbjct: 197 QYYTEGNY----------LYQYPKAKSPCYIKKIAALKTAVGTLLDQLDSA--DPKSQYV 244

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSR-LNKLNPYENTNTYPAMHHAYRELYNEKESS 295
           R   IA++  +  +  + L+      +S  ++ LN    T +   M  AY+ +    E++
Sbjct: 245 RTAAIAWSSEV--DSSSALAWGTTTTRSNVISGLNANGGTESSAPMALAYKNVSASSEAT 302

Query: 296 HNT-IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
                G+T  +K ++ +TDGEN+  S+      TL  C+  ++AG+ IYSVA  AP  GQ
Sbjct: 303 AQAAKGNTTFQKIIVLMTDGENNATSSDT---KTLATCKAAKDAGVLIYSVAFMAPDRGQ 359

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            LL+ C  S   +F      +L+ +F  I ++  +Q   +
Sbjct: 360 TLLKNCASSPSNYFDAQQMSDLIAAFKTIGNQASKQITLL 399


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 90/447 (20%), Positives = 182/447 (40%), Gaps = 63/447 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           ++A+++ V F+ I   IDL    Y  N +  A++ A LS    +++  +++D + +K  +
Sbjct: 25  ISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTAALSASVQLLN--SVEDKSKEKALS 82

Query: 61  STIFKKQIKKHLKQGSYIR--ENAGDIAQKAQINITKDK--NNPLQYIAESKAQYEIPTE 116
           S + +  IK++L     I    N G++  +  I  TK    N    +I    + Y +P  
Sbjct: 83  SVLGENNIKQYLLNNLKISLYNNFGEMDSQRIIQHTKVNIYNRKGTHIINVYSHYNLPLN 142

Query: 117 N--LFLKGLIPSALTNLSLRSTGII---ERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
              LF   LI      ++      +   +   +   +S+  ++D S SM  +  +    +
Sbjct: 143 PFSLFFMNLINIKSWPITTVGEAEVTSKKNYHKEEGVSVQWLIDDSGSMGSIIDRACFGS 202

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYA------------------------------- 200
             + S   +          + +T+ S Y                                
Sbjct: 203 KQLKSQYNVGSKIGIVRNENADTSDSFYPIVGELVSCDRSLYYVLNDKKILEDDDLEEKN 262

Query: 201 --PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                    RK  ++ ++    +  ++K   +     +R+  + +N  I  +   P++  
Sbjct: 263 LDNHSQYYIRKRYLVRDALATFIKRVRKI--DNLKDKLRMSFMYFNERI--DHYFPMTWG 318

Query: 259 LNE----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITD 313
           + E    V S   + +    T+ +P +  AY +L+++ E   H    S  +KKF++ +TD
Sbjct: 319 IKEFKQEVSSHYKRKHENTATDIHPILQEAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTD 378

Query: 314 G-ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP----PEGQDLLRKCTDSSGQFF 368
           G +N G  +  +    L+IC+  +  G+KI++++ S       +  D L +C  S  +FF
Sbjct: 379 GAQNEGVHSVDS---VLKICDAAKEEGIKIFTISYSVDSSERKKANDFLSRCA-SPDKFF 434

Query: 369 AVNDSRELLESFD-KITDKIQEQSVRI 394
              D+ +L   F   I D I E+ V+I
Sbjct: 435 EAYDADKLNMIFKEHIGDAIFERLVKI 461


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/429 (21%), Positives = 173/429 (40%), Gaps = 72/429 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSD--------RTIKD 52
           + A+ +    L I + I +    Y +N M+SA +AA+L+G + +VS+         +I +
Sbjct: 25  IFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISN 84

Query: 53  PTTKK--DQTSTIFKKQIKKHLK--QGSYIRENAGDIAQKAQINIT-------KDKNNPL 101
              +   D      K  IK+ L      +      +I   ++I++T          NN +
Sbjct: 85  HAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTI 144

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTN--LSLRSTGIIERSSENLAISICMVLDVSRS 159
            Y  +    Y+   +  F++ L+        +S     +     E     I +V+D+S S
Sbjct: 145 FYNMDVMTSYDYRLQ--FIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGS 202

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           M         D N+                                   K+  L  +   
Sbjct: 203 MHCAMNSDPEDVNSAPI-------------------------CQDKKRTKMAALKNALLL 237

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK------LNPYE 273
            ++SI      K+++   +G I Y   +  N     S    +V+  + +      L P  
Sbjct: 238 FLDSIDLLSHVKEDVY--MGLIGYTTRVEKNIEP--SWGTEKVRQYVTRDMDSLILKP-- 291

Query: 274 NTNTYPAMHHAYRELYNEKESSH--------NTIGSTRLKKFVIFITDGENSGASAYQNT 325
            T++ PAM  AY+ L ++K+ S           I S   +KF+IF+TDGEN+    +++ 
Sbjct: 292 -TDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNN---FKSN 347

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           +NT++IC+  +   +KI +++++A P GQ LL+ C  S    + V ++  L+  F  I+ 
Sbjct: 348 VNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQ 407

Query: 386 KIQEQSVRI 394
            +  +   +
Sbjct: 408 LMVHRKYSV 416


>gi|218458490|ref|ZP_03498581.1| von Willebrand factor type A [Rhizobium etli Kim 5]
          Length = 220

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 84/237 (35%), Gaps = 19/237 (8%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +  V       A+ +  ++  + Q+Q A D+A L+   ++ + +     +  +       
Sbjct: 1   MAPVLLGAAGMAVHVGDMLLSKQQLQEAADSAALATATALANGK--IQTSEAEAYARNFV 58

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             Q+  +L+ G        DI     +N+ T        Y       Y++    L     
Sbjct: 59  AGQMANYLQSGV-------DIKGGTSVNVQTSTSGKSTSYQVTVSPSYDLSVNPLMQA-- 109

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
           +     +LS   T +   S    +IS+ + LD S SM +     + D+   T        
Sbjct: 110 VGFKTQHLSTSGTTVGGHSQTQGSISMFLALDKSGSMGESTATVNEDDPTETFTYDCNLH 169

Query: 184 PPKKSF-WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
              K+  W  +    K   +      KI+ L  +AGNL + +  A  +     VR G
Sbjct: 170 YNSKNNKWVYD----KCTGSRTNYYTKIEALKIAAGNLFSQLNSA--DPNAQYVRTG 220


>gi|218678237|ref|ZP_03526134.1| hypothetical protein RetlC8_04927 [Rhizobium etli CIAT 894]
          Length = 120

 Score =  132 bits (332), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 283 HAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAG 339
            A     N+ E + H        KK+++F+TDG+N+  S+   + +T   + C+  ++ G
Sbjct: 4   TAKNAAGNDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTATKKTCDDAKSKG 63

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           ++IY++A  AP  GQ LL  C      +F      +LL +F+ I  K   Q  R+
Sbjct: 64  IEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFEAIGAKSAAQVTRL 118


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 58/407 (14%), Positives = 126/407 (30%), Gaps = 25/407 (6%)

Query: 9   CFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQI 68
                   +D++    + +++++ALDA+ L+   +     +      +    +     ++
Sbjct: 30  VVAAAGATVDISRAYIVESRLKAALDASALAVGGATGMTTSQMQAMAQSFFNANYPASKL 89

Query: 69  KKHLKQGSYIRENAGDIAQKAQINIT--------KDKNNPLQYIAESKAQYEIPTENLFL 120
                       N   ++  AQ+  T            +    +     + E+       
Sbjct: 90  GVPGTLSVSQSGNVVSLSVHAQLPTTLMGVVGINTLNVSATSQVTRMGKKLEVALVLDNT 149

Query: 121 KGLIPSALTNL-----SLRSTGIIERSSENLAISICMV---LDVS-RSMEDLYLQKHNDN 171
             +       +         T +   ++    + + +V   +DV+  +  +     H D 
Sbjct: 150 GSMASGGRMTVLKTAAKNLITTVSAAATNPGDVKVAIVPFNVDVNIGTTNENVSWLHWDE 209

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
              +                     +              +  +   +  N+        
Sbjct: 210 FTPSGGGGNGNGNCNIIQILLGLCNNNNNSNSHAGWEGCVMDRDQNYDAQNTFPPPNPGG 269

Query: 232 KNL--SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
            N        + + N         PLS N + + S ++ +    NTNT   +   +  L 
Sbjct: 270 SNATRYPASNSDSDNSNCNLQTIMPLSTNWSALNSHIDAMASAGNTNTTIGLAWGWNMLT 329

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN----TLNTLQICEYMRNAGMKIYSV 345
                S     +  L K ++F+TDG+N+      N       T  IC  ++ AG+K+YSV
Sbjct: 330 QGGPLSSAAAPAANLDKVIVFLTDGDNTRNRWSNNSNTINARTTLICNNIKAAGIKVYSV 389

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            V        L+R C    G +++V  + EL   F  I   +    +
Sbjct: 390 RVIE--GNATLIRNCATEPGMYYSVTTASELTSVFASIAQSLSNLRI 434


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 77/407 (18%), Positives = 137/407 (33%), Gaps = 45/407 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ + V F F+  AID + + Y R ++Q A D+AVL    ++ S              
Sbjct: 32  IFALSVFVIFGFVGAAIDFSRVDYARRRLQDAADSAVL-RAMALKSATDESRGVAADKAF 90

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +  F      +   G+  RE   +I                 Y   +           + 
Sbjct: 91  AENF-GHPGVYDLNGALKREVNENII-------------SQTYTVHATVS-------SYF 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
                      S   T + +  +      I  VLD + SM +       +   D+     
Sbjct: 130 GAFFGKD----SYPVTVVSQAKTSLDVFEIAFVLDTTGSMAEANKMPNLKSSVDSAMAGL 185

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ-EKKNLS 235
            +        K       T+ + + A          L    GN V+    A   +    +
Sbjct: 186 LQNGKNLSGSKIAVVPFNTQVRLSDATVTTMSS-QGLSSGWGNCVHDRDLATSHDVSASA 244

Query: 236 VRIG--TIAYN----IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
            + G     Y               LS+N++  ++ +  L P   TN    +      L 
Sbjct: 245 AQKGKAQTLYPLETCDEASLKPVQGLSDNISSARNFIKTLQPGGYTNVTMGVQWGMEVLS 304

Query: 290 -NEKESSHNTIGSTRLKKFVIFITDGEN----SGASAYQNTLNTLQICEYMRNAGMKIYS 344
            N+  S     GST+ +KF+I +TDG+N    +  SA      T   CE  +  G+ +Y+
Sbjct: 305 PNQPFSDATEFGSTKARKFMIVVTDGDNTKSFTSWSASVIDKRTALACENAKAKGITVYT 364

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           V +       ++LRKC  +   F+ +  + +L  +   I   I +  
Sbjct: 365 VKII--QGNSNMLRKCASAPEYFYDLTSANQLNAAMSGIFKSINKTR 409


>gi|302382135|ref|YP_003817958.1| von Willebrand factor A [Brevundimonas subvibrioides ATCC 15264]
 gi|302192763|gb|ADL00335.1| von Willebrand factor type A [Brevundimonas subvibrioides ATCC
           15264]
          Length = 560

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 89/280 (31%), Gaps = 44/280 (15%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           D + S                 ++   P       W            P           
Sbjct: 281 DTAPSSGTQATMFVPYFAPDEPDRADYPNHSTWQNWQYEGNDYLDDGRPGSNANSPFANT 340

Query: 215 ESAGN----LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
            +        V S+ +     +N ++  G    N G        L++N   +++ +N + 
Sbjct: 341 AARTTEWFARVRSVSRYSTTPRN-TLNTG-FGPNRGCDLQPIIRLTDNYTALRTAVNNMI 398

Query: 271 PYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVIFITDGENSGASA-------- 321
              NTN        +  L  N         G+ RLKK +I +TDG N  +          
Sbjct: 399 ASGNTNVPLGTMWGWHTLSPNAPFGDGRPYGTERLKKIIIIMTDGANVMSDTTSPNDSTY 458

Query: 322 ------YQNTLN-----------------------TLQICEYMRNAGMKIYSVAVSAPPE 352
                 +QN L                        T  +C  M++  +++Y+VAV     
Sbjct: 459 NGLGYIWQNRLGIVSGNDTTRRTRMDNRFDHATAATEDMCGNMKDKDIEVYTVAVQVDST 518

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            Q LLR+C   +  +F V+ +  +  +FD+I   I+   +
Sbjct: 519 AQTLLRRCATDTDHYFPVDSAAGIGAAFDRIAGAIENLRI 558


>gi|114704798|ref|ZP_01437706.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
 gi|114539583|gb|EAU42703.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
          Length = 545

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/152 (23%), Positives = 70/152 (46%), Gaps = 11/152 (7%)

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
              T L+ +L  V++ +NKL P  NTN    +      L      +    GS  ++K +I
Sbjct: 398 EPITGLTFDLQSVETAVNKLTPSGNTNVTIGVQWGMEALTAAAPLTGVRTGS-EVRKVMI 456

Query: 310 FITDGENSGASAYQN------TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDS 363
            +TDG N+    + +         TL  C   +  G+++Y+V +      +DLL+ C ++
Sbjct: 457 VLTDGLNTQNRWWGSRDRNKIDARTLAACNNAKAMGIELYTVRLV--EGNEDLLKTCAET 514

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
             ++  V  + +L  +F  +  ++  + VR+A
Sbjct: 515 EDKYHYVTSASQLKTTFADLARQV--KGVRLA 544



 Score = 48.0 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 54/380 (14%), Positives = 122/380 (32%), Gaps = 56/380 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +T + +         A+DL +   ++N +Q+A+D + L+  +      + ++ T ++ + 
Sbjct: 42  ITCLALVPLIAAAGGAVDLWNARRVQNAVQNAVDTSALAAVS-----YSGEEQTEREKRA 96

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            T+F         + + + E  G    KA+                    Y+I T  L +
Sbjct: 97  DTLFLNNTAGIAIEDTDLSEEDGAWVYKAE--------------------YKIKTNFLRV 136

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME-DLYLQKHNDNNNMTSNKY 179
            G+                  +  N  + + +VLD S SM  D  + +   +  +   ++
Sbjct: 137 VGID-------EFEMESQGAAALANSPMDVVLVLDSSGSMAQDNRMVELKASVKLFLEEF 189

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                 + +    +T     +     A         + G        +     +   R  
Sbjct: 190 KSNDLTQVALVPFDTQVKATSSLFGAAGNVSVANPLATG--------SCATISDPLDRDA 241

Query: 240 TI-AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
              + N       C+ L++ ++ V   +N L     T     + +    + + +  +   
Sbjct: 242 CYASQNAAPPVVDCSKLTDLIDAVLCGVNNLGFKVGTTAITDLRY----ISDRRYDAFID 297

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
               R+ + +    + + S    ++ T +T  I E     G    S    A     DL+ 
Sbjct: 298 GNMFRITRKI---GEADCSSVCTWKKTYSTTTIFETAAGGGAPATSKPNDAETPNNDLIA 354

Query: 359 -------KCTDSSGQFFAVN 371
                  +C     Q +  N
Sbjct: 355 QYPGPWPRCFVDRSQPYDAN 374


>gi|323700353|ref|ZP_08112265.1| von Willebrand factor type A [Desulfovibrio sp. ND132]
 gi|323460285|gb|EGB16150.1| von Willebrand factor type A [Desulfovibrio desulfuricans ND132]
          Length = 400

 Score =  120 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/426 (12%), Positives = 133/426 (31%), Gaps = 73/426 (17%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A+++ V       A+D+ ++     ++Q+A+DA  L+G   +  D  +            
Sbjct: 2   ALLLPVLLGVAGIAVDMGNMYMTHTRLQAAVDAGALAGSLELPYDPDLSKGIV------- 54

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
               Q    + + +       +I+   +I              +  AQ E+    + L  
Sbjct: 55  ---TQAVNDMVETNMEEAVVTEISAGTEIR-----------SVKVTAQAEVR---MLLME 97

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
           ++  A   +   +     +      + +  V+D S SM+   +      +   ++  +  
Sbjct: 98  VLGMADKTVEASAMAGFNK------LEVVFVIDNSGSMKGTPIDLVKQASEELTDLLIPD 151

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN--LSVRIGT 240
                +       + K     A  +   +  + + G+L   I +   ++ N         
Sbjct: 152 GTTPDTKVGLVPFRGKIRLGEA-VDGYAEGCVNADGSLNTGINEEFMDEYNALPYYYKRY 210

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHN 297
           I  +         PLS N + + + +           T     +      L  +   +  
Sbjct: 211 ITLDTCSDIPTVLPLSKNKSTIIAAIGSQTATGAASGTVISEGIKWGRNILTPDAPFTQA 270

Query: 298 TIGSTRLKKFVIFITDGE-----------------NSGASAYQNTLNTLQICEY------ 334
                  +K +I +TDG+                 N   +AY         C        
Sbjct: 271 GSK-EDFRKIMIVLTDGDTEDGECGGTYRATYRPNNYWTNAYYGMGVDTAHCNDGGVLNA 329

Query: 335 --------MRNAGMKIYSVAVSAPPEGQ-DLLRKCTDS----SGQFFAVNDSRELLESFD 381
                    ++AG++I+S+   +      +L+++   S       +F      ++ + F 
Sbjct: 330 DMLSEAQLAKDAGIEIFSIRFGSSDTTDINLMKEIASSKAGTDDHYFDAPSVYDIPDIFK 389

Query: 382 KITDKI 387
           +I  ++
Sbjct: 390 QIGKQL 395


>gi|170751925|ref|YP_001758185.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658447|gb|ACB27502.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 568

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 71/200 (35%), Gaps = 56/200 (28%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK--------ESS 295
           N G        L+NN N +K+ +N + P  +TN +      +R L             SS
Sbjct: 362 NFGCTTQPLQRLTNNTNALKTLINNMAPSGSTNIHEGFMWGWRTLSPNSVFADGQPYASS 421

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL-------------------------- 329
            N+  +T + K +I +TDG NS  +       +L                          
Sbjct: 422 ANSSNATNINKIIILMTDGTNSWGTNSSAPTGSLYFAAGYFRNANGTTPNPRLTTAYQNT 481

Query: 330 -----------------QICEYMRNAGMKIYSVAVSAPPE-----GQDLLRKCTDSSGQF 367
                            + C   +   + IY++  S P +     GQ LLR C  S  QF
Sbjct: 482 NIADGNTARKALDALTAEACANTKAVNISIYTIGFSVPTDPIDSAGQTLLRNCASSPDQF 541

Query: 368 FAVNDSRELLESFDKITDKI 387
           +  N S +L+++F  I   I
Sbjct: 542 YLANSSDDLIKAFKSIQASI 561



 Score = 37.6 bits (85), Expect = 3.5,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 60/195 (30%), Gaps = 28/195 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A +     +    AID      +  ++Q+A DA  L  C + +        TT + + 
Sbjct: 30  LFAFLSVPMVMIGGAAIDYGFATRLETKLQTATDATALLLCQTPL--------TTSEAEL 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T+ +  +   +   + + +     +   +I +T  K +                   F 
Sbjct: 82  NTLAQTTMTGAMGAANLVVDRLAITSSPRKITLTAHKQSTT-----------------FF 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL  +   N    S              I +VLD + SM      +       T+    
Sbjct: 125 GGLTGTQRINPGAVSQCATPLPKT---FEIALVLDNTGSMAASSGGQSKLRAVQTAATDF 181

Query: 181 LPPPPKKSFWSKNTT 195
           +        +S  T 
Sbjct: 182 VNYVYTSPAFSSATK 196


>gi|149922008|ref|ZP_01910450.1| hypothetical protein PPSIR1_18327 [Plesiocystis pacifica SIR-1]
 gi|149817173|gb|EDM76653.1| hypothetical protein PPSIR1_18327 [Plesiocystis pacifica SIR-1]
          Length = 996

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 19/170 (11%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAY-NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT 277
           +LV    +A     + S  IG IA+ N   V  +  P +N L  + S + +L+    TN 
Sbjct: 547 DLVKEAARATARTLDPSDEIGVIAFDNSPQVLVRLQPAANRL-RISSSIRRLSAGGGTNA 605

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
            PA+  AY +L           GS  L K VI ++DGE+      +N +N L     MR 
Sbjct: 606 MPALREAYLQLA----------GSKALVKHVILLSDGESP-----ENGINAL--LGDMRQ 648

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           + + + SV V        L+R      G++F   D  ++   F +   ++
Sbjct: 649 SDITVSSVGVGDGAGKDFLIRVAERGRGRYFYSEDGTDVPRIFSREAREV 698


>gi|254501086|ref|ZP_05113237.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
 gi|222437157|gb|EEE43836.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
          Length = 465

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 68/462 (14%), Positives = 149/462 (32%), Gaps = 94/462 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ V  +    AID++  +  R ++  A+DAA LS    + +         + +Q 
Sbjct: 20  IFAGMVLVLVVIGGAAIDISRAVNAREKLAYAIDAAALSVATDLST------TVLRDNQI 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            T  +   + +L    ++ +   +      ++   D N          +   +    L +
Sbjct: 74  KTRIENSFRANLSDAEFLDQAIDN------LDFDVDSNAGT---VTVSSSAGLNNYFLNI 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME--------------DLYLQ 166
            G     L           E +     + + +V+DV+ SM               D+ ++
Sbjct: 125 PGFGKDGLGPDVFNFGTSAEVNYSRFDVELALVVDVTGSMAGDMGALRDAAEEVVDILIE 184

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
               N+       L+P     +  S  +T +  + +      + +   +    + N    
Sbjct: 185 DDASNSASKVRISLVPYSQGVNLGSYASTVTNGSTSWRNCVNEREGQQKYTDAVYN---- 240

Query: 227 AIQEKKNLSVRIGTIAY--------------NIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
                 +     G  +Y                    +   PL+++ N + S +  L+  
Sbjct: 241 -YDGTNSEYFH-GLQSYFIWDYGSSENWSSARDDCPSSSLQPLTSDKNTLISDIRNLSSG 298

Query: 273 ENTNTYPAMHHAYRELY----------NEKESSHNTIGSTRLKKFVIFITDGE-NSGASA 321
             T     +   +  L           ++ E   N      +KKF + +TDG+ N+    
Sbjct: 299 GGTGGQTGVAWGWYTLSPNWTSLWPTDSDPEPYGNGTPDDDVKKFALIMTDGDFNAQYGK 358

Query: 322 YQNTLNT--------------------------------LQICEYMRNAGMKIYSVAV-- 347
            + T  T                                  +C+ M+   ++I++V    
Sbjct: 359 EERTTCTGRGRNRVCTTNEYWVERYHRYSDYNDPPATRARTLCDAMKAENIEIFTVFFDT 418

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                G DL+  C   S  ++  ++  EL+ +F  I  +IQ+
Sbjct: 419 GGSAFGDDLMSYCASGSDYYYEADNKDELITAFSNIAKRIQQ 460


>gi|114705525|ref|ZP_01438428.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
 gi|114538371|gb|EAU41492.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
          Length = 461

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/461 (12%), Positives = 131/461 (28%), Gaps = 77/461 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   I+ +        +D+     +   +Q A+D A L    +       ++   +    
Sbjct: 1   MALAILPMLLAVGG-TVDVGRQSSLATDLQEAIDIAALHIAKAPSDAIPGEEDVLQL-IK 58

Query: 61  STIFKKQIKKHLKQGSYIRENAG------------------DIAQKAQINITKDKNNPLQ 102
           S I  K  +  LK+     ++                    ++  +      ++    ++
Sbjct: 59  SNITTKDSRIALKKLDVTEKDVSLHATAEITPFFLGLAGIKNLTAQRATKTAREARGEIE 118

Query: 103 YIAESKAQYEIPTENLF----LKGLIPSALTNLSLRSTGIIERSSENLAISICM------ 152
                   + +  ++      L  L  +A   +    T   +     +  +  +      
Sbjct: 119 VALVLDTTWSMSEKDSSGKSRLDSLKGAAAKLVDTIFTEDGKTRVAVVPYADYVNVGTQH 178

Query: 153 ----VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
                LDV  S      ++  +     +      P  + +      ++S        ++ 
Sbjct: 179 RNQSWLDVPPSYSTTPSERRCETRTTRTQCTSYAPTYQCTRTVDGVSESTTCGGGCTSSE 238

Query: 209 KIDVLIE-----------------SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ 251
            + V                     A   V   +             G +          
Sbjct: 239 TVQVAPYEYCTGGGSSRTYDWYGCVASRTVGDYRLTDARPDIRY--PGFLG-TSRECPGP 295

Query: 252 CTPLSNNLNEVKSRLNKLNPYEN-----TNTYPAMHHAYRELYNEKESSHNTI--GSTRL 304
              LS    +VK+ ++ L+         T     +      L              +   
Sbjct: 296 LLSLSTREADVKTSISNLSYGGGGYRPSTFIPAGLIWGLNVLSPPAPFEEQAYDPNNKLP 355

Query: 305 KKFVIFITDGENS---------------GASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
           +K ++ +TDG N+               G    Q+  +T+ IC  ++ +G++I++V    
Sbjct: 356 RKALVLMTDGANTMVFNSSDGRHRNARSGTEVAQSDRDTISICNNIKRSGIEIFTVGFMV 415

Query: 350 -PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 DLL++C      +F      EL  +F +I D + +
Sbjct: 416 NSSSALDLLKECATDGEHYFDATSPEELHSAFGRIADGLTQ 456


>gi|110679843|ref|YP_682850.1| hypothetical protein RD1_2614 [Roseobacter denitrificans OCh 114]
 gi|109455959|gb|ABG32164.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 488

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 71/478 (14%), Positives = 152/478 (31%), Gaps = 117/478 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
              +++ +  L    A+DL     +R ++Q+ LD A+L+          +  P    +  
Sbjct: 34  FATMMVLMMLLVCGIAVDLMQNEMMRTRVQNTLDRAILAAS-------DLDQPLPADEVV 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F K                 D  Q          N     + +++A+   P+  + +
Sbjct: 87  DDYFAK----------AGMTEFLDDVQITPGAHLPTTNFR---VVQAEARTRTPSIYMAM 133

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-------------- 166
            G     + +L +   G  E + EN  IS  +VLD+S SM +                  
Sbjct: 134 TG-----VRSLPVYVAGTAEETIENTEIS--LVLDISGSMRNNGKIGNLRTAAKDFIGAV 186

Query: 167 ---KHNDNNNMTSNKYLLPPPPKK-----------SFWSKNTTKSKYAPAPAPANRKIDV 212
                 +  ++    Y     P             + + +++  ++        + + + 
Sbjct: 187 LEGNAANTTSLNIVPYAGQTNPGPIVFQRAGGRPFATFIEDSDGNEILYGQTFVDDEGNS 246

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIG--------------TIAYNIGIVGNQCTPLS-- 256
           +      + + +     +  N+ +  G                  + G      + +   
Sbjct: 247 IDVPYNTMSSCLDLTNGDFDNIDLPSGGYDQTPYFMNWPIDAPTMDWGWCPQNKSSIRYA 306

Query: 257 -NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI---------------- 299
            NN  +++  ++ +  ++ T T   M +    L      +   +                
Sbjct: 307 QNNAGQLQDFIDDMRLHDGTGTQYGMKYGVALLNPSSRDTFVALNAAGLVPDGFKDRPAD 366

Query: 300 -GSTRLKKFVIFITDGE---------------------------NSGASAYQNTLNTLQI 331
            G+T  +KF++ +TDG+                           ++ A+   N  N   I
Sbjct: 367 FGTTDTRKFIVLMTDGQITDQFRPEDKNDPKNDEIALNQRIGDRDTYATQSTNVANFYSI 426

Query: 332 CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           C   + AG+ +Y++A  AP      +R C  S   F+ V    E+  +F  I  +I E
Sbjct: 427 CNKAKAAGITVYTIAFEAPANAITQMRTCATSPAFFYKVE-GVEIKTAFKSIARQINE 483


>gi|163731887|ref|ZP_02139334.1| hypothetical protein RLO149_21324 [Roseobacter litoralis Och 149]
 gi|161395341|gb|EDQ19663.1| hypothetical protein RLO149_21324 [Roseobacter litoralis Och 149]
          Length = 468

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 63/478 (13%), Positives = 147/478 (30%), Gaps = 117/478 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
              I++ +  L    A+DL     +R ++Q+ LD A+L+          +  P    +  
Sbjct: 14  FATIMVLMMLLVCGIAVDLMQNEMMRTRVQNTLDRAILAAS-------DLDQPLPADEVV 66

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F K                 +  +    +     N     I +++A+   P+  + +
Sbjct: 67  DDYFAK----------AGMTEFLNDVRITPGSDLPTTNFR---IVQAEARTRTPSIYMAM 113

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-------------- 166
            G     +  L +  +G  E + E + IS  +VLD+S SM +                  
Sbjct: 114 TG-----VRTLPVYVSGTAEETIEKIEIS--LVLDISGSMRNNGKIGNLRTAAKDFIGAV 166

Query: 167 ---KHNDNNNMTSNKYLLPPPPKKSFWSK-----------NTTKSKYAPAPAPANRKIDV 212
                    ++    Y     P +  + +           ++   +        + + + 
Sbjct: 167 LEGNAAKTTSLNIVPYAGQTNPGRIVFERAGGLPFATFIEDSNGDEILYGQTIVDDEGNS 226

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ--CTPLSNNL----------- 259
           +      + + +     +  N+ +  G        +        +               
Sbjct: 227 IDVPYNTMSSCLDLTNSDFDNIDLPSGGYDQTPYFMNWPIDAPTMDWGWCPQNNSSIRYA 286

Query: 260 ----NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI---------------- 299
                 ++  ++ +  ++ T T   M +    L     ++   +                
Sbjct: 287 QNDAGRLQDFIDDMRLHDGTGTQYGMKYGVALLNPSSRNTFLALNAAGLVPDGFKNRPAD 346

Query: 300 -GSTRLKKFVIFITDGE---------------------------NSGASAYQNTLNTLQI 331
            G+T  +KF++ +TDG+                           ++ ++   N  N   +
Sbjct: 347 FGTTDTRKFIVLMTDGQITDQFRPEDKNDPKNDEIALNQRTGDRDTYSTQSTNVTNFYSV 406

Query: 332 CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           C   +  G+ +Y++A  AP +    +R C  S   F+ V    ++  +F  I  +I E
Sbjct: 407 CNKAKAEGITVYTIAFEAPADAVTQMRTCATSPAFFYKVE-GVQIKTAFKSIARQINE 463


>gi|317154611|ref|YP_004122659.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
 gi|316944862|gb|ADU63913.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
          Length = 395

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/426 (12%), Positives = 132/426 (30%), Gaps = 83/426 (19%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           +       A+D+ ++     ++Q+A+DA  L+G   +  D  +     +          Q
Sbjct: 1   MLLAVAGLAVDMGNMYVTHTRLQAAVDAGALAGSLELPYDPDLSKGIVQ----------Q 50

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
               +   +        ++   ++            +  +KA+      NL + G +  A
Sbjct: 51  AVSDMIHTNMPDAVVESVSPGTEVR---------SVVVTAKAKV-----NLLVMGFLNLA 96

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
              +   +     +      + I  V+D S SM+   +    + +   ++  +       
Sbjct: 97  DQWVEAGAAAGFNK------LEIVFVIDNSGSMKGTPINLVKEASIGLTDLLIPDGQQPD 150

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI-QEKKNLSVRIGTIAYNIG 246
           +       + K           +D L     N   S+   I ++  ++   + +  Y   
Sbjct: 151 TKVGLVAFRGK-----VRLGGDVDGLEAGCRNADGSVNTGIHEDFMSMYWALSSY-YRNQ 204

Query: 247 IVGNQCT------PLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHN 297
           I  + C+      PLS +  ++   +N          T     +  A   L  E   +  
Sbjct: 205 IDLDTCSSIPESRPLSQDKGDIVEGINSQTALGSASGTVISEGIKWARHMLTPEAPYT-Q 263

Query: 298 TIGSTRLKKFVIFITDGE----------------NSGASAYQNTLNTLQI-CEY------ 334
                  +K +I +TDG+                N+  +     +      C+       
Sbjct: 264 AGDKKDFRKIMIVLTDGDTEDGECGGSYRASFRPNNYWTNAYYGMGVDTAHCQDGGVLNQ 323

Query: 335 --------MRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSS----GQFFAVNDSRELLESFD 381
                    ++ G++I+++           L+++   S       +F      ++ + F 
Sbjct: 324 DMLAEAQLAKDEGIEIFAIRFGVSDNTDISLMKQIASSKAGTNDHYFDAPSVYDIPDVFK 383

Query: 382 KITDKI 387
           KI  ++
Sbjct: 384 KIGKQL 389


>gi|114798549|ref|YP_759188.1| hypothetical protein HNE_0458 [Hyphomonas neptunium ATCC 15444]
 gi|114738723|gb|ABI76848.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 460

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 79/445 (17%), Positives = 149/445 (33%), Gaps = 58/445 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ I        +AID       + ++Q A+D+AVL+   S+   +  KD      + 
Sbjct: 19  IAALTIIPIVGIAGFAIDFQVTTTQKARVQQAVDSAVLAATKSM---QDGKDRAYSLKEA 75

Query: 61  STIFKKQIKKHLKQGSY-----------IRENAGDIAQKAQINITKDKN-NPLQYIAESK 108
           +  FK  + +    G               E  G +       ++K      L +   S 
Sbjct: 76  NDYFKGILNQSNNSGLNCTNIDLVYIDETEELEGHVECSQNTTLSKVAGIRHLDFNVSSA 135

Query: 109 AQYEI-PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVL----DVSRSM--- 160
           A Y I   E  F+  +  S   +  + +  +  R + N  + +        DV  +M   
Sbjct: 136 ATYGIGKLEIAFVFDVSGSMANDNRMGNLKVAAREAVNTLLPVEGYAGDPEDVRLAMVSY 195

Query: 161 ------EDLYLQKHNDNNNMTSNKYLL-PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
                    +    N +   T   Y           +  N T  ++         +   +
Sbjct: 196 DTMVNAGPYFKAVTNQDPERTEPFYGYIRERTTCRRYRNNGTCREWNYEWRGPYHRSYTI 255

Query: 214 I-ESAGNLVNSIQKAIQEKKN----LSVRIGTIAYNIG----------IVGNQCTPLSNN 258
                     + +       +      V     +YN               N   PL+ N
Sbjct: 256 KSTCVWEREGAERYTDASPGHNRWLPPVSATFDSYNDSWSTDHQTDPWCNDNTPIPLTYN 315

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL-------KKFVIFI 311
            N++   ++ + P  NT  +      +  L + + +S    GS  L        K VI +
Sbjct: 316 RNKLHDFIDDMTPRRNTAGHIGQAWGW-YLVSPEWNSVWPAGSKALPYDEPDATKVVIMM 374

Query: 312 TDG---ENSGASAYQNTL-NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQF 367
           +DG   E    +AY +++     IC+ M+   + IY+V   A   GQD+L  C  +    
Sbjct: 375 SDGQYNETRHNNAYPSSVTQAEAICDKMKEKEVVIYTVGFDA-GYGQDVLNYCASNPAFA 433

Query: 368 FAVNDSRELLESFDKITDKIQEQSV 392
           +   + +EL E++  I   I +  +
Sbjct: 434 YKPTNGQELTEAYKSIARSISDLRI 458


>gi|307943467|ref|ZP_07658811.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773097|gb|EFO32314.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 466

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 59/454 (12%), Positives = 139/454 (30%), Gaps = 89/454 (19%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           +  +    A+D    +  R+++ +A+DAA L+    + +          ++Q  T  K  
Sbjct: 31  ILLVVAGSAVDYGRALGYRHKIANAVDAAALTVAKQLST------TVLTENQIRTGLKNA 84

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
            + +L       +   +      ++   D         +  +  +I T  + L G+ P  
Sbjct: 85  FRANLNAAGINSQGIDN------LDFKVDPGEGT---LDVWSSVDIQTNFIKLGGIGPEK 135

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
                L      + +     + + +VLDV+ SM          + ++ +         ++
Sbjct: 136 -----LEVGAASQVNYSRFDVELALVLDVTGSMRPDMNALKEASKSIVNILLPDDSNSRE 190

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA----- 242
           S    +               ++     +  N VN      +         G+ +     
Sbjct: 191 SKVRISLVPYSQGVNLGSYATRVTNGGSTWRNCVNERSGPQKFTDAPYNYAGSRSDFFHG 250

Query: 243 --------YNI---------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
                   Y                   PL+ +  ++   ++ L     T     +   +
Sbjct: 251 KPKQFVWDYGWTEQWQTRPEACPKTAVEPLTADRTKLLRAISGLKDGGGTGGQTGIAWGW 310

Query: 286 RELY----------NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT---------- 325
             L           +   +      +   KKF + +TDG+ + A  +             
Sbjct: 311 YTLSPKWKNLWPRDSAPATYGTGSHTDDTKKFALIMTDGDFNAAYGWDCGCRKIRDKPLY 370

Query: 326 -------------------------LNTLQICEYMRNAGMKIYSVAVSAPPE--GQDLLR 358
                                        ++C+ M++  ++I++V         G DL+ 
Sbjct: 371 CRKKSNKKSWIERYFSPSKISHAPAQRAKKLCDEMKSKNIEIFTVYFDTGGATFGDDLMS 430

Query: 359 KCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            C   S  ++  ++S EL+++F  I ++IQ   +
Sbjct: 431 YCASGSRNYYRADNSNELIQAFSNIANEIQSIYI 464


>gi|84502751|ref|ZP_01000870.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
 gi|84389146|gb|EAQ01944.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
          Length = 470

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 59/472 (12%), Positives = 134/472 (28%), Gaps = 112/472 (23%)

Query: 1   MTAIIISVCFL---FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           M A+++ +           +D+      R ++Q  +DA+ L+                K+
Sbjct: 33  MLALVMFMLLTMMTVAGIGVDVMRTEMERTRIQQVIDASTLAAA------HKDNALDPKQ 86

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                  K  +  ++                   +             E     ++  + 
Sbjct: 87  VVLDYFDKAALASYI-----------------SADDILVGGGETSTAVEVNLTAQV--KT 127

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDL-------------- 163
            F++ L  +   N+  R        +      + +VLD+S SM+D               
Sbjct: 128 PFIRHL-GNESFNVPARGRAEQAYGNSE----VSLVLDISGSMDDNRRMSRLHRAANEFV 182

Query: 164 ---YLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                    D  +++   Y          +S+   +  +  +        D    +    
Sbjct: 183 DTVLTPDSVDRVSVSLIPYTGDVNVGWDIFSRMNVRQLHDYSYCVQFTPDDFSTTAIDPE 242

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
              IQ   Q   ++  R   I+          TP S N   +++++N+L   E T+ +  
Sbjct: 243 DAYIQG--QHFSHVDARFNYISCPT-QSYETVTPFSQNNAALEAQINRLTGRERTSIHIG 299

Query: 281 MHHAY----------------RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA--- 321
           +                      + +E         ++   K ++ +TDG N+       
Sbjct: 300 IKWGAAMLDEAFRPLVNDLVDNSIVDEAFRDRPAPFTSNTLKVIVVMTDGMNTETKRIKE 359

Query: 322 -------------------YQNTLNT--------------------LQICEYMRNAGMKI 342
                              + N ++                       IC   +  G+ I
Sbjct: 360 FAYDTPDMRAHWARHAMDDWDNDVDGSVEDHLFDTYYDTAIGNALLQNICNAAKANGIII 419

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           YS+      +    +  C  S   F+ V    ++ E+F  I  ++++  + +
Sbjct: 420 YSIGFEINNDAAQEMEDCASSPSHFYRVE-GVQISEAFSSIAQQLKQLRLTL 470


>gi|118591415|ref|ZP_01548813.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
 gi|118436087|gb|EAV42730.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
          Length = 474

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 62/468 (13%), Positives = 144/468 (30%), Gaps = 98/468 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +++ +  +     ID++  +  R ++  A+DAA LS  A + +           +Q 
Sbjct: 27  VFGLMVVLIVVIAGITIDVSRTVNAREKLSFAIDAAALSVAADLST------SVMSDEQI 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                   K +L    ++ E   ++       +  +          +   Y I      +
Sbjct: 81  KAALADSFKANLADVEFLDEAIKNL----SFVVDAENGTIKVSSFATLDNYFIDMGGYGM 136

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           + L P      +       + +     + + +V+DV+ SM     +   D     S   +
Sbjct: 137 QALGPE-----TFNFGTSSQVTYSRFDVELALVVDVTGSM-----RNDMDTLRDASKGLV 186

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI--------QEKK 232
               P+ +  + +  +    P     N          G +      ++         + +
Sbjct: 187 NILIPETTEEADSKVRISLVPYSQGVNLGTYAAK-VKGGVYGYADSSVCVTERQDYDDGE 245

Query: 233 NLS-VRIGTIAYNIGIVGNQCT-------------------PLSNNLNEVKSRLNKLNPY 272
           ++  VR   + YN  +  +                      PL+ + + +   +  L+  
Sbjct: 246 DIYKVRYTDMPYNYYVKTDPPPKDVFYGGGSNRCSGTSKMIPLTADRDTLLDAIADLDDN 305

Query: 273 ENTNTYPAMHHAYRELYNEKES------SHNTIGSTRLKKFVIFITDGENS--------- 317
             T     +   +  +                  +  + KF I +TDG+N+         
Sbjct: 306 GGTAGQTGVVWGWNSISPNYSDVWPLASKPEPYDNDDVLKFAIIMTDGDNNRFYEFVKER 365

Query: 318 --------------------GASAYQNTLNT-----------LQICEYMRNAGMKIYSVA 346
                                 + +Q    +             +C+ M++ G+ I+ V 
Sbjct: 366 EECDWVYSRRYGWQWTCEMVSVNQWQERSESESYNNNSSKAQRALCQAMKDEGISIFGVY 425

Query: 347 V--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              +    G   ++ C  + G ++    S EL+ +F  I  KIQ+  V
Sbjct: 426 FGTNDSSAGSKNMQSCAST-GNYYKATSSDELINAFANIAKKIQQIYV 472


>gi|300023811|ref|YP_003756422.1| von Willebrand factor A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525632|gb|ADJ24101.1| von Willebrand factor type A [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 466

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 72/434 (16%), Positives = 142/434 (32%), Gaps = 60/434 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  ++  V F  I  A+D    +  R+Q  +A DAAVL+G  ++ ++   +         
Sbjct: 43  LFGLMALVLFAMIGLAVDYGRFVNARSQTIAATDAAVLAGARALQTNGGDQAAAL----- 97

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + +    +  K    +  +  + A            N    +    A    P   L  
Sbjct: 98  -RVAQSYYAQATKNRLSLSNDTINFAIAD---------NATAMVTTGNAVITTPFMGLAG 147

Query: 121 KGLIPSALTNLSLRSTGIIERSS-ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
            G +P    + S  S  ++       L + I M+LD++ SM    L       +   N  
Sbjct: 148 TGSLPILRKDGSDYSKAVLAVGGNAELNLEIAMMLDITGSMRGQKLTDMKAAASDLLNIV 207

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI-------------ESAGNLVNSIQK 226
           +     K +        +     PA A +K                  E   +   +  K
Sbjct: 208 VWTDQSKFTSKVAIVPFAYDVRLPAAAFKKATGTTSTNYPCVVERTGTEKYTDAAPATGK 267

Query: 227 AIQEKKNLSVRIGTIAYN---IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
            +      S +     Y+         +  PL+++ + + +++N L+   +T  +     
Sbjct: 268 YVMVHNTSSTKKNKTTYSPTCDVASSAEVLPLTSDKSTLLAKVNGLSTAGSTAGHIGTAW 327

Query: 284 AY-------RELYNEKESSHNTIGSTRLKKFVIFITDGENSG------------------ 318
           A+         L+    S+     +  L+K  + +TDGE +                   
Sbjct: 328 AWYMLAPNWSSLWTSASSTPAAYNADNLRKIAVLMTDGEYNTQYTTNGVPDDSSSLTRCP 387

Query: 319 --ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-APPEGQDLLRKCTDSSGQFFAVNDSRE 375
             A+   ++   +  C  M+  G+++Y+V          D L +C   S  F+       
Sbjct: 388 NAANGVCSSAQAVSQCTAMKAKGIEVYTVGFQLDNQTAIDTLSQCATDSSHFYNSTTGDA 447

Query: 376 LLESFDKITDKIQE 389
           L  +F  I  KI  
Sbjct: 448 LKAAFRDIALKIST 461


>gi|288956977|ref|YP_003447318.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
 gi|288909285|dbj|BAI70774.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
          Length = 456

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 57/438 (13%), Positives = 126/438 (28%), Gaps = 63/438 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+   V    +  AID A   ++ +++  A DAA L+               +  DQ 
Sbjct: 32  MVALSFLVLLGMLGVAIDFARAQFVSSRIYYAADAATLAVS-------RENFQVSTNDQL 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN-LF 119
             + +     +           G +     +++      P            +P      
Sbjct: 85  KALAQSYFDANF--------PPGTMGATTSLSVATSGTPPTVQGFTVTVTATLPLVFAPL 136

Query: 120 LKGLIPSALTNL---SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
           ++ L    + ++            ++S    + + +VLD S SM+            +  
Sbjct: 137 VETLGGPTIGSVGISKASGAVFTTQTSNQGGMELVIVLDNSASMKGSQEDLRGGVKALLD 196

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
             Y      K  +              +    K D++    G + N     +  K N S 
Sbjct: 197 MLYGNADTRKNLYVGIVHYSGAVNVLQSALKNKADIVAPVVGGMANCPMATVNGKLNGSR 256

Query: 237 RIGT---------------IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAM 281
                              I Y         + LS N  +    +       +T     +
Sbjct: 257 LSNAPPKTFKFDSTTDGVEIQYCGASTLGTSSALSPNRGDADKAIKSYVAGGDTLIGEGL 316

Query: 282 HHAYREL---------YNEKESSHNTIGSTRL--KKFVIFITDGEN-----SGASAYQNT 325
              +R L           ++  +   +       KK ++ +TDG N     +  + Y + 
Sbjct: 317 VWGWRMLTPSWRGLWNTKDQPGASLPLDYDLPYMKKVLVLMTDGVNHIAGRNYTAYYSDP 376

Query: 326 LNTLQ-----------ICEYMRNA-GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
             T+            IC   +    + +Y++   +  + Q  +  C     + +     
Sbjct: 377 YQTVADASKADADLMTICNAAKKDHNVVLYTITYGSDTDEQQ-MSDCASDPSKHYHAALP 435

Query: 374 RELLESFDKITDKIQEQS 391
           ++L ++F ++   +    
Sbjct: 436 QDLAKAFTQVGTDLTTMK 453


>gi|218887819|ref|YP_002437140.1| von Willebrand factor A [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758773|gb|ACL09672.1| von Willebrand factor type A [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 406

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 63/436 (14%), Positives = 133/436 (30%), Gaps = 76/436 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V        ID   +    N++Q A+DAA L+G   +  D  + D    K   
Sbjct: 4   LMAVLLPVVLGLAGLGIDSGMLYLAHNRLQGAVDAAALAGSLELPYDPQL-DKGLVKGAV 62

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +          + +G         +  KA+  +       L                   
Sbjct: 63  NQYMAANYPAAVLKGVTPGTEERSVTVKAEATVDTIFMGALGIG---------------- 106

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                         ST   + ++    + +  V+D + SM+   +Q+ N      +   +
Sbjct: 107 -------------SSTVRAQATAGYNNLEVVFVIDNTGSMKGTAIQQANAAATQLAELIM 153

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                          + K    PA  +   D    + G L  S      ++       G+
Sbjct: 154 PDGMETSVKVGLVPFRGK-VHIPAGVDGLADGCRNADGTLAPSWILEEYKQTKYRYPTGS 212

Query: 241 IAYNIGIVG----NQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKE 293
            + N+         +   L++N   + S + K +       T     +      L  E  
Sbjct: 213 -SLNVPKGTCDSIPRVQALTSNRTTIVSAIAKQDALGDASGTVISEGIKWGRHVLTPEAP 271

Query: 294 SSHNTIGSTRLKKFVIFITDGE------------NSGASAYQNT-----LNTLQICEY-- 334
            +     +  ++K +I +TDG+            N   +AY         +    CE   
Sbjct: 272 FT-QGSSNKDMRKVMIVLTDGDTEDGKCGGNYALNYTPNAYWTNAYYGMFDMNTHCENGG 330

Query: 335 ------------MRNAGMKIYSVAVSAPPEGQ-DLLRKCTDS----SGQFFAVNDSRELL 377
                        ++ G++I+++           L++    S       ++    + +L 
Sbjct: 331 KLNAAMLSEAQIAKDKGIEIFAIRYGDSDSTDISLMKAIASSKAGTDDHYYNAPSAYDLE 390

Query: 378 ESFDKITDKIQEQSVR 393
           E F KI  ++  + +R
Sbjct: 391 EIFKKIGRQLGWRLLR 406


>gi|83941160|ref|ZP_00953622.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
 gi|83846980|gb|EAP84855.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
          Length = 480

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 70/464 (15%), Positives = 127/464 (27%), Gaps = 113/464 (24%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +I +        +D       R+++Q+  D AVL+          ++DP T  +      
Sbjct: 46  MIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAA----DLDQMRDPKTVVEDY---- 97

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
               K  +       E   ++     +N  T   +       +   ++  PT        
Sbjct: 98  --FAKSGM------TEFLSNVVVDDGLNFRTVTVDASKDMDTQFIGRFGFPT-------- 141

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                    L      +       + I +VLD+S SM          +        +L  
Sbjct: 142 ---------LEVPAHSQAEERVAKVEISLVLDISGSMATNNRLGEVQDAADIFLDTVLKD 192

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE-----SAGNLVNSIQKAIQEKKNLSVRI 238
             +          S+   A      +++V  +                          ++
Sbjct: 193 ENEDLISVSLVPYSEQVNAGPLIMDRMNVNRKHDYSHCIDFDNGDFDSIAMNSSTRYNQM 252

Query: 239 GTIAYNI-------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
               +N                   + TP S N   +K++++ L P   T+ +  M  A 
Sbjct: 253 QHFQWNYDGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPRAGTSIFLGMKWAA 312

Query: 286 -----------RELYNEKE------SSHNTIGSTRLKKFVIFITDGENSGASAYQNTL-- 326
                        L N         +   +   +   K VI +TDG N  +    NT   
Sbjct: 313 AMLDPAFRDINNSLVNAGHVDREFYNRPASYTDSETLKTVILMTDGANDNSFRISNTYYN 372

Query: 327 ---------------------------------------NTL--QICEYMRNAGMKIYSV 345
                                                  NTL   IC+  +   + I+S+
Sbjct: 373 EDSEYVHWNRYNLWWYLRREVNSRYWGYFYYQKYNKSLGNTLLSNICDAAKAKRIVIWSI 432

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 E    ++ C  S   FF V    EL E+F  I  +I +
Sbjct: 433 GFEVDDEDVPAMQDCASSPSHFFRVE-GVELSEAFRAIARQINQ 475


>gi|32477945|ref|NP_870939.1| hypothetical protein RB13237 [Rhodopirellula baltica SH 1]
 gi|32448502|emb|CAD78017.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 388

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/395 (13%), Positives = 133/395 (33%), Gaps = 49/395 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I++ V      Y I++ ++   R ++Q + D A  +    +       +     ++ 
Sbjct: 39  MLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAAGRVLAVTGDKAEAIEAAERL 98

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                     +L +   I +      +  +    +           S +      +++ +
Sbjct: 99  LE-----ANPYLDRTLSIGDADIIFGKSNRTEENRRYEFTPDKKVNSVSLRAFGADDVPM 153

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L P+    +  R   I +  +  + + I +VLD S SM        +D      +   
Sbjct: 154 --LFPTMGVPIEFRP--IKQAVATQVELDIAIVLDRSGSMA-----FSHDEVAKNGSPSS 204

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
            PP  K          +++    A           +    ++ ++ +  ++     R+  
Sbjct: 205 APPGWKMG--HAVPENARWLDTVA-----------AVNGFLDIMEDSSHDE-----RVSL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNK---LNPYENTNTYPAMHHAYRELYNEKESSHN 297
             Y+     +    L+ +  E+++ +N          TN    +      L ++K +   
Sbjct: 247 STYSDKSKAD--VKLTGDYTEIRAAMNAHSTKFKGGATNIGSGILEGGATLGDKKLARSW 304

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                   + +I ++DG ++        +  +   + + N  + I++V  S     Q++ 
Sbjct: 305 AS------RVLIVMSDGIHN------TGIEPIPAAQQVANEKIMIFTVTFSDEANVQEME 352

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +      GQ F   DS++L E+F KI   +     
Sbjct: 353 KVAVSGGGQHFHAKDSQQLTEAFRKIAKSLPTLIT 387


>gi|114799275|ref|YP_759187.1| hypothetical protein HNE_0457 [Hyphomonas neptunium ATCC 15444]
 gi|114739449|gb|ABI77574.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 512

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 72/488 (14%), Positives = 147/488 (30%), Gaps = 96/488 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQ----SALDAAVLSGCASIVSDRTIKDPTTK 56
           +TA +I         AIDL + +  ++++Q    SA+ A  L   A   +  T  D  T 
Sbjct: 25  ITAFVIPCILALTGIAIDLQNTVRQKSKVQAALDSAVLAGALGRQAGNTAAETTLDVQTY 84

Query: 57  KDQTST----------IFKKQIKKHL--------KQGSYIRENAGDIAQKAQINITKD-- 96
                T          +     + +L        +Q +Y+    G    +  +  T    
Sbjct: 85  ALALFTDQGGGLDCDPVAVTFDETNLDILGTVRCRQPTYLSSLIGHDELEFNVASTSTYG 144

Query: 97  --------------KNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST------ 136
                           N    +A+ K       + L            L++ S       
Sbjct: 145 VGKLDVAFIFDVSGSMNSYNRLAQLKTAAVAAVDELLPDSRERDGTVRLAIASYNHSLNA 204

Query: 137 -----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
                 + E  + +   S    L    S     +   +        +           +S
Sbjct: 205 GAYIGAVTETVTLSADGSNSTALSRYNSHNTKRMIDQDSGKRFFYYQSGTCSSWNCGKYS 264

Query: 192 KNTTKSK--------YAPAPAPANRKIDVLIESAGNLVNSIQKAIQE------------- 230
             +  +K         A A            ++A      I                   
Sbjct: 265 SWSWDTKRRFFDDTGLADACVYERTGTQAATDAAPGSGAWIGAGNPRWSFYAGSSSKYDG 324

Query: 231 ----KKNLSVRIGTIAY---NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
               +   +   G  AY   +   + +   PL+ +   +K  +N L     T  +  +  
Sbjct: 325 WQNVENQNATGYGVGAYEGRHGTCMPSGPVPLTEDKTVLKDHVNALVAEGGTAGHLGIAW 384

Query: 284 AYRELYNEKESSHNTIGSTRL-------KKFVIFITDGENSG---ASAYQNTLNTLQICE 333
            +  L + + ++     S  L        K VI +TDG+ +     ++  +   ++ +C+
Sbjct: 385 GW-YLVSPEWAAIWPEASEPLPYRQPQTSKAVILMTDGDFNIEHPTASRDSFRQSMDLCD 443

Query: 334 YMRNAG--MKIYSVAVSAP------PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
            M+ +   ++IY+V    P       +G+ +L  C  S    F+ +   EL+E +  I  
Sbjct: 444 GMKASSRRIQIYTVGFQVPSSVQRTGDGRTILEYCATSPSHAFSADSGEELIEVYRSIAR 503

Query: 386 KIQEQSVR 393
            I +  ++
Sbjct: 504 SISDLRLK 511


>gi|83859217|ref|ZP_00952738.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852664|gb|EAP90517.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 436

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 75/439 (17%), Positives = 141/439 (32%), Gaps = 83/439 (18%)

Query: 3   AIIISVCFLF----ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD 58
           AII+++C       +  A+D +    + +++QSALD+  L+  + +  DR  +D      
Sbjct: 20  AIIMALCSGVLVTAVGGALDYSRSTTVSSELQSALDSGALAAAS-LTQDRNPEDVV---- 74

Query: 59  QTSTIFKKQIKKHLKQGS-YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                 +  ++  L      +     D+     +N           +  + A   +PT  
Sbjct: 75  ------RAYVEAALADHPQLLASLQLDVVADISLN---------SRVVNATASVAMPTT- 118

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
             + GL+      L   S  I +       + I +VLDVS SM    +    D   +   
Sbjct: 119 --MLGLVGINTLTLEHASEAIEQV----RDVEISLVLDVSGSMGGSKINALQDA-AIEFV 171

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
           + +L     +         +     P   N+ I     +       +         +++ 
Sbjct: 172 EIVLAADAAERTSISVIPYNGGVRTPREVNQDIVSGNNNHRRQSGCVDMGTDYPVEMTLP 231

Query: 238 IGTIAYNIGIVGNQCTP---------------LSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              + +       Q                  LS N   ++  +N L    NT    A  
Sbjct: 232 YREMEFTEYYGSEQTGNSSSAFCPRSNMESEFLSQNEGRMRGLINSLRAEGNTGLDVATM 291

Query: 283 HAYRELYNEKESSHNTIGSTRLK--------KFVIFITDGENSG---------------- 318
              R L      +     S R          K ++ +TDGE +                 
Sbjct: 292 WGARALDPAWRGNLGGSFSDRPASYDDRDTIKILVVMTDGEATAQIRSEEYTYYDWWGRE 351

Query: 319 ---------ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-PEGQDLLRKCTDSSGQFF 368
                     SA Q   N  + C+     G++IY++A        +DL+R C +    ++
Sbjct: 352 RTGTRSYELYSARQARENMAEACDIAEGNGVQIYTIAFQLSGQTNRDLMRNCANKPQNYY 411

Query: 369 AVNDSRELLESFDKITDKI 387
            V +  ++ E+F  I   I
Sbjct: 412 QVENL-DIAEAFSSIAADI 429


>gi|260425757|ref|ZP_05779737.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260423697|gb|EEX16947.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 479

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 74/470 (15%), Positives = 142/470 (30%), Gaps = 117/470 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  ++  +  +F    ID+ +    R ++Q+ LD AVL+                     
Sbjct: 41  MAVVLSMMMMIFGGLGIDMIYAELQRTKVQNTLDRAVLAAA------------------- 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  +   L+    + +    +A    + I+ D +  L Y       Y+    N   
Sbjct: 82  ------DLDNELEAQGVVEDYMDKMALADAL-ISVDVDEGLNYRTVVAEGYKTMPSNFMQ 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH--------NDNN 172
              + +      L++ G+ E +     + + +VLD+S SM+D     +         D  
Sbjct: 135 ILGVDN------LQAYGLAEATERINKVEVSLVLDISGSMDDNDKLANMQDAAGTFIDTL 188

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
               N+ L+           N      +   A         IE   ++  S   A  +  
Sbjct: 189 LAEGNEDLVSISLVPYSEQVNAGPEILSYLSANWKHGYSHCIEMPNSVFGS---AALDFS 245

Query: 233 NLSVRIGTIAYNI-------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYP 279
               ++    +N                   +    S++ + +K+++N+L P   T+ + 
Sbjct: 246 RTYEQMQHYQWNYDGYNNTLSDTVCPRYGYERIQAWSHDASALKAQVNQLQPRAGTSIFM 305

Query: 280 AMHHAYRELYNEK-----------------ESSHNTIGSTRLKKFVIFITDGE------- 315
            M      L                     E        T + K V+ +TDG+       
Sbjct: 306 GMKWGTALLDPSTRPIASGMIARGSVDQVFEGRPVAYDDTDVLKTVVLMTDGQHDRSYRI 365

Query: 316 -----------------------NSGASAYQNTLNTLQ-------------ICEYMRNAG 339
                                  +   S+Y+ +    Q             IC   +  G
Sbjct: 366 QDWAYNSESEYAHWNRYNLWYYLSRYVSSYERSSFYYQKYNADLGDALLGSICAAAKAQG 425

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           + I+SV       G D++  C  S   FF V    E+ E+F  I   + +
Sbjct: 426 IIIWSVGFEVGDHGADVMESCASSPAHFFRVE-GVEITEAFSTIAHTLNQ 474


>gi|329848522|ref|ZP_08263550.1| flp pilus assembly protein TadG [Asticcacaulis biprosthecum C19]
 gi|328843585|gb|EGF93154.1| flp pilus assembly protein TadG [Asticcacaulis biprosthecum C19]
          Length = 486

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 71/196 (36%), Gaps = 27/196 (13%)

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-- 274
             N V S +  + +        G +        N   PLSN+   V + +  L       
Sbjct: 290 VKNQVASSKVVMPDPTTPY---GGLVQTSQTCLNPILPLSNDATVVTNTIKGLVVNIGGY 346

Query: 275 ---TNTYPAMHHAYRELYNEKESSHNT---IGSTRLKKFVIFITDGENSGASAYQNTL-- 326
              T     M      L      +        +   +K ++ +TDG N+  +     +  
Sbjct: 347 KPETYIPGGMIWGVNALTPPAPFTEGKPYDANNKEPRKTIVLMTDGANTLYANTSGGIAV 406

Query: 327 -----------NTLQICEYMRNAGMKIYSVAVSAPPEGQDL--LRKCTDSSGQFFAVNDS 373
                      + +++C+Y ++  ++IY++      + + L  L+ C   +  +F    S
Sbjct: 407 ANATQVAVTYSDQIRVCDYAKSKKIEIYTIGFDV-TDSKALSTLKACATDAQHYFDAKSS 465

Query: 374 RELLESFDKITDKIQE 389
            +L+++F+ I  K+ +
Sbjct: 466 ADLIKAFETIGGKLSK 481



 Score = 43.0 bits (99), Expect = 0.076,   Method: Composition-based stats.
 Identities = 42/247 (17%), Positives = 72/247 (29%), Gaps = 70/247 (28%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I      +  AID A +   +   Q ALD+AVL+    IV++    D        
Sbjct: 26  IFGLAIFAIMAALGTAIDFAVLQRAKRSTQDALDSAVLAAA--IVNNSNEGDLKKLAADV 83

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                             +EN G     A++   K         A ++  Y+     LF 
Sbjct: 84  F-----------------KENLGAADLDAKVTAFKYDAKARTVKATAQGSYDPVIMQLFG 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +P         +       + +  + + +VLD + SM                    
Sbjct: 127 FKNLPY--------AVTSDAIKAADGTLEVALVLDNTWSMS------------------- 159

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                                A      KID+L  +A  LV++I           V+I  
Sbjct: 160 ---------------------ATVNGTPKIDILKTAAQGLVSTILTKD---NKDYVKIAV 195

Query: 241 IAYNIGI 247
           + Y   +
Sbjct: 196 VPYADYV 202


>gi|163759224|ref|ZP_02166310.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
 gi|162283628|gb|EDQ33913.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
          Length = 541

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 65/178 (36%), Gaps = 33/178 (18%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN-EKESSHNTIGSTR 303
            G       PL+ + +++++ +  L    +TN    +   +R L + E  +         
Sbjct: 359 FGCEMEPLVPLTTDFSKIRTTVKALEANGSTNMLEGVMWGWRVLSDREPFAQGAPKSDAS 418

Query: 304 LKKFVIFITDGENSGASAYQN-------------------------------TLNTLQIC 332
           ++K +IF+TDG+NS  +   +                                  T   C
Sbjct: 419 VEKIMIFLTDGQNSFGNLNNDLGSAYTSMGYLVDGRLDGMTAANIGQTNNALDKKTKAAC 478

Query: 333 EYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           E  +  G+ IY++ +     G   +L +C  SS  +F     ++L   FD I   + +
Sbjct: 479 ENAKEDGVTIYTIRLEEADVGTGKMLEECATSSAHYFDAPSRQQLTPIFDAIKKGVVK 536



 Score = 47.2 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/230 (13%), Positives = 66/230 (28%), Gaps = 36/230 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I+     +    A+D   +   ++++Q+A+D+A L                      
Sbjct: 18  VFGILAVPVMVAGGLAVDYVGLSVEKSKLQNAVDSAALLIAR------------------ 59

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                      + +   ++     I     IN+ K   + +   A  KA  +   + L  
Sbjct: 60  --------AGDMSETQAMKLAKTTITTNYGINVAKVAVSMVDGDATVKASMD---QALVF 108

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G +      +S  +T     +       I +VLD + SM    L    +      +   
Sbjct: 109 GGFMGRKNAAVSAEATATYAYTKYE----IALVLDTTGSMLGGKLTSLQNAVIGLVDGME 164

Query: 181 LPPPPKKSFWSK---NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA 227
                K+                P   P       + + A   ++   KA
Sbjct: 165 ALGLNKEQLKFAVVPYAGFVNVGPEYGPTINGAGKVKKPAAAWIDQDAKA 214


>gi|218528586|ref|YP_002419402.1| hypothetical protein Mchl_0543 [Methylobacterium chloromethanicum
           CM4]
 gi|218520889|gb|ACK81474.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 518

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 68/180 (37%), Gaps = 31/180 (17%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGST 302
           N G      T L+ +  ++ + +  +    +TN    +   +  L  N         G  
Sbjct: 337 NAGCEIQPLTRLTTSQTQLTNAIAAMTVIGDTNIPIGLAWGWHLLSPNGPFKDGVAYGEI 396

Query: 303 RLKKFVIFITDGENS-----------------------GASAYQNTLNTLQI-------C 332
           + KKF++ +TDG+N                        G ++  N + T  I       C
Sbjct: 397 KTKKFIVLMTDGQNQSAVSSSDNRSYYSGLGFIWQNRIGTTSNDNAVRTKAIDTRLTLLC 456

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           + +R A +++++V V        +L+ C  S   FF V +S  L   F  I D+I E  +
Sbjct: 457 DNIRKARIQVFAVRVEVNDGDSAVLKACATSPNMFFDVKNSSGLPAVFRAIADQISELRI 516


>gi|327538644|gb|EGF25299.1| protein containing von Willebrand factor, type A domains
           [Rhodopirellula baltica WH47]
          Length = 388

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 54/395 (13%), Positives = 132/395 (33%), Gaps = 49/395 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I++ V      Y I++ ++   R ++Q + D A  +    +       +     ++ 
Sbjct: 39  MLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAAGRVLAVTGDKAEAIEAAERL 98

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                     +L +   I +      +  +    +           S        +++ +
Sbjct: 99  LE-----ANPYLDRTLSIGDADIIFGKSNRTEENRRYEFTPDKKVNSVGLRAFGADDVPM 153

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L P+    +  R   I +  +  + + I +VLD S SM        +D      +   
Sbjct: 154 --LFPTMGVPIEFRP--IKQAVATQVELDIAIVLDRSGSMA-----FSHDEVAKNGSPSS 204

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
            PP  K          +++    A           +    ++ ++ +  ++     R+  
Sbjct: 205 APPGWKMG--HAVPKNARWLDTVA-----------AVNGFLDIMEDSSHDE-----RVSL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHN 297
             Y+     +    L+ +  E+++ +N  +       TN    +      L ++  +   
Sbjct: 247 STYSDKSKAD--VKLTGDYTEIRAAMNAHSTNFKGGATNIGSGILEGGATLGDKNLARSW 304

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                   + +I ++DG ++        +  +   + + N  + I++V  S     Q++ 
Sbjct: 305 AS------RVLIVMSDGIHN------TGIEPIPAAQQVANEKIMIFTVTFSNEANVQEME 352

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +      GQ F   DS++L E+F KI   +     
Sbjct: 353 KVAVSGGGQHFHAKDSQQLAEAFRKIAKSLPTLIT 387


>gi|83955719|ref|ZP_00964299.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
 gi|83840013|gb|EAP79189.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
          Length = 480

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 69/464 (14%), Positives = 127/464 (27%), Gaps = 113/464 (24%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +I +        +D       R+++Q+  D AVL+          ++DP T  +      
Sbjct: 46  MIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAA----DLDQMRDPKTVVEDY---- 97

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINI-TKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
               K  +       E   ++     +N  T   +       +   ++  PT        
Sbjct: 98  --FAKSGM------TEFLSNVVVDDGLNFRTVTVDASKNMDTQFIGRFGFPT-------- 141

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                    L      +       + I +VLD+S SM          N        +L  
Sbjct: 142 ---------LEVPAHSQAEERVAKVEISLVLDISGSMATNNRLGEVQNAADIFLDTVLKD 192

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE-----SAGNLVNSIQKAIQEKKNLSVRI 238
             +          S+   A      +++V  +                          ++
Sbjct: 193 ENQDLISVSLVPYSEQVNAGPLIMDRMNVNRKHDYSHCIDFDNGDFDSIAMNSSTRYNQM 252

Query: 239 GTIAYNI-------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
               +N                   + TP S N   +K++++ L P   T+ +  M  A 
Sbjct: 253 QHFQWNYDGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPRAGTSIFLGMKWAA 312

Query: 286 -----------RELYNEK------ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL-- 326
                        L N         +   +   +   K VI +TDG N  +   ++    
Sbjct: 313 AMLDPAFRDINNSLVNAGYVDREFYNRPASYTDSETLKTVILMTDGANDNSYRIRSNYYD 372

Query: 327 ---------------------------------------NTL--QICEYMRNAGMKIYSV 345
                                                  NTL   IC+  +   + I+S+
Sbjct: 373 SDSEYVHWNKYNLWWYLRREVDSRYWGYFYYHKYNKTLGNTLLSNICDAAKAKRIVIWSI 432

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 E    ++ C  S   FF V    EL E+F  I  +I +
Sbjct: 433 GFEVDDEDVPAMQDCASSPSHFFRVE-GVELSEAFRAIARQINQ 475


>gi|312878233|ref|ZP_07738157.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311794982|gb|EFR11387.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 1221

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 57/318 (17%), Positives = 119/318 (37%), Gaps = 33/318 (10%)

Query: 83  GDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF--LKGLIPSALTNLSLRSTGIIE 140
           GDI+   +IN  KD+    +         +I     F      IP   + +  +    ++
Sbjct: 407 GDISPFVEINSLKDEEVFSEIYGIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVK 466

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
               +  +   + LD      D   +      +  +   L   P  K+ W     K +  
Sbjct: 467 MFYLDEDLMTFVPLDEQG--VDPINKVVWAKTDHFTTFVLFYIPTWKAIWEVPINKGERE 524

Query: 201 PAPAPANRKIDVLIESAGNLV--------NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                    +  +++S+G++             K+  +      R   + ++    G   
Sbjct: 525 VNQQIKYIDLVFVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGDRAAVVDFDDY--GYLL 582

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
            PL+ +   VK+ +++++ +  TN    +  A  +L ++              K +I +T
Sbjct: 583 QPLTTDFQTVKNAIDRIDSWGGTNIAEGIRIANHQLISQSSDDRI--------KVIILLT 634

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVN 371
           DGE      Y N L T       +N G+ IY++ +    + ++LLR     + G +F V+
Sbjct: 635 DGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVD-ENLLRNIATQTGGMYFPVS 684

Query: 372 DSRELLESFDKITDKIQE 389
            + +L + F +IT+ + E
Sbjct: 685 SASQLPQVFKRITEIVTE 702


>gi|78357411|ref|YP_388860.1| von Willebrand factor, type A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219816|gb|ABB39165.1| von Willebrand factor, type A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 402

 Score = 99.6 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 60/438 (13%), Positives = 132/438 (30%), Gaps = 84/438 (19%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A+++ V    +   +D   +    +++Q+A+DAA L+G   +  D  +     +      
Sbjct: 2   AVLLPVILGIMGLGLDSGMLYLSHSRLQAAVDAAALAGSLQLPYDPAMDKGLVRA-AVDE 60

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
                  + + Q          +   A+  +       L                     
Sbjct: 61  YMHANFPQAVVQSVLPGAEERSVTVNAEATVGTIFMGALGIG------------------ 102

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
                       ST   + S+    + +  V+D S SM+   + + N       +  +  
Sbjct: 103 -----------SSTVRAQASAGYNNLEVVFVIDNSGSMKGSPINETNAAATRLVDLIMPE 151

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                        + K    PA  +        + G+L       + E K    R     
Sbjct: 152 GMATSVKIGLVPFRGK-VRIPADVDGLPSGCRNADGSLNE--DGLLDEYKKPEYR---YP 205

Query: 243 YNIGIVGNQCT----PLSNNLNE----VKSRLNKLNPYE---NTNTYPAMHHAYRELYNE 291
           YN  +     +    PL+  L      +   + + +       T     +  A   L  E
Sbjct: 206 YNDRLRVTPYSCSSIPLTQGLTADRATITQAIGRQDARGDSSGTVISEGLKWARHVLTPE 265

Query: 292 KESSHNTIGSTRLKKFVIFITDGE-----------------NSGASAYQNTLNTLQICEY 334
              +     +  ++K +I +TDG+                 N   +AY   ++    CE 
Sbjct: 266 APFTEG-SSAKDMRKVIILLTDGDTEDGNCGGNYSVYYRPNNYWTNAYYGMMDMDSHCED 324

Query: 335 --------------MRNAGMKIYSVAVSAPPE-GQDLLRKCTDS----SGQFFAVNDSRE 375
                          ++AG++I+++   +     ++L+R    S       +F      +
Sbjct: 325 GGVLNNAMLSEAALAKDAGIEIFAIRYGSSDAVDRNLMRAVASSKEGTDDHYFDAPSPYD 384

Query: 376 LLESFDKITDKIQEQSVR 393
           + + F  I  ++  + +R
Sbjct: 385 IDDVFKLIGRQLGWRLLR 402


>gi|84515372|ref|ZP_01002734.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
 gi|84510655|gb|EAQ07110.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
          Length = 485

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 74/488 (15%), Positives = 127/488 (26%), Gaps = 132/488 (27%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MT +++    +    A+D       R  +QS  D AVL+  +       +      +D  
Sbjct: 36  MTILLLVTMLIMGGMAVDFMRYEARRATLQSVSDRAVLAAAS-------LNQTLDSRDVV 88

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                     +  +  +     G         I  D  N       S         N F 
Sbjct: 89  ED--------YFAKAGFPNALVGA-------PIVVDNGNSRTVTVRSALDV-----NTFY 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-------------------- 160
             L          RS+           + I +VLD+S SM                    
Sbjct: 129 LRLAGMDRLTAPARSSATEGV----GKVEISLVLDISGSMRFSNRFVNMQAAAIAFAEEV 184

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
            D           +       P P   +F        +Y       +  I  L       
Sbjct: 185 LDPANGGTVSLTIIPYAGATNPGPEMFAF----MGGVRYPDTLLAGDDGI--LGTEDDYF 238

Query: 221 VNSIQKAIQEKKNLSVRIG------TIAYNIGIVGNQCTPLSNNL--------------- 259
              +   ++   +     G          +  +     + +                   
Sbjct: 239 FPQVSSCVEMVGSDWSSAGLPGAGRAQVPHFQVWDIARSVMDWGWCPQDRSSIQYAMATP 298

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-----SSHNTIGSTRL---------- 304
            + +S +N L  ++ T T+ AM +A   L    +      SH   G              
Sbjct: 299 AQARSFINGLRMHDGTGTHYAMKYALATLDPSSQPAFMHLSHPGRGLVPPQFANRPAAWD 358

Query: 305 ----KKFVIFITDGE------------------------NSGASAYQ------NTLNTLQ 330
               KK ++ +TDG+                        N   +  Q      N      
Sbjct: 359 DPETKKIIVLMTDGDITQQERPRIAQQERDIDYIISRSINGRDNRGQFVDAATNVGRFEA 418

Query: 331 ICEYMR--NAGMKIYSVAVSA-PPEGQDL-LRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           IC         + +Y+VA    P    DL +R C      FF      EL++ F  I ++
Sbjct: 419 ICTLANQPARSVDVYTVAFEVQPNSAADLQMRNCASDPSMFFR-TSGAELIDVFSGIAER 477

Query: 387 IQEQSVRI 394
           I +  + +
Sbjct: 478 ITDLRLNL 485


>gi|218462234|ref|ZP_03502325.1| hypothetical protein RetlK5_23393 [Rhizobium etli Kim 5]
          Length = 66

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 31/64 (48%)

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            C+  ++ G++IY++A  AP  GQ LL  C      +F      +LL +F  I  K   Q
Sbjct: 1   TCDTAKSKGIEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQ 60

Query: 391 SVRI 394
             R+
Sbjct: 61  LTRL 64


>gi|87311197|ref|ZP_01093320.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
 gi|87286105|gb|EAQ78016.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
          Length = 373

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 58/397 (14%), Positives = 129/397 (32%), Gaps = 54/397 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V      + +D+A++   R +++ A D+A  +G  ++  ++        K   
Sbjct: 25  LIAVLLPVILWMAAFCVDVAYMQLTRTELRIATDSAARAGARTLSLEQ--DASLAHKSAI 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQI-NITKDKNNPLQYIAESKAQYEIPTENLF 119
               K  +  +    +      G   +   +   T      L        +      +  
Sbjct: 83  EYAAKNNVAGNTLTLADSDVQIGLSVRTDDVGRFTFSSGGKLLNSVNVTGRRTQQAPDGA 142

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           ++  +     +   +       S  +    I +V+D S SM                  +
Sbjct: 143 VRLYLTPIFGHEFFQPVADATASQIDR--DIALVVDRSGSM-----------------TF 183

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
            +     +S W  N         P P+  +   L++S    +  +       +   V   
Sbjct: 184 RINRNSYESGWRNN--------DPVPSRARWWALVDSVDGFLTELGS---TPQLELV--S 230

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSH 296
              YN     ++   L++  + ++  L+  +   P  +TN    M      L N+K +  
Sbjct: 231 LSTYNSSAKIDE--QLTDKYSRIEDALDDYSRRYPDGSTNITAGMDRGISTLQNKKYARP 288

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                    K ++ +TDG ++  S+  N            +  + ++++  S     Q L
Sbjct: 289 YAS------KTMVVMTDGNHNYGSSPTNAAY------DAASDDIVVHTITYSD-GANQSL 335

Query: 357 LRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +R+      GQ +   D  EL E F +I         
Sbjct: 336 MREVARIGGGQHWHAPDGDELEEIFREIARNAPTLLT 372


>gi|322436225|ref|YP_004218437.1| VWFA-related domain protein [Acidobacterium sp. MP5ACTX9]
 gi|321163952|gb|ADW69657.1| VWFA-related domain protein [Acidobacterium sp. MP5ACTX9]
          Length = 304

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 84/188 (44%), Gaps = 31/188 (16%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            E+    V ++ +   E          + ++  +   +    +N+   +++ LN+L   +
Sbjct: 97  KEAGKKFVRALLREQDEFD-------LMDFSDTVR--EVVSFTNDKKRIENGLNELRKGD 147

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T  Y A++ A + L           G  R ++ ++ ITDG+N+      + +   Q  E
Sbjct: 148 ATAVYDAVYLASQRL------GETNAGGGR-RRVLVLITDGDNT-----VHGVGYDQAVE 195

Query: 334 YMRNAGMKIYSVAVSAPPEG---------QDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
             + AG+ +Y++ V  P E            L++  TD+ G ++ VND R+L + + K++
Sbjct: 196 QAQRAGVMVYALIV-VPIEADAGRNTGGEHALIQMATDTGGNYYYVNDPRDLAKVYAKVS 254

Query: 385 DKIQEQSV 392
           D ++ Q V
Sbjct: 255 DDLRTQYV 262


>gi|114764812|ref|ZP_01443994.1| hypothetical protein 1100011001322_R2601_10469 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542698|gb|EAU45721.1| hypothetical protein R2601_10469 [Roseovarius sp. HTCC2601]
          Length = 477

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 71/466 (15%), Positives = 136/466 (29%), Gaps = 110/466 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   +  +  +F    ID+ +    R ++Q+ LD AVL+            D   + D  
Sbjct: 40  MAVALSLLMMIFGGIGIDMMYAELQRTKIQNTLDRAVLAAA----------DLDNELD-- 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +  ++ ++ + S            A +++  D+    + +     +    T     
Sbjct: 88  ---AQGVVEDYMSKMSLAD---------ALVSVNVDEGLNYRTVTADGYR----TMPSNF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMED--------LYLQKHNDNN 172
             LI          S  +   +     + + MVLD+S SM+D               D  
Sbjct: 132 MQLIGIENMQAGGHSQAMERINK----VEVSMVLDISGSMDDGDKMAELQTAASDFVDTL 187

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ---KAIQ 229
               ++ L+           N      +             +E   +  NS         
Sbjct: 188 LDDGSEDLVSISLVPYSEHVNAGPEILSYLNVNYMHDDSYCLEMPNSAFNSAALDLSLTY 247

Query: 230 EKKN--LSVRIGTIAYNI----GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
           ++         G+ +            Q  P S +   +K+++++L P   T+ +  M  
Sbjct: 248 DQMQHFQWNYSGSNSLTDTVCPRYAYEQIRPWSQDAGALKTQISQLQPRAGTSIFMGMKW 307

Query: 284 AYRELYNEK-----------------ESSHNTIGSTRLKKFVIFITDG------------ 314
           A   L                     E        T + K ++ +TDG            
Sbjct: 308 ASALLDPSTRPIASGMIADGTVDAVFEGRPVAYSDTDVLKTIVLMTDGQHDRSFRIQNWA 367

Query: 315 ---ENSGASAYQNTL--------------------------NTL--QICEYMRNAGMKIY 343
              EN      Q  L                          +TL   +C   +  G+ I+
Sbjct: 368 YNDENEVEHWSQYNLWHYLNYYVNSWNRSSFYYQKYDAATGDTLLSSVCTAAKRQGILIW 427

Query: 344 SVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           S+       G +++  C  S   FF V    E+ E+F  I   + +
Sbjct: 428 SIGFEVSDHGANVMESCASSPAHFFRVE-GVEISEAFSTIAQTLNQ 472


>gi|255261929|ref|ZP_05341271.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104264|gb|EET46938.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 478

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 68/469 (14%), Positives = 122/469 (26%), Gaps = 113/469 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            +  +  +  L    A+DL      R ++Q  LD AVL+            D        
Sbjct: 38  FSLFMFVLMLLTAGMALDLMRYETHRARLQGTLDRAVLAAA----------DLDQTLSPA 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + +     K  L                + +  T         I  ++    +PT  + L
Sbjct: 88  AVVTDYFAKAGL---------------SSFLTSTTVDQGLNYRIISAQGNMTMPTTFMRL 132

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G          L   G          + I +V+D+S SM            + T    +
Sbjct: 133 SG-------QTELAIRGDATAEERVSNVEISLVVDISGSMGRNNKLSTLRTASHTFIDTV 185

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE-----SAGNLVNSIQKAIQEKKNLS 235
           + P  +          +    A      ++ V  +                A  +   +S
Sbjct: 186 IRPETEDLISLNIIPYTAQVNAGPDIFDQLTVDQKHNFSHCIDFEPADFNTAALDVPPVS 245

Query: 236 VRIG------TIAYNIGIVGN---------QCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
            R           ++   V N         +  P S +   +KS +  L    NT  +  
Sbjct: 246 TRTYKQMQHFQYGWSSSYVNNPGCPMQSYERIVPFSQDATSLKSTVTSLRARANTAIHLG 305

Query: 281 MHHAYREL---------------YNEKESSHN--TIGSTRLKKFVIFITDGENSGA---- 319
           M      L                 + E +            K ++ +TDG+N       
Sbjct: 306 MKWGVSMLDPTFRPIVTAMIANNKVDPEFAGRPVAYNDPETLKTIVLMTDGQNVDTYRIS 365

Query: 320 ---------------------------------------SAYQNTLNTLQICEYMRNAGM 340
                                                  +A Q       IC+  +  G+
Sbjct: 366 DEFYSTPSQIAHWDRYQLFFFTNNYIDRDIDQNYYYKKFTATQADTMLQSICDAAKAEGI 425

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            ++++           +  C  S   FF V    EL E+F  I  +I +
Sbjct: 426 LVWTIGFEVSNHAAGEMLDCASSPSHFFRVE-GVELSEAFASIARQINQ 473


>gi|110634434|ref|YP_674642.1| hypothetical protein Meso_2084 [Mesorhizobium sp. BNC1]
 gi|110285418|gb|ABG63477.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 549

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 63/184 (34%), Gaps = 40/184 (21%)

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
           G +    TPLSN+   +K  +++     NTN    +    R L   +  +     ++ ++
Sbjct: 361 GCLSRPITPLSNDYAALKREVSRFTADGNTNIMEGVAWGMRVLSPREPFTEGKEPASDVE 420

Query: 306 KFVIFITDGENSGASAYQN--------------------------------TLNTLQICE 333
           K +I +TDG N+   +                                      TL  CE
Sbjct: 421 KIMIVLTDGANNMGLSNNRNHALGSSYSSFGYLVEDRLTRERSQRRVTEEMNRRTLAACE 480

Query: 334 YMRN-------AGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
             +          + IY++ +  P      LL++C    G +F      +L   F +I D
Sbjct: 481 NAKREYTPSKEDDVTIYTIRLEEPDVATGTLLQECATGPGYYFDSPSRTQLNAIFKEIRD 540

Query: 386 KIQE 389
            I +
Sbjct: 541 GITK 544



 Score = 43.7 bits (101), Expect = 0.044,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 50/155 (32%), Gaps = 33/155 (21%)

Query: 6   ISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFK 65
           + V F     A+D  ++   R+++Q+ALD        + V     +       +  +I  
Sbjct: 31  LPV-FGAAGLAVDYTNMSRTRSELQNALD--------AAVLAVAQRGDKISDAEARSIAA 81

Query: 66  KQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP 125
             +  +L                +       + N       ++A     T  L   GLI 
Sbjct: 82  SFLTGNL---------------SSAYKNMAVERNGTSVKLSAEA-----TMPLSFGGLIG 121

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
                +   ST  +  +       I +VLD + SM
Sbjct: 122 RKEATVGASSTADMAFAYYE----IALVLDTTGSM 152


>gi|325106974|ref|YP_004268042.1| von Willebrand factor A [Planctomyces brasiliensis DSM 5305]
 gi|324967242|gb|ADY58020.1| von Willebrand factor type A [Planctomyces brasiliensis DSM 5305]
          Length = 396

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 67/411 (16%), Positives = 141/411 (34%), Gaps = 71/411 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++SV  + + +  D+A++  +R Q+  + DAA  +G  ++         T  + Q 
Sbjct: 23  LIAALLSVMLILVVFTTDVAYMQLVRTQLHVSTDAAAKAGMEALA-------RTESRGQA 75

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + K    K+L  G  ++ +  DI          + +   +++   +    I       
Sbjct: 76  RVVAKDIFSKNLIGGRELKLHNKDIEFG---RTDANPDGTWEFLPNERPFQAIRISVNLD 132

Query: 121 KGLIPSALTNLSLRSTGIIERSS---ENLAISICMV------LDVSRSME-DLYLQKHND 170
                    ++ L    ++ +SS    + +++  +V      LD S SM  D     +  
Sbjct: 133 DNRQKGRNGSVPLLFGKVLGQSSFATNHSSVAANLVHEIVLCLDRSHSMCFDETGVDYAY 192

Query: 171 NNNMTSN--KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
                S    Y+ PP P  S W+K                    L  +    V+++    
Sbjct: 193 PPGTPSYPAGYITPPNPVGSRWAK--------------------LQGAIQVFVDTLDDLQ 232

Query: 229 QEKKNLSVRIGT---IAYNIGIVGNQCT-------PLSNNLNEVKSRLNKL---NPYENT 275
                  V  G+   ++++      +         PL  NLN V   +           T
Sbjct: 233 IVPDVGVVTWGSDITLSWSWYPFQGRSFPAVMVDVPLGQNLNLVSPAIAAKLGDIMMGGT 292

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +  +   L             +  +K +I ++DG+      +    N L      
Sbjct: 293 NMSSGIDRSVSLLTANG-------THSLAQKTIILMSDGQ------WNAGRNPLDAANDA 339

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD 385
            +  + I+++A       Q ++R+    + G+FF   D   L ++F ++  
Sbjct: 340 ADKNITIHTIAFL--NGDQSVMRQIAERTGGKFFNAPDGESLEDTFKELAK 388


>gi|163747459|ref|ZP_02154811.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
 gi|161379312|gb|EDQ03729.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 63/462 (13%), Positives = 129/462 (27%), Gaps = 120/462 (25%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
               +DL      R ++Q+  D AVL+                       + +    + +
Sbjct: 45  GGVGVDLMRHERERARVQAVADRAVLAAA--------------------DLDQTLSPEAV 84

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS 132
            +  + +    D       ++T ++    +             + +F+         ++ 
Sbjct: 85  ARDYFDKSGLADYIS----SVTVEEGLNYR---RVTVDASRDLKTMFIDKF-GQEKLHVP 136

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYL-----------------QKHNDNNNMT 175
            ++T       +   + I MVLD+S SM +                        D  +++
Sbjct: 137 AKATA----EEKVAKVEISMVLDISGSMRENDKMNNLHDASNVFIDTVIQTDTEDLISIS 192

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL-----VNSIQKAIQE 230
              Y       K    +      ++ +        D  + +         +   +     
Sbjct: 193 VVPYTAQVNVGKDIMDELNVTQLHSYSHCVDFEDSDFNLTTISQTRSYEHMQHFEAGYYW 252

Query: 231 KKNLSVRIGTIAYNI-------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
             N   R G   Y+             +    S N   +KSR+    P  NT  +  +  
Sbjct: 253 NGNDRDRTG--HYDNISNPGCPKQSYEEIETFSQNAAALKSRIANFQPRANTAIHLGLKW 310

Query: 284 AYRELYNEKESSHNTIGSTRL-------------KKFVIFITDGEN-------------- 316
               L     + +  IG   +              K VI +TDG N              
Sbjct: 311 GVALLDPSFRAINEAIGGDAVFRGRPAEYNDIDTLKTVILMTDGVNVTTRRIAPEAYSNR 370

Query: 317 -----------------------------SGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
                                        +  +A Q       IC+  +  G+ I+S+  
Sbjct: 371 DHYRHWSDYPFYWWLGRNVRSSEHYRWYRTKYTAGQADNLLDNICDAAKAKGIVIWSIGF 430

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                G  +++ C  S   FF V    E++++F+ I  +I +
Sbjct: 431 EVTDHGAAVMKNCASSDSHFFRVE-GVEIVDAFEAIARQINQ 471


>gi|254292617|ref|YP_003058640.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
 gi|254041148|gb|ACT57943.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
          Length = 514

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 77/510 (15%), Positives = 160/510 (31%), Gaps = 145/510 (28%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ ++V    I + ID   +   +  +Q+A D+AVL+   + ++       T +++ +
Sbjct: 22  MFALFLTVILFIIGFTIDFRRMDSAKMHLQAATDSAVLAAARAYLTSSVQVKETKRQEDS 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  +L   S       +  +  QI +   ++  +   A +K +       L  
Sbjct: 82  QKIASDYLTANLLSSS-------NNFENNQIQLVFKEDGEIVGNASTKIK-------LIF 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM------ 174
            GL   +   L   +   +  S +   + I +VLD S SM      K     ++      
Sbjct: 128 GGLFGKSDVVLPALAAATVGDSRK---LEIVLVLDTSGSMSSQNRMKQLRTASINFVNSV 184

Query: 175 ---------------TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
                            N  +     +   W  +   + +         ++    +   N
Sbjct: 185 FDNAVYERTVQVGVVPWNATVNINMDRPGTWDASPGPAIHNSNYGNGTNQVTSFQDFTEN 244

Query: 220 LVNS------------------------IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
           L                              A ++++ +S   G +     +     + +
Sbjct: 245 LYPPGFSDFGSYSDSDIDDDFGSSGWLGCITATKDERKIS-SSGNVT---PLTDVPPSKM 300

Query: 256 SNNLNEVKSR-----------------------LNKLNPYENTNTYPAMHHAYRELYN-- 290
                +V                          LN+LNP  NT+    +   YR      
Sbjct: 301 KWPARKVAGWDPNSDCPSPMLAMSQSRPQIIKKLNQLNPSGNTHADIGLMWGYRMFSQQA 360

Query: 291 --------EKESSHNTIGSTRLKKFVIFITDGENSGASAYQ------------------- 323
                     ++  ++  ST+ +K +I +TDGEN+  ++                     
Sbjct: 361 NWNNFFGYNSDTKPDSFHSTKSRKIMIMLTDGENTATNSEGYSYYGWCTYTNHYNKWGRY 420

Query: 324 --------------------NTLNT--LQICEYMRNAGMKIYSVAVSA----PPEGQDLL 357
                               N LN+  L  CE +R+  ++++++A+            LL
Sbjct: 421 TGSTKDCEVPKGINKDEISNNDLNSLMLDACEVIRSKDVELFTIALDLHSYYDSTAIALL 480

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           R+C  S    + +    EL E+F ++  K 
Sbjct: 481 RECAGSDSHAYNI-KGNELDETFQELASKA 509


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score = 96.9 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 58/317 (18%), Positives = 117/317 (36%), Gaps = 31/317 (9%)

Query: 83  GDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF--LKGLIPSALTNLSLRSTGIIE 140
           GDI+   +IN  KD+    +         +I     F      IP   + +  +    ++
Sbjct: 373 GDISSFVEINNLKDEEVFSEIYGIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVK 432

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
               +  +   + LD      D   +      N  +   L   P  K+ W     K +  
Sbjct: 433 MFYLDEDLMTFVPLDEQG--VDPVNKVVWAKTNHFTTFVLFYIPTWKAIWEVPINKGERE 490

Query: 201 PAPAPANRKIDVLIESAGNLV--------NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                    +  +++S+G++             K+  +      R   + ++    G   
Sbjct: 491 INQQVNYIDLVFVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGDRAAVVDFDN--FGYLL 548

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
            PL+ +   VK+ +++++ +  TN    +  A ++L +          S    K +I +T
Sbjct: 549 QPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQQLIS--------RSSEDRIKVIILLT 600

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           DGE      Y N L T       +N G+ IY++ +    +   L    T + G +F V+ 
Sbjct: 601 DGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVDENLLRDIATQTGGMYFPVSS 651

Query: 373 SRELLESFDKITDKIQE 389
           + +L + F +IT+ + E
Sbjct: 652 ASQLPQVFKRITEIVTE 668


>gi|323136144|ref|ZP_08071226.1| hypothetical protein Met49242DRAFT_0613 [Methylocystis sp. ATCC
           49242]
 gi|322398218|gb|EFY00738.1| hypothetical protein Met49242DRAFT_0613 [Methylocystis sp. ATCC
           49242]
          Length = 652

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 63/191 (32%), Gaps = 46/191 (24%)

Query: 250 NQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKK 306
              T L+NNL+ V + ++ +N      T     +  A+R L  +K  +        + KK
Sbjct: 460 EPLTRLTNNLSTVTAAIDSMNYWLNGGTVISEGLMWAWRTLSPQKPYADGAAYTDKKTKK 519

Query: 307 FVIFITDGEN------SGASAYQNTLNT-----------------------------LQI 331
            ++ +TDG N      + ASA  +  +                               + 
Sbjct: 520 VIVLMTDGVNGLADNGNAASANISDYSAYGYMGASRLSVADGVTTYAGLQTFLDDRLKKA 579

Query: 332 CEYMRNAGMKIYSVAVS--------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           C+  +  G+ IY+V  +               LL  C       F   DS  L  +F +I
Sbjct: 580 CDNAKAKGISIYTVMFNHNGFLSATEQARSATLLSYCASKPEYAFLATDSAALNSAFGQI 639

Query: 384 TDKIQEQSVRI 394
                   +R+
Sbjct: 640 ASSAAASPLRL 650


>gi|312622403|ref|YP_004024016.1| von willebrand factor type a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202870|gb|ADQ46197.1| von Willebrand factor type A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 1166

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 58/317 (18%), Positives = 118/317 (37%), Gaps = 31/317 (9%)

Query: 83  GDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF--LKGLIPSALTNLSLRSTGIIE 140
           GDI+   +IN  KD+    +         +I     F      IP   + +  +    ++
Sbjct: 373 GDISSFVEINNLKDEEVFSEIYGIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVK 432

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
               +  +   + LD      D   +      N  +   L   P  K+ W     K +  
Sbjct: 433 MFYLDEDLMTFVPLDEQG--VDPVNKVVWAKTNHFTTFVLFYIPTWKAIWEVPINKGERE 490

Query: 201 PAPAPANRKIDVLIESAGNLV--------NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                    +  +++S+G++             K+  +      R   + ++    G   
Sbjct: 491 INQQINYIDLVFVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGDRAAVVDFDD--FGYLL 548

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
            PL+ +   VK+ +++++ +  TN    +  A ++L +        + S    K +I +T
Sbjct: 549 QPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQQLIS--------LSSEDRIKVIILLT 600

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           DGE      Y N L T       +N G+ IY++ +    +   L    T + G +F V+ 
Sbjct: 601 DGE----GYYDNNLTT-----EAKNNGITIYTIGLGTSVDENLLRDIATQTGGMYFPVSS 651

Query: 373 SRELLESFDKITDKIQE 389
           + +L + F +IT+ + E
Sbjct: 652 ASQLPQVFKRITEIVTE 668


>gi|312793553|ref|YP_004026476.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180693|gb|ADQ40863.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 726

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 78/177 (44%), Gaps = 29/177 (16%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
             +A + V+++ +          R   + ++    G    PL+ +   VK+ +++++ + 
Sbjct: 59  KIAAKSFVDALIQGD--------RAAVVDFDDY--GYLLQPLTTDFQTVKNAIDRIDSWG 108

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            TN    +  A  +L ++              K +I +TDGE      Y N L T     
Sbjct: 109 GTNIAEGIRIANHQLISQSSDDRI--------KVIILLTDGE----GYYDNNLTT----- 151

Query: 334 YMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQE 389
             +N G+ IY++ +    + ++LLR     + G +F V+ + +L + F +IT+ + E
Sbjct: 152 EAKNNGITIYTIGLGTSVD-ENLLRNIATQTGGMYFPVSSASQLPQVFKRITEIVTE 207


>gi|86749514|ref|YP_486010.1| hypothetical protein RPB_2394 [Rhodopseudomonas palustris HaA2]
 gi|86572542|gb|ABD07099.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 72/449 (16%), Positives = 137/449 (30%), Gaps = 79/449 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID +     R  MQ+ALD+A L     + S            Q 
Sbjct: 28  IFAIALLPMIGFIGAAIDYSRANKARTSMQAALDSAALMVSKDLAS------GVITAGQV 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S   +                             KD       + +          N+F 
Sbjct: 82  SAKAQSYFASLYNNTEAPN------ITVTATYTAKDSTGSSTVLLKGTGDISTEFMNMF- 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS---- 176
                     +   +T           + + + LDV+ SM          +   T     
Sbjct: 135 ----GFPTLGIGSAATATWG----GTRLRVAIALDVTGSMASAGKMPAMQSAAKTLVDNL 186

Query: 177 ------------------NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
                                 +    K + W K         +            ESAG
Sbjct: 187 RANAQTADDLYISIIPFAQMVNVGKSNKNASWIKWDYWEDTTGSCNWWWLTTKSSCESAG 246

Query: 219 NLVNSIQKAI-----------QEKKNLSVRIGTIAY---NIGIVGNQCTPLSN-----NL 259
              +S  ++             +    +       +   N      Q  P+++     N 
Sbjct: 247 RTWSSTNQSQWGGCVTDRDQPADTTKDAPTTAATRFPAANYSACPEQILPMTSAYSSSNA 306

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST-RLKKFVIFITDGENS- 317
             +K +++ L+P   TN    MH A+  L +    +     +  +    +I ++DG N+ 
Sbjct: 307 TTIKDKIDALSPNGGTNQPIGMHWAWMSLQDGAPLNTPAKDADYKYTDAIILLSDGMNTI 366

Query: 318 -----GASAYQNTLNTLQ--ICEYMRNAGM------KIYSVAVSAPPEGQ-DLLRKCTDS 363
                  S++   ++  Q  +C+ +R A         IY++ V+   + + ++L+ C DS
Sbjct: 367 DRWYGNGSSWSKDVDARQKLLCDNIRAASAASTTKTVIYTIQVNTDGDPESEVLKYCADS 426

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G FFA   +  +  +F +I   + +  +
Sbjct: 427 -GNFFATTTASGISTAFAQIGASLSKLRI 454


>gi|197105075|ref|YP_002130452.1| hypothetical protein PHZ_c1612 [Phenylobacterium zucineum HLK1]
 gi|196478495|gb|ACG78023.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 521

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 64/186 (34%), Gaps = 40/186 (21%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN-EKESSHNTIGST 302
           N G        L+ + + ++  ++ L    +TN    +   +  L             + 
Sbjct: 331 NAGCGLRPIIRLTTDFDGLRDAVDDLVADGSTNIPMGLVWGWHTLAPMAPFPDGVPYLTE 390

Query: 303 RLKKFVIFITDGENS-------------------------------GASAYQNTLNT--- 328
           + KK V+ +TDGEN+                                 S+ Q        
Sbjct: 391 KHKKIVVLMTDGENTILYKDTPNGSDYSGVGHARQGRVLDPAGRPITESSSQRERTAALD 450

Query: 329 ---LQICEYMRN--AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
              L++C  M+     ++IY++ V        +L+ C  S+  ++ V ++ ++  +F  I
Sbjct: 451 DRLLKLCANMKAPAKDIEIYAIRVEVSSGSSSVLQTCASSADHYYDVQNAADMTMAFQSI 510

Query: 384 TDKIQE 389
             +I  
Sbjct: 511 AGQIAA 516


>gi|315498201|ref|YP_004087005.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416213|gb|ADU12854.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 570

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 51/256 (19%), Positives = 92/256 (35%), Gaps = 29/256 (11%)

Query: 163 LYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR------KIDVLIES 216
            + + +N +N+           P  S+   N T +    +            K +  I +
Sbjct: 314 TWTRTNNASNSTPWPSASYYGTPSYSYAQYNGTITATPTSAGGYGSGSTTTIKDNSTITA 373

Query: 217 AGNLV----NSIQKAIQEKKNLSVRIGT--IAYNIGIVGN----------QCTPLSNNLN 260
             +L+    +S    + ++K      G   IA N   +                L+ ++ 
Sbjct: 374 NSDLLGVGTDSWNGCVIDRKQPYDVSGQSPIASNTDTLYPAAKCATNNLLPVMGLTTDIA 433

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNE-KESSHNTIGSTRLKKFVIFITDGENS-- 317
            V++   KL P  NTN    +      L  E   ++          K++I ITDGEN+  
Sbjct: 434 AVRAHAQKLTPAGNTNITIGVQWGMELLSPELPFNTAKPYSDKTNYKYMIVITDGENTQN 493

Query: 318 --GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
               SA      TL  C+  ++ G+ +Y++ V       D+L+ C      F+ V  S +
Sbjct: 494 RWSTSASTINARTLLACQAAKDLGITVYTIRVME--GNSDMLKSCASRPEYFYDVTASSQ 551

Query: 376 LLESFDKITDKIQEQS 391
           L  +  K+   IQ   
Sbjct: 552 LTSTLAKVFYSIQSTR 567


>gi|315498202|ref|YP_004087006.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416214|gb|ADU12855.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 489

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 66/476 (13%), Positives = 141/476 (29%), Gaps = 87/476 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK--- 57
           M  +  S+  + +  A+D ++++  R++ Q ALDAA L    +++   T++         
Sbjct: 17  MFGLFFSILIVSMAGAVDYSNVISRRSKAQDALDAATL--AVAVLRPATVEQAQAAVKLR 74

Query: 58  ------DQTSTIFKKQIKKHLKQGSYIRENAGDIAQK--AQINITKDKNNP-LQYIAESK 108
                 D    +   Q     K  +Y     G         +NI +       + I  + 
Sbjct: 75  LDKELGDNPDKVVIGQFNYDTKTRTYYVTAKGTYKPFLLGVVNIKEIPYEVISETIQAAN 134

Query: 109 AQYEIPT---ENLFLKGLIPSALTNLSLRSTG------IIERSSENLAISICMV------ 153
              E+         +  ++  + T L +  T        +  S+    + + +V      
Sbjct: 135 GTLELALVLDNTDSMGQILNGSSTRLDVLKTAATNLVNTVMTSANKDYVKVAVVPYADYV 194

Query: 154 ----LDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
                + S+S   +           T              +    +     P      + 
Sbjct: 195 NVGLANRSQSWVSVGADYTVPAAAKTCTTISTKQVCTGGVYGTCDSIKDGVPIKVGCWKT 254

Query: 210 IDVLIES---------------------AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV 248
                                         + V+S  K +     L+   G +       
Sbjct: 255 PQTCTTVNITPYQSCNNPQPTYYKWYGCVRHQVDSKTKMLVLPDPLTAYTGVLE-TAQKC 313

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYEN-----TNTYPAMHHAYRELYNE---KESSHNTIG 300
                PLSN+   V + +  L          T     +H     L      KE       
Sbjct: 314 PTAIQPLSNDKTVVTNSIKGLVNSIGSYKPDTFIPGGLHWGVNTLSPPAPFKEGMAYDSK 373

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNT---------------------LQICEYMRNAG 339
           +   KK ++ +TDG N+  +     + +                        C+Y +   
Sbjct: 374 NKEPKKVIVLMTDGANTLYTNSSGQIVSAATGSPPTISSSLVAPTYTAQDNACKYAKGKN 433

Query: 340 MKIYSVAVSA-PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           ++++ + +    P     L+ C   +  +F   ++ +L+E+F+ I  K+    VR+
Sbjct: 434 IEVFVIGLGVTDPTALSALKSCATDAQHYFDAQNANDLIEAFEIIGGKLS--VVRL 487


>gi|192291928|ref|YP_001992533.1| hypothetical protein Rpal_3558 [Rhodopseudomonas palustris TIE-1]
 gi|192285677|gb|ACF02058.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 455

 Score = 96.1 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 65/449 (14%), Positives = 136/449 (30%), Gaps = 80/449 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  A+D +     R  +Q+ALD+A L      +  R +   T   DQ 
Sbjct: 28  IFALALVPLLGFIGVAVDYSRANNARTSLQNALDSAAL------MLSRDLGVGTITPDQV 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S+  +           Y  +  G +         KD +         +   +     +  
Sbjct: 82  SSKAQTYF-----NSLYTNKETGAVTV-TATYTAKDGSGSSTIAMSGQGAVQTQFMKILG 135

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS---- 176
                      ++        +     + + M LDV+ SM                    
Sbjct: 136 FQ---------TMAIGSSTTTTWGGTRLRVAMALDVTGSMASAGKMSAMKTAAKNLVDSL 186

Query: 177 ------------------NKYLLPPPPKKSFWSK-NTTKSKYAPAPAPANRKIDVLIES- 216
                                 +    + + W + +          +           + 
Sbjct: 187 RASAQTADDVYISVVPFAQMVNVGSSNRNANWVRWDLWDESNGSCSSWWYSTKSSCEYAG 246

Query: 217 --------------AGNLVNSIQKAIQEKKNLSVRIGTIAYNI----GIVGNQCTPLSNN 258
                           +             + + R   + Y+      +       LSN 
Sbjct: 247 RTWTATSHNQWAGCVTDRDQPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSAYSLSNA 306

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYREL-YNEKESSHNTIGSTRLKKFVIFITDGENS 317
              +K++++ L+P   TN    MH A+  L   +  ++     + +    +I ++DG N+
Sbjct: 307 TT-IKNKIDALSPNGGTNQAIGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILLSDGLNT 365

Query: 318 GASAYQNTLN--------TLQICEYMRNAG-----MKIYSVAVSAPPEGQ-DLLRKCTDS 363
               Y N  +           +C+ +R +      + IY++ V+   + +  +L+ C DS
Sbjct: 366 VDRWYGNGRDWSPQVDARQRILCDNIRASATNTNPVVIYTIQVNTDGDPESTVLKYCADS 425

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G FFA   S  +  +F +I   + +  V
Sbjct: 426 -GNFFATTTSSGIGTAFAQIGSSLSKLRV 453


>gi|323138635|ref|ZP_08073702.1| hypothetical protein Met49242DRAFT_3090 [Methylocystis sp. ATCC
           49242]
 gi|322396123|gb|EFX98657.1| hypothetical protein Met49242DRAFT_3090 [Methylocystis sp. ATCC
           49242]
          Length = 547

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 74/207 (35%), Gaps = 61/207 (29%)

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHN 297
           G+ ++       +   L+   ++V++++N+L     TN +      +R L  N   S   
Sbjct: 331 GSSSFCPDPGTQRILQLTQKKSDVQNKINQLVANGATNLHEGFMWGWRTLSPNAPFSGGR 390

Query: 298 TIGSTRLKKFVIFITDGEN----------------------------------------- 316
              + + +K ++F+TDG N                                         
Sbjct: 391 AYQAPKNRKIMVFMTDGFNSWNSRVNTATGSTYDTLGYYSYNGAENERFPDGSQGNGVNY 450

Query: 317 --------SGASAYQN------TLNTLQICEYMRNAGMKIYSVAVSAPPE-----GQDLL 357
                   + +S+YQ          T Q C   + AG++++++  S   +     G  L+
Sbjct: 451 RSLLAAAANNSSSYQTISRAMQDELTRQACTNAKTAGIEVFTIGFSVSGDPIDAQGLALM 510

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKIT 384
           ++C  +   +F   D+ +L  +F +I 
Sbjct: 511 KECATNEDHYFKAEDASQLNAAFSQIG 537



 Score = 47.2 bits (110), Expect = 0.005,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 65/185 (35%), Gaps = 24/185 (12%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ V  +    A D       R  +Q A D+AVL+  + + ++ T       + Q     
Sbjct: 7   LMPVMLMLGATA-DYTRFTTTRAALQQAADSAVLTVASKM-TESTTNAQAKDQAQVVLNA 64

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           + ++   +  G+ + E+   +   A++ I     N    +A+             L  L 
Sbjct: 65  QPRMTTAIVTGATVSEDKRTVCATAKVTI----QNSFMQMAQ-------------LATLT 107

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
           P+  +  +L        + E     I +VLD S SM      +   +   ++    +   
Sbjct: 108 PTVKSCANLAGGADPGTTYE-----IALVLDNSGSMNSSSDGQSKISILKSAANSFVDTM 162

Query: 185 PKKSF 189
             KS 
Sbjct: 163 FSKSN 167


>gi|39936212|ref|NP_948488.1| hypothetical protein RPA3149 [Rhodopseudomonas palustris CGA009]
 gi|39650067|emb|CAE28590.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 455

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 65/449 (14%), Positives = 136/449 (30%), Gaps = 80/449 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  A+D +     R  +Q+ALD+A L      +  R +   T   DQ 
Sbjct: 28  IFALALVPLLGFIGVAVDYSRANNARTSLQNALDSAAL------MLSRDLGVGTITPDQV 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S+  +           Y  +  G +         KD +         +   +     +  
Sbjct: 82  SSKAQTYF-----NSLYTNKETGAVTV-TATYTAKDGSGSSTIAMSGQGAVQTQFMKILG 135

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS---- 176
                      ++        +     + + M LDV+ SM                    
Sbjct: 136 FQ---------TMAIGSSTTTTWGGTRLRVAMALDVTGSMASAGKMSAMKTAAKNLVDSL 186

Query: 177 ------------------NKYLLPPPPKKSFWSK-NTTKSKYAPAPAPANRKIDVLIES- 216
                                 +    + + W + +          +           + 
Sbjct: 187 RASAQTVDDVYISVVPFAQMVNVGSSNRNASWVRWDLWDESNGSCSSWWYSTKSSCEYAG 246

Query: 217 --------------AGNLVNSIQKAIQEKKNLSVRIGTIAYNI----GIVGNQCTPLSNN 258
                           +             + + R   + Y+      +       LSN 
Sbjct: 247 RTWTATSHNQWAGCVTDRDQPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSAYSLSNA 306

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYREL-YNEKESSHNTIGSTRLKKFVIFITDGENS 317
              +K++++ L+P   TN    MH A+  L   +  ++     + +    +I ++DG N+
Sbjct: 307 TT-IKNKIDALSPNGGTNQAIGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILLSDGLNT 365

Query: 318 GASAYQNTLN--------TLQICEYMRNAG-----MKIYSVAVSAPPEGQ-DLLRKCTDS 363
               Y N  +           +C+ +R +      + IY++ V+   + +  +L+ C DS
Sbjct: 366 VDRWYGNGRDWSPQVDARQRILCDNIRASATNTNPVVIYTIQVNTDGDPESAVLKYCADS 425

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G FFA   S  +  +F +I   + +  V
Sbjct: 426 -GNFFATTTSSGIGTAFAQIGSSLSKLRV 453


>gi|83859216|ref|ZP_00952737.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852663|gb|EAP90516.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 441

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 63/447 (14%), Positives = 147/447 (32%), Gaps = 96/447 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+++    + +  A+D +    I  ++QSA+DA  L+  +            ++ +  
Sbjct: 38  MFAMLLGPLVVSVGGALDYSRTFTIGAEIQSAMDAGTLAAASL-----------SQGEDP 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQYEIPTENLF 119
            TI +  I   L + +        + ++  + ++ D   N  +  A++            
Sbjct: 87  ETIVRNYITAALSEHN-------GVLERLNVQVSSDLAINSREVTADAVISV-----PTL 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           + G+I      L+  S      +     + I +VLD+S SM    +    D         
Sbjct: 135 MLGIIGYDALTLNRVSEA----NERVRNLEISLVLDISGSMSGSKITALRDAAEEFVGVM 190

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV-------NSIQKAIQEKK 232
           + P                 + +  P N  + +      +LV         ++  + +  
Sbjct: 191 MDPDLE-----------GLTSLSVIPYNGGVRLPQTVTNDLVPGTPNDSGCLELGVSDP- 238

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNE------------------VKSRLNKLNPYEN 274
            +++ +    Y+     ++        +                   + + +  L+   N
Sbjct: 239 -VTMDLAANGYDWLDWQDRDQR-GWRSSAFCPEENEATVFLEQTPSVLVNLIRDLDAGGN 296

Query: 275 TNTYPAMHH-------AYR-ELYNEKESSHNTIGSTRLKKFVIFITDGENSGA-----SA 321
           T    A          A+R  L  +  S           K ++ +TDG  +       + 
Sbjct: 297 TGLDVATAWGARALDPAWRGRLGGDFASRPAAYDDPSTMKVLVVMTDGAATAQIRRAQNW 356

Query: 322 YQNTLNT-LQICEYMRNA-----------GMKIYSVAVSAPP-EGQDLLRKCTDSSGQFF 368
           Y +  +  +      R+            G+ IY++A        ++L+R C      ++
Sbjct: 357 YGDWYSYEIYSASQARDNMADACDAAEAEGVHIYTIAFQVSGSTNRNLMRDCASRPENYY 416

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIA 395
           AV +  ++  +F+ I   +    +R+A
Sbjct: 417 AVENL-DISAAFNSIAADLNN--LRLA 440


>gi|144898053|emb|CAM74917.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 460

 Score = 93.4 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 74/469 (15%), Positives = 145/469 (30%), Gaps = 113/469 (24%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +I +       A+D A    +++++  ALDAA L+  +S          T    +   I 
Sbjct: 22  LIPLSLSV-GLAVDTARAYAVKSKLSQALDAAALAVGSS----------TGTAAELQQIG 70

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           +K    + K          D A    +++T D       +  +    ++ T    L  L+
Sbjct: 71  QKFFDANFKDSGL------DAAGSFSVSVTGD-------VVSANGSAQVQTT---LMQLV 114

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                 +S  +  I         + + +VLD + SM          +        L    
Sbjct: 115 GIDTIAVSESAQVIRSI----KGLELALVLDNTGSMTTSDNIGALRDAAQELVDILFGGR 170

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA---------GNLVNSIQKAIQE----- 230
                          +  P P    +    ++          G ++  + +A+++     
Sbjct: 171 ADHPTLRVAVVPYSASVNPGPIAPTLISGNDAYAPTNLLGWKGCVIERVGRAMEDSPAST 230

Query: 231 ------------------KKNLSVRI------GTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
                              K  +VR       G    N+G      TPL+     V S +
Sbjct: 231 APWLRYQWLPAIDNYYDATKASTVRADPSQGNGGTGPNLGCPT-PITPLTGVKATVDSAI 289

Query: 267 NKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGEN------- 316
             L       T     M    R L  E   +      + +  K VI +TDG+N       
Sbjct: 290 QALRAWSRGGTMGDIGMAWGLRVLSPEPPFTEGLAWNTPKWAKAVILMTDGDNQFYKLTS 349

Query: 317 -----------------------------SGASAYQNTLNTL--QICEYMRNAGMKIYSV 345
                                        +  +  ++ +NT   Q+C+ M++ G+ +Y++
Sbjct: 350 TTGPNKVNSAVNSDYSGYGRLDQYGALGTTSTTTAKSVINTRLTQVCQAMKDKGITVYTI 409

Query: 346 AV--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                     +D+ + C  S+ ++F      +L  SF  I  ++ +  V
Sbjct: 410 TFTSGINQATKDIYKACASSTAKWFDSPSQADLRASFRAIATELSQLRV 458


>gi|307943468|ref|ZP_07658812.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773098|gb|EFO32315.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 479

 Score = 92.7 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 71/468 (15%), Positives = 135/468 (28%), Gaps = 117/468 (25%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
              IDL   +  R++M +ALDA+ L           +       D+     +K    +L 
Sbjct: 22  GSGIDLTSALNARSKMANALDASALKLA------GKLSVAKLSDDEIQAGLEKMFTANLS 75

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
           +         ++       +   K      I +  +   + T  + L GL P     L +
Sbjct: 76  RFDLKASALSELE----FEVDWTKG-----ILDVWSDVSVKTHFIGLGGLGPEK---LDV 123

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN-----MTSNKYLLPPPPKKS 188
             T  +  +S+  A+ + +VLDV+ SM+         +       +  N        + S
Sbjct: 124 GVTSRVSFASQ--ALELALVLDVTGSMDGDISSLKEASQLLFEALVPENAGRHDQRIRVS 181

Query: 189 FWSKNTTKSKYAPAPAPANRKID-----VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
               +   +  A A    NR+ D               ++       + N  V  G + Y
Sbjct: 182 IVPYSQGVNLGAKAWKVTNRQSDSSNCVATRGGPNAFTDAYYNYRGARSNFFVAPGALDY 241

Query: 244 --------------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL- 288
                               ++  PL+N+   + + ++ L     T     +   ++ L 
Sbjct: 242 FVIRRGSNVSWYPPRNNCPESEILPLTNSRKTLLAAVDALEAQGGTAGQAGIAWGWKALS 301

Query: 289 -----YNEKESSHNTIGSTRLKKFVIFIT----------------------DGENSG--- 318
                +    S      S+++ K  + +T                      DGE+S    
Sbjct: 302 WTWHPFWPSGSDPAKSFSSQVGKAAVIMTDGDFNVHYTERFNAGCAPVEETDGEDSTHGG 361

Query: 319 ----------------------------------------ASAYQNTLNTLQICEYMRNA 338
                                                             L +CE M+  
Sbjct: 362 KRNRRDNDDDDDDDDDDKKRERGGRCSGGTYSIEEYLPGATKRDAPATQALALCEAMKEQ 421

Query: 339 GMKIYSVAVSAPPE--GQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
            + IY+V         G+DL++ C     +F+   D   L  +F  I 
Sbjct: 422 DVVIYTVYFETTGAKFGKDLMKSCASDPDKFYLAEDRDGLKAAFSAIA 469


>gi|13473479|ref|NP_105046.1| hypothetical protein mll4092 [Mesorhizobium loti MAFF303099]
 gi|14024228|dbj|BAB50832.1| mll4092 [Mesorhizobium loti MAFF303099]
          Length = 477

 Score = 92.3 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 65/469 (13%), Positives = 142/469 (30%), Gaps = 103/469 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +     SV  L   +++D++ +   ++ +Q  +DAAV S    + +         + D +
Sbjct: 25  LFGFAASVLALAAGFSVDISQLYNAKSGLQGVVDAAVTSTARDLTTG-----VIKEADAS 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +    +   +       +   D     +   T             +A   +     F 
Sbjct: 80  KAVQNFLVANSMAGILQPDQIVLDRLVVDRTANT------------VQADAHVDVALFFP 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              + +     + R T        +  I + M+LDV+ SM   +  K +   ++ +    
Sbjct: 128 VFGMGN-----TQRVTASTTSLYSDKTIEVAMMLDVTGSMAANWWAKTDKIGDLQAAAST 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA-------GNLVNSIQKA---IQE 230
                  +    N  + + A  P         L +S         NL   +  A   I  
Sbjct: 183 AVENLLDNNIDPNNPRVRVAIVPYAEAVNTGGLADSVFVEQAGGSNLPPPVPSAGAPIPV 242

Query: 231 KKNLSVRI-----------GTIAYNIG--------------------------IVGNQCT 253
             ++++R            G   Y+                                +  
Sbjct: 243 GSSVTLRPDKCATERKDKDGYADYSSDGPSELRRNNQNQEYLAKVNRDDRMGTCPKPELI 302

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI---------GSTRL 304
           PL+ +  ++   +        T    A+   Y  L     S+              + ++
Sbjct: 303 PLTADKQKLLDTIADFKAAGVTAGGIAVQWGYYMLSPSWRSTIVNARLGSGPANFDNRKV 362

Query: 305 KKFVIFITDGENSGASAYQNT------------LNTLQICEYMRNAGMKIYSVAV----- 347
            K  I +TDG+ + A A                 N   IC+ M+  G++I+++       
Sbjct: 363 GKVAILMTDGQFNTAFAAGRGAPRSQNAGQMSRSNAESICDNMKRDGIEIFTIGFDLDDP 422

Query: 348 ----SAPPEGQDLLRKCTDSS----GQFFAVNDSRELLESFDKITDKIQ 388
               +   + + +L+ C+ +       ++      EL E+F+ I   I+
Sbjct: 423 SMTSTERDQAKSVLQDCSTADTSTLKHYYEAATGPELDEAFNAIVQNIE 471


>gi|254460794|ref|ZP_05074210.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677383|gb|EDZ41870.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 480

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 74/467 (15%), Positives = 139/467 (29%), Gaps = 111/467 (23%)

Query: 1   MTAIIISVCFL-FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + A+ + +  L      +DL      R  +Q  LD A+LS     +              
Sbjct: 42  IFAVFMVLMILTIGGIGVDLMRSERDRTVLQHTLDRAILSAAD--LDQTQTPQAVVDDYF 99

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
            +   +  +           +  G  AQ                   + A  ++      
Sbjct: 100 ETAGLESFLSNVTVDQGINYKTVGAEAQS----------------ITTTAFMKM------ 137

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
                 + +  L+  + G+ E    N+ IS+  VLD+S SM          +   +    
Sbjct: 138 ------AGVDTLNATAAGVAEERIANVEISM--VLDISGSMGIGSKMTQLRSAATSFVNT 189

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-LIESAGNLVNSIQKAIQEKK-NLSV- 236
           +L P  +          S++  A      +++     +  + V     A  E + +LSV 
Sbjct: 190 VLSPENEDLVSVSLVPYSQHVNAGPKIYNELNTNHRHNYSHCVEMADSAYSETELDLSVT 249

Query: 237 ----------RIGTIAYNI----GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
                       G               + T  S + + + +++ +L P   T  +  M 
Sbjct: 250 YDQMQHFQWNYSGANQLTDTICPRYSYERITAFSQDASALNAQIAQLQPRAGTQIFMGMK 309

Query: 283 HA-----------------YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA------ 319
            A                   ++ +  ++       T   K V+ +TDG+NS +      
Sbjct: 310 WAAAMLDPAFNPVVNALVTSNDIDSVFDNRPAAFDDTETLKTVVLMTDGKNSSSMRIKSW 369

Query: 320 -------------------------------------SAYQNTLNTLQICEYMRNAGMKI 342
                                                 A Q       IC   ++AG+ I
Sbjct: 370 AYDSSSDYYHWSRYNLWYYLRRNVNRHYHSRYYWFTHDAAQGDALLDDICNASKDAGIVI 429

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +S+       G D++  C  S   FF V    E+ E+FD I  +I +
Sbjct: 430 WSIGFEVDDHGADVMANCASSPSHFFRVE-GIEISEAFDAIARQINQ 475


>gi|323135758|ref|ZP_08070841.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
 gi|322398849|gb|EFY01368.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
          Length = 588

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 75/207 (36%), Gaps = 61/207 (29%)

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHN 297
           G  A+       +   L+ +   +K+++++L    NTN        +R +  N   ++  
Sbjct: 372 GPNAFCPDHTTQRLLQLTTSQTTIKNKIDQLVANGNTNLQEGFMWGWRTISPNGPFAAGR 431

Query: 298 TIGSTRLKKFVIFITDG------------------------------------------- 314
              ++  +K ++F+TDG                                           
Sbjct: 432 PYATSNNRKVMVFMTDGFNHWGAYPNTVVGSDYEALGYYTYNGEKNLRLPDGSRGDRVDY 491

Query: 315 -------ENSGASAYQNTLN-----TLQICEYMRNAGMKIYSVAVS---APPEGQ--DLL 357
                   NS +S      +     TLQ C   +NAG++++++  S    P + Q  +LL
Sbjct: 492 QNALKAARNSNSSYLATARDAQDELTLQACTNAKNAGVEVFTIGFSTSTDPIDAQGLELL 551

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKIT 384
           + C  +   +FAV ++ +L  +F  I 
Sbjct: 552 KSCATNVDHYFAVENANQLNAAFSSIG 578



 Score = 38.3 bits (87), Expect = 2.4,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 51/156 (32%), Gaps = 24/156 (15%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ V F+    A D       R+ ++ A D AVL+  + + +  T      +        
Sbjct: 32  LVPVMFMLGATA-DYTRYATTRSALRQATDVAVLTVASKLTATTTDAQAKAQAQVILN-A 89

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           + ++       + I          +++ I     N    +A   +             L 
Sbjct: 90  QPRMSTASITTASIATTKQTFCATSEVTI----QNSFMQMARVTS-------------LT 132

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
           PS  +   L        ++ N    + +V+D S SM
Sbjct: 133 PSVTSCADL-----AWGANPNATYEVALVVDNSGSM 163


>gi|304393172|ref|ZP_07375100.1| Flp pilus assembly protein TadG [Ahrensia sp. R2A130]
 gi|303294179|gb|EFL88551.1| Flp pilus assembly protein TadG [Ahrensia sp. R2A130]
          Length = 692

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 69/200 (34%), Gaps = 51/200 (25%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGST 302
           N        + L++N N  +++L  +     TN    +   +R L   E  +      + 
Sbjct: 491 NSMCSSVSVSDLTDNKNTTQAKLTSMQASGATNVQMGVAWGWRTLSPGEPFTEGRPYDAE 550

Query: 303 RLKKFVIFITDGENSG--ASAYQNTLNTL------------------------------- 329
             KK +I +TDG N+    + Y N                                    
Sbjct: 551 DNKKIMIIMTDGNNTYYPTNIYGNQYAQDNKSFYGGHGHSVKGRIFDGYDGEANPGHNSQ 610

Query: 330 -----------QICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSS----GQFFAVND 372
                      + C   +NAG+ IYS+A   P     +  L  C  S       +F  N+
Sbjct: 611 TFTKAMDEHLTETCTNAKNAGITIYSIAFDVPNGSSVKATLEDCASSDVGGGKLYFDANN 670

Query: 373 SRELLESFDKITDKIQEQSV 392
           +  L+++F+KI +++ +  +
Sbjct: 671 NAALIDTFEKIAERLADLRI 690



 Score = 38.7 bits (88), Expect = 1.6,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 55/163 (33%), Gaps = 10/163 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            TA+ + V  + I    D A +   R   QSA+DA  ++   ++ +   ++      ++ 
Sbjct: 37  FTALSLPVMLMAIGAGADYAELYRARVNFQSAVDAGAIAAAKNLAATGQVQTSKDIGEEV 96

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQ-INITKDKNNPLQYIAESKAQYEIPTENLF 119
                  + +   +   I  + GD     Q +  T    +   +      Q +       
Sbjct: 97  FRSNLSHLGEKAVREGQINFDMGDGDCAVQGVITTATLPHDRFFSLSFVDQSQ------- 149

Query: 120 LKGLIPSALT--NLSLRSTGIIERSSENLAISICMVLDVSRSM 160
            KG   + +         +        N  I I +VLD S SM
Sbjct: 150 QKGFGANKIVKGQEEFILSASSTVECGNDTIEIALVLDNSGSM 192


>gi|167644155|ref|YP_001681818.1| Flp pilus assembly protein TadG [Caulobacter sp. K31]
 gi|167346585|gb|ABZ69320.1| Flp pilus assembly protein TadG [Caulobacter sp. K31]
          Length = 562

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 83/278 (29%), Gaps = 51/278 (18%)

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
           D       + +  +S KY        S+   NT  +        A               
Sbjct: 287 DEPDDNTVNISASSSTKYRDARRYSTSYPITNTYLTDTVTPTGTATNAWSTRSTVVAKYA 346

Query: 222 NSIQKAIQEKKNLSVRIG-TIAYNIGIVGNQCTPLSN-----NLNEVKSRLNKLNPYENT 275
            S +  +        + G     N G        L+N     + + VK +L+++    NT
Sbjct: 347 TSNKATLL----SLAKTGTAYGPNAGCGMTSLMRLTNVKAKADRDTVKGKLDQMIASGNT 402

Query: 276 NTYPAMHHAYRELYNEKESSHNTIG----STRLKKFVIFITDGENSG------------- 318
           N    +   +  L      +           R  K ++ +TDG+N+              
Sbjct: 403 NVAMGLIWGWHTLSKNAPFADGVDPATTVGKRTTKVIVLLTDGDNTNDTYNNPNASIYTG 462

Query: 319 -------------------ASAYQNTLNTLQ-----ICEYMRNAGMKIYSVAVSAPPEGQ 354
                               S   N  + +       C   + AG++IY++ V      +
Sbjct: 463 YGYITQGRLLNASNSPLGATSTATNRRDAIDSREARACTNAKAAGVQIYAIGVGVSSHSR 522

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +L+ C      ++ V D+ +L   F+ I   IQ   +
Sbjct: 523 GILQDCASKPEMYYDVTDAAQLASVFNTIAGSIQNLRI 560



 Score = 38.0 bits (86), Expect = 3.1,   Method: Composition-based stats.
 Identities = 33/241 (13%), Positives = 76/241 (31%), Gaps = 12/241 (4%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL----SGCASIVSDRTIKDPTTKKDQ 59
           ++I +  L     ID++     + Q+Q ALDAA L    S   +     TI D     + 
Sbjct: 32  LLIPIAVLTFGL-IDISRASVQKRQLQDALDAATLMAARSTATTNADLDTIGDAALATEM 90

Query: 60  TS---TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
                T         L   + +     ++  K  I+      N       + A       
Sbjct: 91  AGLGVTFGPGNSSFVLGDNNTVVGTIQNVVIKPIISNLWSSTNTP---VSATATVMRSIN 147

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSS-ENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
           +L +  ++ +  +  S   +G  + ++    + S+  VL  + +               +
Sbjct: 148 HLEVALVLDNTGSMASSLGSGGSKITALITASKSLVDVLSAAAARATEADAVKISVVPFS 207

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
               +      ++ W   T  + Y       ++    L+ + G       ++     +++
Sbjct: 208 MTVNIGSTYQTQTSWLTGTQPAAYGVDNFATSQNRFTLLSNLGLTWGGCVESRPAPFDVT 267

Query: 236 V 236
            
Sbjct: 268 D 268


>gi|307941972|ref|ZP_07657325.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307945282|ref|ZP_07660618.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307771155|gb|EFO30380.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774878|gb|EFO34086.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 412

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 64/406 (15%), Positives = 136/406 (33%), Gaps = 59/406 (14%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
           +  ID++     R+Q Q   D   L    +    R        K+Q     +   +K L 
Sbjct: 36  SVGIDMSFAYNKRDQSQLVADEVSLFAVTTF---RKYVADGMSKNQARKRAETDARKFL- 91

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
             +   ++     +K  I I           A      +      ++   +     + + 
Sbjct: 92  --TARTKSLDGTTEKFSIKINIVDREAKVVKANVNISGK---HESYMTHAMGFDNIDYTA 146

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
            S   I    +     I +V DVS SM      +                 P    W  +
Sbjct: 147 DSESTI-SFGQGKYEFIFLV-DVSPSMGIGASNRDRQIMQRAIGCQFACHEP----WYSS 200

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
            +++K A A      +IDV+ ++  +LV  +++A +    + +R G  +++  +     T
Sbjct: 201 VSRAKSAGARL----RIDVVKDALKSLVTQLEEATE----VDLRTGLYSFSNYLHIQ--T 250

Query: 254 PLSNNLNEVKSRLNKLN------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
            L+  +++ K   NK+           TN +          +N    S        +K+ 
Sbjct: 251 GLNKGISKFKREANKIAIHREYLRGGGTNFHGVFSD-----FNGVLRS--LKPKADVKQH 303

Query: 308 VIFITDGEN-------SGASAYQNTLNTL--------QICEYMRNAGMKIYSVAVSAPPE 352
           +I I+DG N       +    +  T N          + C+  +   ++     +  P  
Sbjct: 304 IIIISDGVNHLNLRSGTNRHLWNQTPNWRPYNYSFNPRWCDEFKKGEVRTVHTMLVEPDR 363

Query: 353 GQDL------LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              +      +R C  S+  F++ N + E+ ++F  + + + +   
Sbjct: 364 AHYVRASTSSMRACATSADFFYSANSAAEIDKAFKDLFEALLKSVY 409


>gi|209884898|ref|YP_002288755.1| hypothetical protein OCAR_5764 [Oligotropha carboxidovorans OM5]
 gi|209873094|gb|ACI92890.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 600

 Score = 90.0 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 69/160 (43%), Gaps = 14/160 (8%)

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL--YNEKESSHNTIGSTRL 304
            +    TP+SN    + S++N +NP  NTN    +   ++ L   N+   + +   +   
Sbjct: 439 CLSATITPMSNQWATLNSKVNAMNPSGNTNQAIGLFWGWQTLNTANDPFKAPSKDPNWVY 498

Query: 305 KKFVIFITDGENSGASAYQNTLNT---------LQICEYMRNAGMKIYSVAVSAPPEG-- 353
           + +++ ++DG N+    Y                 +C+ ++   + I+++ V+   +   
Sbjct: 499 QDYIVILSDGLNTQNRWYTCPNAGPCPTIDGREKTLCDNIKADKITIFTIQVNINSKDPE 558

Query: 354 QDLLRKCTDSSGQFFA-VNDSRELLESFDKITDKIQEQSV 392
             +L+ C  S   +F  +  + +   +FD + +KI +  +
Sbjct: 559 SQVLKDCASSGSGYFQLITSANDTATAFDNVLNKIAKLRI 598



 Score = 46.4 bits (108), Expect = 0.008,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 81/270 (30%), Gaps = 49/270 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            T + I      +  A+D   +   R  MQSALD+A L       +  +  + TT+  Q 
Sbjct: 28  FTLVAIP-LVALVGAAVDYTRVSSARTAMQSALDSAALMISKDAAT-MSDSEITTRARQY 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                   +  ++                  +     NN         A   +PT  + +
Sbjct: 86  VNSLYTNTETPIQ----------------TFSAVYTPNNGSGATILLNAGGNMPTYFMKI 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G    +   ++  ST     S     + + +VLD + SM+                   
Sbjct: 130 VG-TNFSTLPINTASTTKWGSSR----MRVALVLDNTGSMDQNGKMTAL----------- 173

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                          K   A A     +K+     + G++  S+    ++    +  +G 
Sbjct: 174 ---------------KKAAANATTGLIKKLSAFNTNEGDVYISVVPFAKDVNVGTSNVGA 218

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
              N          L++N   +K + N + 
Sbjct: 219 SWLNWSEWEAAPRILTDNSYPIKVKYNNIT 248


>gi|32471725|ref|NP_864718.1| hypothetical protein RB2055 [Rhodopirellula baltica SH 1]
 gi|32397096|emb|CAD72400.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 402

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 59/399 (14%), Positives = 131/399 (32%), Gaps = 45/399 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I++ V  +   Y I++A++  +    Q   DAAV +     +               
Sbjct: 43  LLVIMLPVLLILAAYVINVAYVEAVTADSQVVTDAAVCAAGRVYIQTGDKNAALAAARDA 102

Query: 61  ST---IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
           +    +  K +  ++    +       + +        D  +               +  
Sbjct: 103 AERNPVAGKVVPINMSDLEFGISLRESLDEGYSFQPLSDD-DEFGNAVRLTTLSLSNSPQ 161

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
                L P+  TNL +R   +    S    + + +V+D S SM        ND       
Sbjct: 162 PVFSPLFPTMGTNLEIRPQRVA--VSTQSTMDVALVIDRSGSMA-----YANDEAPDPYV 214

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                PP     W+           P P N +   L+ S       +  + Q       +
Sbjct: 215 NPAAAPP----GWTY--------GDPVPPNSRWLDLVASVNAFNGFLADSPQ-----YEK 257

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKES 294
           +    Y+     +    L++   E+ ++L+ ++       T+    + H    L +    
Sbjct: 258 LCLATYSDNASRDCD--LTHTYAEISNQLDAISYQFNGGGTSVGYGLEHGLAVLTDA--- 312

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
           +H    +    + ++ +TDG ++   + ++    LQ      N G+ ++++  S   +  
Sbjct: 313 THARKFAV---RVMVLMTDGHHNTGKSPESMTYHLQ------NHGVTLFTITFSDDADQS 363

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            +        G+ F   D+ +L  +F KI  K+     +
Sbjct: 364 RMSNLANACGGENFHATDASQLQNAFQKIAKKLPSLMTQ 402


>gi|327541056|gb|EGF27607.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 497

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 57/427 (13%), Positives = 141/427 (33%), Gaps = 54/427 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  L   + I+LA +  ++ ++  A DAA  +G  +   ++T++        T
Sbjct: 89  LMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEAAKAAARLT 148

Query: 61  STIFKKQIKKHLKQGSYIRENA------GDIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
           + + +   + +                        +   TK   + +     + +   I 
Sbjct: 149 AAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLVAVSSVRIN 208

Query: 115 TENLFLKGLIPSALTNLSLRSTG----IIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
            +      L P      +  S G    +   ++  +   I +VLD S SM+       +D
Sbjct: 209 GKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDWKTYDWPDD 268

Query: 171 NNNMTSNKYLLPPPP--KKSFWSKNTTKSKYAPAPAPA---------------------- 206
            +    +  +           W     + +Y    +                        
Sbjct: 269 ADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWEEVFGLGPA 328

Query: 207 -NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
            N   + L+ +    +  +    Q  +N  V I   +YN     +    L ++ + V++ 
Sbjct: 329 PNTPWEDLVLAVDAFLRVLD---QTPQNEQVSIA--SYNSHGTLDCW--LLDDFDSVRAA 381

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           + +L P  +T     M+       +E    + +       K ++ +TDG ++  +     
Sbjct: 382 VAQLGPNGSTGIGNGMNSGKTAFTHENARPYAS-------KTMVVMTDGNHNYGTQPNTV 434

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
              L     M ++ + I +V      + + +        G+ +  +   EL+ +F++I +
Sbjct: 435 AQQL-----MSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIAN 489

Query: 386 KIQEQSV 392
            +     
Sbjct: 490 NLPTILT 496


>gi|254472518|ref|ZP_05085918.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958801|gb|EEA94001.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 479

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 67/457 (14%), Positives = 146/457 (31%), Gaps = 80/457 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  +F   AID       R  +  ALDAAVL+    + +           + +
Sbjct: 30  LVAFLMVLLIVFAGMAIDFGLGFNTRRAVNQALDAAVLAVANKLST----------TELS 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYE--IPTENL 118
           S      I ++ ++        GD+     + +T D          +       +P   L
Sbjct: 80  SNTVDSLIDQYFEEN-LKNSVGGDVVHTKPV-VTYDPKGDTVAATATATVKTSFLPVLKL 137

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
                       ++  ST    ++   +A+ + +   +S S+  L     +  + +  + 
Sbjct: 138 LNSESGDFGELTVTSSSTARFPKTKVEVAVVVDVTGSMSGSIGSLKTASRDMLDTLLPDD 197

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANR----KIDVLIESAGNLVNSIQKAIQEKKNL 234
                   +  +       K     A        +   +     +L  S +    E ++ 
Sbjct: 198 NTRLQSRVRISYVPYNVGVKLDKTLARKATFEKSQYGCVHARVRDLAYSGENHDYEDEDD 257

Query: 235 SVRIGTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-- 291
             R+  I  N       Q  PL+N+  +++S +N L     T     +   +  L  E  
Sbjct: 258 DERVDYIGTNYSWCPNAQMVPLTNDRTKIESSINALRASSATAGQIGIAWGWYTLSPEWR 317

Query: 292 ----KESSHNTIGSTRLKKFVIFITDG---------------------------ENSGAS 320
                ES  +   +  ++K+ + +TDG                           +NS   
Sbjct: 318 GFWPTESKPDFYDNNGVRKYAVLMTDGSFNAYYAADYSKADAEHKKLIKNKSDVQNSQDP 377

Query: 321 AYQNTLNTL----------------------------QICEYMRNAGMKIYSVAVSAPPE 352
                L+                               +C+ M+   + IY+V   +  +
Sbjct: 378 MDSGKLDADDHKKIASKVKWEYDYSSSLSGVPFKTASNLCKNMKKEDIVIYTVFFGSDYK 437

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           G+ ++ +C  +S  F+   +   L+++F  I + I+ 
Sbjct: 438 GKKIMEECASNSETFYHATNQSALIQAFSSIANDIKS 474


>gi|85859126|ref|YP_461328.1| von Willebrand factor type A domain-containing protein [Syntrophus
           aciditrophicus SB]
 gi|85722217|gb|ABC77160.1| von Willebrand factor type A domain protein [Syntrophus
           aciditrophicus SB]
          Length = 447

 Score = 88.8 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 55/349 (15%), Positives = 123/349 (35%), Gaps = 79/349 (22%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V   F   A+D+      R+++  ++DA  ++G       + I +P   +D  
Sbjct: 15  IFALLLIVLLGFTALAVDVGRWYTTRSELSKSVDAGAIAGA------KNISNPYLGEDGH 68

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++  +++   G  +  ++G   + A      D+++ ++      +          L
Sbjct: 69  LRLAEEVARENFSAGYLMTPDSG--ERSATFTAYADEDHRIRVEGTVSS-------PGNL 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL        S           +   + I +VLD S SM+   +               
Sbjct: 120 AGLFGVDWVATSAMGVA------KKNEVEIMLVLDRSGSMDGTPMND------------- 160

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                                           L ++A + V S  +  Q++     ++G 
Sbjct: 161 --------------------------------LKKAARSFV-SFFEETQDQD----KMGL 183

Query: 241 IAYNIGIVGNQCTPLSNN-LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
           +++   +  +   PL NN ++ + S++N ++    TN   ++  A               
Sbjct: 184 VSFATSVKVD--VPLGNNYVSSMTSKINAMDAVGATNAEDSLSQAGNPAKGGLTDQSGVP 241

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQI----CEYMRNAGMKIYS 344
           G+ R+++FVIF +DG  +          T  I    C    + G  +Y+
Sbjct: 242 GNKRVQQFVIFFSDGNPTAFRGKFKYNGTDNIDAVVCGTGNDCG-TVYT 289


>gi|257062895|ref|YP_003142567.1| hypothetical protein Shel_01450 [Slackia heliotrinireducens DSM
           20476]
 gi|256790548|gb|ACV21218.1| uncharacterized protein [Slackia heliotrinireducens DSM 20476]
          Length = 744

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 73/189 (38%), Gaps = 30/189 (15%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
             +     ++I K+  +          ++Y+        +  ++N   +K+ +  L+   
Sbjct: 401 KTATREFASTIFKSDADVC-------LVSYDSSARNVIDS--TDNEYALKAAVRDLSAGG 451

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            TN   A+  +Y  L           GS   K+ ++ ++DGE +         + +    
Sbjct: 452 GTNIEDALRVSYERL----------EGSGSDKRIIVLMSDGEANEGLVGD---DLIAYAN 498

Query: 334 YMRNAGMKIYSVAV----SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            +++ G+ IY++      S   E Q ++     S G  + V+D+ +L   F  I D I  
Sbjct: 499 EIKDDGVTIYTLGFFQSVSDKAECQRVMEGIA-SPGCHYEVDDASQLRYFFGDIGDDING 557

Query: 390 Q---SVRIA 395
                VRIA
Sbjct: 558 TRFIYVRIA 566


>gi|254486311|ref|ZP_05099516.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043180|gb|EEB83818.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 476

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 60/402 (14%), Positives = 107/402 (26%), Gaps = 93/402 (23%)

Query: 72  LKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNL 131
           L     + E          ++    +N         KA  E+ T+ L   G       ++
Sbjct: 79  LAPADVVDEYFAKSGMSDYLSSVTIENGLNFRTVTVKANNEMKTQFL---GRFGFPTLDV 135

Query: 132 SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
              S            + I +VLDVS SM++        +   T    +L P  K +   
Sbjct: 136 PALSKAEERVEK----VEISLVLDVSGSMKNNSKLTTMKDAAKTFIDTVLRPETKNNVSL 191

Query: 192 KNTTKSKYAPAPAPANRKIDVLIE-----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
                S+           + V                  +          +     +N  
Sbjct: 192 SLIPYSEQVNVGPDIFNALWVDTRHDFSYCIDVPDGHFVQTQMTPGFPWDQTQHFQWNTY 251

Query: 247 ------------------IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                              V  +  P+S +   +K++++   P   T  Y  M      L
Sbjct: 252 SIESGYQQNTLHDTVCPRAVYERVRPISQDGPSLKAQIDLFQPRAGTAIYMGMKWG-TAL 310

Query: 289 YNEKESSHNTI------------------GSTRLKKFVIFITDGENSGASAYQNTL---- 326
            +                                 K ++ +TDG+NS +           
Sbjct: 311 LDPSFRETTASLVSDSVVESTFADRPADYSDRETLKTIVLMTDGQNSNSQRISTAYYNSS 370

Query: 327 -------------------------------------NTL--QICEYMRNAGMKIYSVAV 347
                                                NTL   IC   ++ G+ I+++  
Sbjct: 371 SEVVHWSKWNFNYYLSQYIKEKDWHRYYYTRYTAEKGNTLMDNICSAAKDEGIVIWTIGF 430

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                G D+++KC  S   FF V    EL ++F  I  +I +
Sbjct: 431 EVNDTGADVMKKCASSPSHFFRVE-GVELTDAFSAIASQINQ 471


>gi|32472883|ref|NP_865877.1| signal peptide [Rhodopirellula baltica SH 1]
 gi|32444120|emb|CAD73562.1| hypothetical protein-signal peptide and transmembrane prediction
           [Rhodopirellula baltica SH 1]
          Length = 434

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 57/427 (13%), Positives = 141/427 (33%), Gaps = 54/427 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  L   + I+LA +  ++ ++  A DAA  +G  +   ++T++        T
Sbjct: 26  LMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEAAKAAARLT 85

Query: 61  STIFKKQIKKHLKQGSYIRENA------GDIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
           + + +   + +                        +   TK   + +     + +   I 
Sbjct: 86  AAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLVAVSSVRIN 145

Query: 115 TENLFLKGLIPSALTNLSLRSTG----IIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
            +      L P      +  S G    +   ++  +   I +VLD S SM+       +D
Sbjct: 146 GKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDWKTYDWPDD 205

Query: 171 NNNMTSNKYLLPPPP--KKSFWSKNTTKSKYAPAPAPA---------------------- 206
            +    +  +           W     + +Y    +                        
Sbjct: 206 ADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWEEVFGLGPA 265

Query: 207 -NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
            N   + L+ +    +  +    Q  +N  V I   +YN     +    L ++ + V++ 
Sbjct: 266 PNTPWEDLVLAVDAFLRVLD---QTPQNEQVSIA--SYNSHGTLDCW--LLDDFDSVRAA 318

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           + +L P  +T     M+       +E    + +       K ++ +TDG ++  +     
Sbjct: 319 VAQLAPNGSTGIGNGMNSGKTAFTHENARPYAS-------KTMVVMTDGNHNYGTQPNTV 371

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
              L     M ++ + I +V      + + +        G+ +  +   EL+ +F++I +
Sbjct: 372 AQQL-----MSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIAN 426

Query: 386 KIQEQSV 392
            +     
Sbjct: 427 NLPTILT 433


>gi|323493494|ref|ZP_08098616.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
 gi|323312317|gb|EGA65459.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
          Length = 393

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 57/394 (14%), Positives = 139/394 (35%), Gaps = 47/394 (11%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A++I +     +  +    ++     MQ A+D A L+                + +   +
Sbjct: 20  AMLIPMIIAAASTIVIGYQVLLSNRAMQ-AVDTASLAC-------------EFRGEYDRS 65

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
           I +  +  +  +                  +T           E    Y     +L    
Sbjct: 66  IAQGYLDYYKPKID---------------KVTATLGASSGCKVELGYSYSSIFTSLTFSD 110

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM---EDLYLQKHNDNNNMTSNKY 179
              S +  ++      +   +++  I + +VLD+S SM    D      N       ++ 
Sbjct: 111 --ASYVAGVTASQKVYVTEVTDSDPIELVLVLDISGSMMGALDELKSILNRGLTTLRSQQ 168

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRK-----IDVLIESAGNL--VNSIQKAIQEKK 232
                      S     +  +   AP  +      +D  + S G+    N++        
Sbjct: 169 ANVAGQDHIKVSIVPFSNGVSVTDAPWLKSGGTLCVDATVNSGGSFSPANTVANLDVTHD 228

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
              V   + + +   + +   PL++NLN+V   +N+L    +T +Y  +    R+L    
Sbjct: 229 QAPVTTSSSS-SDCSLTSVILPLTSNLNDVVDAVNRLQTIGSTASYQGLLWGLRQLTPNW 287

Query: 293 ESS---HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
           +S+           +++ ++ +TDG     +++ + L    +C   ++ G+++  +    
Sbjct: 288 QSAWRVGPNRNQDNVQRKLVLMTDG--MDDNSHLDELINAGLCTRAKDLGIELNFIGFGV 345

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                +   +C  S+G  F+ N++++L + F ++
Sbjct: 346 QSWRLEQFTRCAGSAGAVFSANNTQDLDDYFSQL 379


>gi|315499132|ref|YP_004087936.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315417144|gb|ADU13785.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 519

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 59/140 (42%), Gaps = 7/140 (5%)

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI-GSTRLKKFVIFITD 313
           L+++   V + L+ L+P  NTN    +      L   +  +  T  G T +KK++I +TD
Sbjct: 377 LTSDFTSVNTYLSSLSPGGNTNITLGVQFGMEMLSPAEPYTKATAFGDTDVKKYMIIVTD 436

Query: 314 GENSGASAYQNTL----NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           G N+      +       T   C   +  G+ ++ V V        LL  C   S  ++ 
Sbjct: 437 GANTQNRWSTSNSAINARTALACTAAKAQGITLFVVRV--EDGDSSLLEACASQSSYYYD 494

Query: 370 VNDSRELLESFDKITDKIQE 389
           ++ + +L ++   I   I +
Sbjct: 495 LSQASDLTKTMQDIFATINK 514



 Score = 40.7 bits (93), Expect = 0.42,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 48/165 (29%), Gaps = 25/165 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +   +       A+D+       +++Q A DAAVL     I              + 
Sbjct: 22  IFGLCAVILVGAAGGAVDMMRYFDTSSRLQDATDAAVLKATQKI--------------EV 67

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S    K       + +         A       T D    + Y +E   +        + 
Sbjct: 68  SEAAAKTAAAMAFEMNLSDHPELQTASHTFAIETSDNAKVVHYTSEITQR-------PYF 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
             L+      + + S+      SE+    +  VLD + SM     
Sbjct: 121 LQLLGLGEQTIRVASSA----QSESDPFELLFVLDTTGSMASNNK 161


>gi|91977525|ref|YP_570184.1| hypothetical protein RPD_3057 [Rhodopseudomonas palustris BisB5]
 gi|91683981|gb|ABE40283.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 464

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 61/457 (13%), Positives = 122/457 (26%), Gaps = 87/457 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  AID +     R  MQ+ALD+  L     +VS     D     + +
Sbjct: 28  IFALTLLPILGFIGAAIDYSRASRARTAMQAALDSTAL-----MVSKDLGADKIKTSEVS 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                           Y    A  +         KD +     +             +F 
Sbjct: 83  EKAQTYF------NSLYTGTEARGVTLTTNY-TAKDDSGSSTVVVNGDGAVSTHFMKMF- 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                     +   +T           + + M LDV+ SM      K  +     S    
Sbjct: 135 ----GFPSLAIGSAATATWG----GTRLRVAMALDVTGSMVLNGSTKLAEMKKAASALVD 186

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL--------------------------- 213
                 +S      +   +A      +  ID                             
Sbjct: 187 TLRASAQSKDDLYISVVPFAQMVNVGSSNIDASWIKWDVWDETEGSCSKSKFKTKTDCED 246

Query: 214 -------------IESAGNLVNSIQKAIQEKKNLSVR-------IGTIAYNIGIVGNQCT 253
                             +             +   R       +GT +    I      
Sbjct: 247 NGRTWTVTDRSKWKGCVTDRDQPADTTKDAPTSDDTRFPALRTLLGTTSCPAQIFPMTSA 306

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFIT 312
             + +  ++K  ++ L     TN    M  A+  L      ++     + +    +I ++
Sbjct: 307 YAATDAQKIKDVIDDLVADGGTNQPIGMAWAWMSLQQGNPLNTPAKDPNYKYTDAIILLS 366

Query: 313 DGENSGASAYQNTLNTLQ-----------ICEYMR-----NAGMKIYSVAVSAPPEGQ-D 355
           DG N+            Q           +C+ ++          +Y++ V+   + +  
Sbjct: 367 DGLNTMDRWPDYGDGQRQFDGKIDARQKLLCDNIKLPDSNGKRPVVYTIQVNTTGDPEST 426

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +L+ C    G FFA   +  +  +F +I   + +  +
Sbjct: 427 ILKYCA-DGGNFFATTTASGIGTAFAQIGSSLSKLRI 462


>gi|115525407|ref|YP_782318.1| hypothetical protein RPE_3406 [Rhodopseudomonas palustris BisA53]
 gi|115519354|gb|ABJ07338.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 580

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 65/162 (40%), Gaps = 20/162 (12%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR--LKKFV 308
           + T ++NN   + + ++ L P   TN    +   ++ L          +   +   +  +
Sbjct: 417 KVTEMNNNWATMNTTVDGLFPVGGTNQPIGLVWGWQSLVGGGPFPTPPVKDEQYTYQDII 476

Query: 309 IFITDGENSGASAYQNTLNTLQ-------------ICEYMRNAGMKIYSVAVSAPPEGQ- 354
           + ++DG N+    Y N  +T                C  ++ AG+K+Y+V V+     + 
Sbjct: 477 VLMSDGLNTVDRWYGNGWDTNTSVDNRMYASATTGTCVNVKAAGIKVYTVHVNTNGSPES 536

Query: 355 DLLRKCTDSSG----QFFAVNDSRELLESFDKITDKIQEQSV 392
            LL+ C   +     +F  V  +  L  +F+ I  K+ +  V
Sbjct: 537 TLLKNCASPADDGGKEFQMVTSASGLNAAFNSIATKLTDLRV 578



 Score = 51.4 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 72/238 (30%), Gaps = 66/238 (27%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I       F+  A+D +  +  R  MQSALD+  L            KD +  K   
Sbjct: 27  LFGIACVPLITFVGAAVDYSRAVAARTAMQSALDSTALMVA---------KDYSLNKISA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S I  K       +  +        A   ++      N       +     ++PT+    
Sbjct: 78  SEIDGK------AKSIFSALYTNKSANSVEVVAVLTPNTGKGSTIKVDGTGKVPTD---F 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+  +  ++   ST     +     + + +VLD + SM D                  
Sbjct: 129 MKLVNISQIDIGASSTTTWGSTR----LRVALVLDTTGSMND------------------ 166

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                                     N KI  L  +  NL+  ++ A  + +++ V I
Sbjct: 167 --------------------------NGKIGALKTATQNLLTQLKDAAGKPEDVYVSI 198


>gi|148256121|ref|YP_001240706.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
 gi|146408294|gb|ABQ36800.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
          Length = 602

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 61/165 (36%), Gaps = 23/165 (13%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG-STRLKKFVI 309
           Q  PLS N   +KS +N + P   TN    M  A + L             +T   + +I
Sbjct: 436 QIVPLSYNWTSLKSAVNAMEPTGGTNQAIGMAWAVQSLIPNGVLGAPAEDANTTYNRVII 495

Query: 310 FITDGENSGASAYQNTLNTLQI------------CEYMRNAG-------MKIYSVAVSAP 350
            ++DG N+          + Q             C  ++N           IY++ V+  
Sbjct: 496 LLSDGLNTEDRWPDYGNGSTQASGNPIDARQALLCSNLKNTKDSKGNAMYTIYTIQVNTS 555

Query: 351 PEG---QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                   +L+ C  S  +F+ +  S +++ +F+ I   + +  V
Sbjct: 556 SPADPTSTVLQNCASSPDKFYMLTSSSQIVTTFNSIGTALSKLRV 600



 Score = 36.4 bits (82), Expect = 7.1,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 54/161 (33%), Gaps = 21/161 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID +     R+ MQ ALD+  L   +  +S  TI          
Sbjct: 39  LFAIALLPILAFIGAAIDYSRANAARSAMQGALDSTAL-MLSRDLSQGTITAADVAAK-A 96

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           ST FK        Q   +  +       +  NI            +  A  +I T+    
Sbjct: 97  STYFKALYTSTDAQSVAVTASYTASTSSSASNI------------QLNASGQIVTQ---F 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             L+       + ++T           + + + LD + SM 
Sbjct: 142 MKLVGFPTMTFNTKATTTWGDVK----MRVALALDNTGSMA 178


>gi|323495646|ref|ZP_08100717.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
 gi|323319281|gb|EGA72221.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
          Length = 419

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 59/422 (13%), Positives = 130/422 (30%), Gaps = 55/422 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+II   F   T A D A  +  + +++ A + AVL+  A    ++  +   +     
Sbjct: 14  LFAMIIPGLFGLFTLASDGARAIQTKARIEDASEIAVLAIAAHNDDNKNSQGSGSGSAVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQI-----NITKDKNNPLQYIAESKAQYEIPT 115
             I    ++ +L     +           QI      + + +    QY  E+ +++    
Sbjct: 74  RKIATDYLEAYLHDVDSVNNLKIHKYNCDQIPECVAGLARGEPRFFQYEVEATSRH---V 130

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHN------ 169
                   IP        +      +     A+ I  V D S SM   +    N      
Sbjct: 131 SWFPGDSSIPGFGKTFDAKGAATARKYQSE-AVDILFVADYSGSMAGGWNGGSNRKYIDL 189

Query: 170 ---------DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                    +                 + ++  T       + +    ++        N 
Sbjct: 190 RNIIKVVTDELQKFNDLNNTDNNTVGMTGFNYYTKTKPTNRSNSCFMTQLVYNNNYNINY 249

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
             ++     EK N       ++++      +   L++N +   + +N   P   T +Y  
Sbjct: 250 TKTVNNIFNEKNNKY----CVSHSDSSRF-RDIDLTDNYSSFNTTVNGFYPNHGTASYQG 304

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNA 338
           +    + L             T  ++ +I ++DG++SG S        +    C  ++  
Sbjct: 305 IMRGAQML----------KKGTNPRRLLIVLSDGDDSGTSQKNIHKQLVNAGMCTKIKQE 354

Query: 339 ------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITD 385
                         ++  V           LR C   +   F   ++ + L +  + IT+
Sbjct: 355 LSTGISSSGQSIKARLAVVGFDYNVNNNTALRDCA-GAENVFKAQNTDDILNKILELITE 413

Query: 386 KI 387
           +I
Sbjct: 414 EI 415


>gi|319780897|ref|YP_004140373.1| hypothetical protein Mesci_1159 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166785|gb|ADV10323.1| hypothetical protein Mesci_1159 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 492

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 63/479 (13%), Positives = 149/479 (31%), Gaps = 118/479 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +  SV  L + ++++++ +   R+ +Q  +DAAV S        R +     K+   
Sbjct: 25  LFGLSASVLALAVGFSVNVSQLYNARSSLQGVVDAAVTSTA------RDLTTGAIKEADA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +   +  +  + + G         I Q  QI + +   N      ++ A  ++       
Sbjct: 79  NKSVQAFLDANSQAG---------ILQADQIVLDRLIVNRTAKTVQADAHVDVGLYFPIF 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                    ++   +       S +  + + M+LD++ SM          +    +   +
Sbjct: 130 G------TGDMKRVAASTTALYS-DKTVEVAMMLDITGSMAKRGKVDKIGDLKTAAKNAV 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRK----IDVLIESAGNL---------------- 220
                K+   +     +    A      K    +    +++  L                
Sbjct: 183 QTMLQKQDPQNPRIRVAIVPYASGVNAGKLAENVYAEKQASTELPPVAGSPLLVAKTGKN 242

Query: 221 --------VNSIQKAIQEKKN-------------------LSVRI---GTIAYN------ 244
                   ++ +  A+    N                    +VR    G   Y       
Sbjct: 243 LLPSFSDYISIVGAAMPRPDNCATERKDKNGNADMSADGPDTVRTDGNGKKFYALVNRDD 302

Query: 245 -------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
                        +  PL+ + + +   +        T    A+   Y  L  +  ++  
Sbjct: 303 HLGDGDMNRCPDAKVIPLTADSDALLESIEDFRANGFTAGAIAIQWTYYMLSPQWRTAIR 362

Query: 298 TIG---------STRLKKFVIFITDGE-NSGASAYQNTLN---------TLQICEYMRNA 338
             G           ++ K  I +TDG+ N+  +   ++ N            +C+ M+N 
Sbjct: 363 NAGLGKGASDADPKKIAKVAILMTDGQFNTAFAGAGDSYNRQGTLARGNAETLCDNMKND 422

Query: 339 GMKIYSVAV---------SAPPEGQDLLRKCTDSSG-----QFFAVNDSRELLESFDKI 383
           G++I+++           +   + + +L+ C+          FF V+   EL ++F +I
Sbjct: 423 GIEIFTIGFDLDDKDMSTTERDQAKAVLKDCSSKDTSGAKRHFFDVSTGAELDDAFQEI 481


>gi|116753518|ref|YP_842636.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
 gi|116664969|gb|ABK13996.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
          Length = 795

 Score = 86.1 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 84/234 (35%), Gaps = 27/234 (11%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           D   S + +   + +          +    P     S +++ S     P       D+  
Sbjct: 33  DQHLSRDVISPSEISTVTITLRGGEIPCASPVDVVLSIDSSGSMTTSDPG------DLRK 86

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
            +A   V  +  ++        R+G +++N   +     PL+NN  +++S ++      N
Sbjct: 87  SAAKEFVTGLDLSM-------DRVGVVSWNTSAIS---WPLTNNTKDIESAIDSTGADGN 136

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T     +  A   L     S           K ++ +TDG ++    Y          + 
Sbjct: 137 TCLDTGLKSAIDLLSECSGS-----------KVIVLLTDGISTDGGHYTPPGVPGSPVDE 185

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            R+ G+ ++++ +    + ++L      + G+F++  D+  L   + +I   I 
Sbjct: 186 ARSKGILVFTIGLGPDADARNLTEIAHSTGGEFYSAPDANALAGIYKRIRSSIT 239


>gi|320106407|ref|YP_004181997.1| VWFA-like domain-containing protein [Terriglobus saanensis SP1PR4]
 gi|319924928|gb|ADV82003.1| VWFA-related domain-containing protein [Terriglobus saanensis
           SP1PR4]
          Length = 305

 Score = 86.1 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 75/190 (39%), Gaps = 35/190 (18%)

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
           D        ++    +              I+++  +  ++  P +N+   + + +  L+
Sbjct: 98  DAAKRFVKQMLREQDEMD-----------LISFSDTV--DEIVPFTNDAGRMNAGIGNLH 144

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
             + T+ Y A++ A + L   K  +         +K ++ +TDG N+        +   Q
Sbjct: 145 KGDATSLYDAIYLASQRLTEAKRDATR-------RKILVIVTDGGNT-----TKGMRYQQ 192

Query: 331 ICEYMRNAGMKIYSVAVSAPPEG---------QDLLRKCTDSSGQFFAVNDSRELLESFD 381
             E    AG  IY + +  P E            L++   D+ G++F V D  +L ++F 
Sbjct: 193 AVEAAERAGAAIYPI-IMVPIEADAGRNTGGEHALIQMAQDTGGKYFYVLDKHDLDKAFA 251

Query: 382 KITDKIQEQS 391
            ++D ++ Q 
Sbjct: 252 HLSDDLRTQY 261


>gi|312883763|ref|ZP_07743482.1| hypothetical protein VIBC2010_14219 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368512|gb|EFP96045.1| hypothetical protein VIBC2010_14219 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 396

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 50/410 (12%), Positives = 126/410 (30%), Gaps = 76/410 (18%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDP-----TTKK 57
           A++I +     +  + + + + + N+   A DAA ++       D+ +          K 
Sbjct: 20  AMLIPMVIAAASTIV-IGYQVQLSNRAMQAADAASIACEFKGEYDQALTQSYLDYYQPKI 78

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
           D+     +     ++  G  +      +       +     N   Y+ E           
Sbjct: 79  DKVRGQIRTNSGCNMSLGYSLSTIFTSLTLSDTSFVVSSTANEKAYVTEDVVS------- 131

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM----------------- 160
                                         + + +VLD+S SM                 
Sbjct: 132 ----------------------------DPLELVIVLDISTSMYGAINDLKAILKRGIVS 163

Query: 161 --EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
             E     +  D+  ++   +        + W  N  ++        +  K       A 
Sbjct: 164 LKEQQNNAQSEDHIKVSIIPFSTGVSVNNAPW-LNDARTFCVDGTTESEDKFYAARTVAN 222

Query: 219 NLV--NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
             +  + I   + +           ++ +        PL+ +L++V + ++ L     T 
Sbjct: 223 LDITHDQISVKLSQPNKWRESCSAASFTL--------PLTADLDQVTNTVDSLRTEGGTA 274

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKF---VIFITDGENSGASAYQNTLNTLQICE 333
           +Y  +    R+L    + +     +  + K    ++ +TDG  +    Y + L    +C+
Sbjct: 275 SYQGLIWGLRQLTPNWQKAWEVGPNRNVDKVERKLVLMTDG--NDYGRYFDDLINAGLCD 332

Query: 334 YMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
             ++ G+ +  V         +   +C       F+ +D+++L   F ++
Sbjct: 333 RAKDYGIALNFVGFGVNGSRLEQFTRCAVDPKGVFSASDTQDLDHYFSQL 382


>gi|149909171|ref|ZP_01897828.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
 gi|149807695|gb|EDM67641.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
          Length = 402

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 63/411 (15%), Positives = 144/411 (35%), Gaps = 43/411 (10%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++      +   +  A    +  +   A D+AVL+          + +      + + + 
Sbjct: 18  MLPAIVSLLAITVFFAMYSQVVIRAGQAADSAVLACAYQQNDTGVVTEGILDYYRPNFVL 77

Query: 65  KKQIKK-HLKQGSYIRENAGDIAQKAQINITKDKNNP-LQYIAESKAQYEIPTENLFLKG 122
            +  K   L   +  + +A    + A +N      +   + ++ S++  ++         
Sbjct: 78  PELNKSVKLNSNNGCQISAQYRFEPAMVNALPVAIDSDTEVVSNSQSSAKLVQN------ 131

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
                           +  +     +   +VLD+S SM     +      ++ S+   + 
Sbjct: 132 ----------------VNVNGIQNPVDFSLVLDISGSMTWHLPELKKIITDVISD---IV 172

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN-----SIQKAIQEKKNLSVR 237
           P   +  +S    ++    + AP     +   +    LV         K +Q     S R
Sbjct: 173 PSSNQVRFSIVPFQTGVGVSGAPWLLSSEASPKCVDGLVYRNGNLDADKTVQSLNYSSDR 232

Query: 238 IGTIAYNIGIVGNQCT------PLSNNLNEVKSRLNKL-NPYENTNTYPAMHHAYRELYN 290
           +       G   ++C+      PL+NNLN V   +  L     +T +Y       R L +
Sbjct: 233 LDFNEVTPGRWLDRCSETSFILPLTNNLNRVIRYVESLDTSGGSTASYQGFIWGVRTLTD 292

Query: 291 EKESSHNTIG--STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA-GMKIYSVAV 347
           + +         S+ L + +I  TDG+++    + N L +  +C+ ++    +++  +  
Sbjct: 293 QWQKEWQVTPVQSSSLTQRLILFTDGDDNRRDYF-NDLMSAGLCDVIQQDLNIQVSFIGF 351

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
               +     ++C   +G  F  N++ EL + F+   +   E  VRI    
Sbjct: 352 GVSADRIKQFKQCAGRNGSVFDANNTAELADYFEDAININIETKVRIVLGE 402


>gi|289178041|gb|ADC85287.1| Fibronectin-binding protein [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 2710

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/368 (14%), Positives = 117/368 (31%), Gaps = 87/368 (23%)

Query: 94  TKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMV 153
           T    +  +   ++     +         L+  +  +    +  +I  S+    + I +V
Sbjct: 92  TDKSVSTQEVTLKTYDDNHVTVAPKDGSFLVGLSAMS---SAQKLIGVSNVTKPLDIVLV 148

Query: 154 LDVSRSME---------DLYLQKHNDNNNMTSNKYLLPPPPKKSF-----WSKNTTKSKY 199
           LD S SM                  D          +     + +     W  +   S++
Sbjct: 149 LDTSGSMAWGMDGDDEYAYDPVYAADITTSKRYYVRVSGSMTRVYSSANGWYYDAGGSRH 208

Query: 200 APAP--------------------APANRKIDVLIESAGNLVNSIQKA---IQEKKNLSV 236
              P                       + ++  L ++    ++    A   + +    + 
Sbjct: 209 YVTPKTSAADSDAAHTQFYSRRRLTTQDTRMYALKQAVNGFIDQTIAANAKVSDPNKKN- 267

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           RIG + Y   +  N  + L+++L+ +KS ++ L     T     M  A   L N +  + 
Sbjct: 268 RIGLVTYASDV--NTRSGLTDSLSGLKSTVDDLKASGATRADLGMQTANTVLGNARADA- 324

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVAV--SAPPE 352
                    K VIF TDG+ + ++ ++N +  + +   + M+  G  +YSV +   A P+
Sbjct: 325 --------SKIVIFFTDGQPTKSNGFENDVANDAIGAAKTMKTNGASVYSVGIFTGANPD 376

Query: 353 GQ----------DLLRKC---------------------TDSSGQFFAVNDSRELLESFD 381
                       +L                           +S  + A +D+  L   F+
Sbjct: 377 ANVSSVTGKSDIELKSNAFMQGVSSNYPNATTYTNLGAKAPNSNYYLAASDADTLNAVFN 436

Query: 382 KITDKIQE 389
            I  ++  
Sbjct: 437 TIWSEVSS 444


>gi|219682744|ref|YP_002469127.1| Rhs family protein [Bifidobacterium animalis subsp. lactis AD011]
 gi|219620394|gb|ACL28551.1| Rhs family protein [Bifidobacterium animalis subsp. lactis AD011]
          Length = 2582

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/368 (14%), Positives = 117/368 (31%), Gaps = 87/368 (23%)

Query: 94  TKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMV 153
           T    +  +   ++     +         L+  +  +    +  +I  S+    + I +V
Sbjct: 92  TDKSVSTQEVTLKTYDDNHVTVAPKDGSFLVGLSAMS---SAQKLIGVSNVTKPLDIVLV 148

Query: 154 LDVSRSME---------DLYLQKHNDNNNMTSNKYLLPPPPKKSF-----WSKNTTKSKY 199
           LD S SM                  D          +     + +     W  +   S++
Sbjct: 149 LDTSGSMAWGMDGDDEYAYDPVYAADITTSKRYYVRVSGSMTRVYSSANGWYYDAGGSRH 208

Query: 200 APAP--------------------APANRKIDVLIESAGNLVNSIQKA---IQEKKNLSV 236
              P                       + ++  L ++    ++    A   + +    + 
Sbjct: 209 YVTPKTSAADSDAAHTQFYSRRRLTTQDTRMYALKQAVNGFIDQTIAANAKVSDPNKKN- 267

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           RIG + Y   +  N  + L+++L+ +KS ++ L     T     M  A   L N +  + 
Sbjct: 268 RIGLVTYASDV--NTRSGLTDSLSGLKSTVDDLKASGATRADLGMQTANTVLGNARADA- 324

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVAV--SAPPE 352
                    K VIF TDG+ + ++ ++N +  + +   + M+  G  +YSV +   A P+
Sbjct: 325 --------SKIVIFFTDGQPTKSNGFENDVANDAIGAAKTMKTNGASVYSVGIFTGANPD 376

Query: 353 GQ----------DLLRKC---------------------TDSSGQFFAVNDSRELLESFD 381
                       +L                           +S  + A +D+  L   F+
Sbjct: 377 ANVSSVTGKSDIELKSNAFMQGVSSNYPNATTYTNLGAKAPNSNYYLAASDADTLNAVFN 436

Query: 382 KITDKIQE 389
            I  ++  
Sbjct: 437 TIWSEVSS 444


>gi|183601829|ref|ZP_02963198.1| hypothetical protein BIFLAC_06106 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|241190320|ref|YP_002967714.1| hypothetical protein Balac_0261 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241195726|ref|YP_002969281.1| hypothetical protein Balat_0261 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218714|gb|EDT89356.1| hypothetical protein BIFLAC_06106 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|240248712|gb|ACS45652.1| hypothetical fibronectin binding protein [Bifidobacterium animalis
           subsp. lactis Bl-04]
 gi|240250280|gb|ACS47219.1| hypothetical fibronectin binding protein [Bifidobacterium animalis
           subsp. lactis DSM 10140]
 gi|295793307|gb|ADG32842.1| hypothetical fibronectin binding protein [Bifidobacterium animalis
           subsp. lactis V9]
          Length = 2696

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/368 (14%), Positives = 117/368 (31%), Gaps = 87/368 (23%)

Query: 94  TKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMV 153
           T    +  +   ++     +         L+  +  +    +  +I  S+    + I +V
Sbjct: 78  TDKSVSTQEVTLKTYDDNHVTVAPKDGSFLVGLSAMS---SAQKLIGVSNVTKPLDIVLV 134

Query: 154 LDVSRSME---------DLYLQKHNDNNNMTSNKYLLPPPPKKSF-----WSKNTTKSKY 199
           LD S SM                  D          +     + +     W  +   S++
Sbjct: 135 LDTSGSMAWGMDGDDEYAYDPVYAADITTSKRYYVRVSGSMTRVYSSANGWYYDAGGSRH 194

Query: 200 APAP--------------------APANRKIDVLIESAGNLVNSIQKA---IQEKKNLSV 236
              P                       + ++  L ++    ++    A   + +    + 
Sbjct: 195 YVTPKTSAADSDAAHTQFYSRRRLTTQDTRMYALKQAVNGFIDQTIAANAKVSDPNKKN- 253

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           RIG + Y   +  N  + L+++L+ +KS ++ L     T     M  A   L N +  + 
Sbjct: 254 RIGLVTYASDV--NTRSGLTDSLSGLKSTVDDLKASGATRADLGMQTANTVLGNARADA- 310

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVAV--SAPPE 352
                    K VIF TDG+ + ++ ++N +  + +   + M+  G  +YSV +   A P+
Sbjct: 311 --------SKIVIFFTDGQPTKSNGFENDVANDAIGAAKTMKTNGASVYSVGIFTGANPD 362

Query: 353 GQ----------DLLRKC---------------------TDSSGQFFAVNDSRELLESFD 381
                       +L                           +S  + A +D+  L   F+
Sbjct: 363 ANVSSVTGKSDIELKSNAFMQGVSSNYPNATTYTNLGAKAPNSNYYLAASDADTLNAVFN 422

Query: 382 KITDKIQE 389
            I  ++  
Sbjct: 423 TIWSEVSS 430


>gi|283782262|ref|YP_003373017.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
 gi|283440715|gb|ADB19157.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
          Length = 395

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/400 (14%), Positives = 128/400 (32%), Gaps = 52/400 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ V      +AID++++  +R+++++A DAA  +G  ++                
Sbjct: 23  LIAFLLVVVVCMAAFAIDVSYMQLVRSELRAATDAAAKAGTLALAKTDGDAASARTAAIQ 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKA---QINITKDKNNPLQYIAESKAQYEIPTEN 117
           +    K   + L   +   +     AQ          +     ++ ++         +  
Sbjct: 83  AAARNKVAGRALVLTTDQVQVGRSAAQANGTWSFTANQTPYTSVKILSSMSDSTAAGSVP 142

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           LFL   +         +S    +   E     IC+V+D S SM              T  
Sbjct: 143 LFLGTFMGRGSFQ-PAQSATASQMEQE-----ICLVIDRSHSMCFNMSGVEWSYPPGTKT 196

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                  P  +  S+                    L  S    +++I +     +   + 
Sbjct: 197 TPHTICYPPHATLSRW-----------------AALQSSVNLFMDTILETNNTPRVALIT 239

Query: 238 IGT--------IAYN--IGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHA 284
            G+         +Y     +       LS +   VKS++           TN    +   
Sbjct: 240 WGSTIGTNTAEYSYTKKTEVAVANELGLSTDYAAVKSKIAARTTKVMLGGTNMSAGIDAG 299

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
              L      +         KK +I +TDG+      +    + +   E   + G++I++
Sbjct: 300 RTLLNGNTVRA-------LAKKTMILMTDGQ------WNQGRDPIDAAEDAADEGIQIHT 346

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +   +      + +    + G+++  ++  EL E+F  + 
Sbjct: 347 ITFLSGSAQNTMRQVAEITGGKYYVSSNQAELEEAFRDLA 386


>gi|90406741|ref|ZP_01214934.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
 gi|90312194|gb|EAS40286.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
          Length = 404

 Score = 85.3 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 64/396 (16%), Positives = 138/396 (34%), Gaps = 44/396 (11%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++      +  +I  A  +    +   A D + ++   S  ++ ++          +  +
Sbjct: 19  LLPAMLAMLALSILTAMYLLSVTRASQASDVSSIACAYSQRANVSLTQG------FAQYY 72

Query: 65  KKQIKKHL-KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
           K     H+  Q +++                       Q   +    +    ++L     
Sbjct: 73  KPNFISHVNAQSTFLS-------------------GQKQCKIQIGYAFTPLLKDLLPASS 113

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                 ++ ++ST  +   SE   + + +VLD+S SM           N    N      
Sbjct: 114 QNKVHASVQIQSTSTLTVHSEIKPMDLSLVLDISGSMSGRIGLLKRIINQAIQNIEQQNT 173

Query: 184 -PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA------GNLVNSIQKAI-----QEK 231
               +  +S     S  + + AP   K              GN++N+ Q          K
Sbjct: 174 KNNTQIRFSIVPFSSGVSISNAPWLAKSKGKALCVDAMSYPGNVLNTAQTVADIDTHPSK 233

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
            N+  +      N   V +   PL+NNL++V+  ++ L+   +T +Y       R L   
Sbjct: 234 LNIRAKEPLSLINDCNVYSLLLPLTNNLSKVRKHVDSLSILGSTASYQGFIWGVRTLLPN 293

Query: 292 KESSHNTIGSTR--LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA-GMKIYSVAVS 348
            + + N    T   L + +I  TDGE+     +   + +  +C+ +++   + I  +   
Sbjct: 294 WQKAWNLQPETSSLLSQRLILFTDGEDDSRDQFDKLVRS-GMCQRIQDDFNIDISFIGFG 352

Query: 349 APPEGQDLLRKCTDSSGQ--FFAVNDSRELLESFDK 382
             P   D  +KC  S+G+   +   +  +L + F +
Sbjct: 353 LSPRRLDQFKKCIGSNGKGVVYDAKNGSDLEKFFAE 388


>gi|307943460|ref|ZP_07658804.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773090|gb|EFO32307.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 320

 Score = 85.3 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 63/191 (32%), Gaps = 58/191 (30%)

Query: 257 NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS-----------TRLK 305
           NNL  +K+ +++L   + T     +    + L  +  ++    G             + +
Sbjct: 131 NNLGGLKAAVDRLTLSDGTGMDIGLLWEAKALSPKLRTAAALDGGLLPGHPTDWSDKQTQ 190

Query: 306 KFVIFITDG---------------------------------------ENSGASAYQNTL 326
           K ++ +TDG                                        NS A++  N++
Sbjct: 191 KVIVLMTDGGITAQYRPKDPWKGLNPKDMRRGIVNARRNVQYVTTRGNMNSPANSKHNSV 250

Query: 327 NTLQI-CEYMRNAGMKIYSVAVSAPPEGQDL----LRKCTDSSGQFFAVNDSRELLESFD 381
             ++  C+  +  G+ IY+V          L    L  C  S   ++ V  S +L  +F 
Sbjct: 251 AYMKTMCDQAKAKGIIIYTVGFQ--IRRNTLPDLSLSYCATSPSHYYFVESS-DLSAAFK 307

Query: 382 KITDKIQEQSV 392
            I   I+   +
Sbjct: 308 AIASSIKSLRI 318


>gi|328545070|ref|YP_004305179.1| von Willebrand factor type A [polymorphum gilvum SL003B-26A1]
 gi|326414812|gb|ADZ71875.1| von Willebrand factor type A [Polymorphum gilvum SL003B-26A1]
          Length = 552

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 61/189 (32%), Gaps = 39/189 (20%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE----SSHNTI 299
           N        T L+N+   +   +  +     TN +  +   +R L  ++      S +  
Sbjct: 365 NFLCKTQPITDLTNDKQALLDAVAAMRADGYTNIHQGVVWGWRVLTPQEPFSRGRSPDQK 424

Query: 300 GSTRLKKFVIFITDGENSGASAYQN-------------------------------TLNT 328
                ++ +I +TDG N+      +                                  T
Sbjct: 425 REKDHRRIMIVMTDGANTYQDKSSSHNRTEYNAYGYGTEQRLGSGIDTAGEIAAKMDERT 484

Query: 329 LQIC-EYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
              C         ++Y++A        + LLR C  S    F    + EL+ +F++I  +
Sbjct: 485 ALACRNAATYEATQVYTIAFQVGDYATRKLLRDCASSPEMAFDAGSNSELVTAFERIGKE 544

Query: 387 IQEQSVRIA 395
           I    +R+A
Sbjct: 545 IS--RLRLA 551



 Score = 46.1 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 52/166 (31%), Gaps = 29/166 (17%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
                 +        ID++ ++  ++++QS           +       K  T   +Q  
Sbjct: 18  FGSFAFLLTAGSGVGIDMSRVVTEKSRLQS--------AADATALAANYKSGTYTAEQIR 69

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
              +         G Y     G +++    N+T             +A   +PT   F  
Sbjct: 70  QHAEAYF-----DGLYTAPERGSVSR----NVTVGDG-----TISVEAGVTMPT---FFA 112

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK 167
            L+     + ++ +   +  +S      + +VLD S SM    +  
Sbjct: 113 PLLGVEEISFAVMAESKVGTAS----FDVVLVLDNSGSMAGSRMTT 154


>gi|13476511|ref|NP_108081.1| hypothetical protein mlr7847 [Mesorhizobium loti MAFF303099]
 gi|14027272|dbj|BAB54226.1| mlr7847 [Mesorhizobium loti MAFF303099]
          Length = 548

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 83/262 (31%), Gaps = 40/262 (15%)

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP-----ANRKIDVLIESAGNLV 221
              D    +S+          S+    + K+K A           +   D +  +  +  
Sbjct: 281 DPEDAQKPSSSYGNAAKYYNNSYLDDVSDKTKTAKLKGNRLGIDLSSLADPVPPADKDAK 340

Query: 222 NSIQKAIQEKKNLSVRIGT--IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNT 277
             + K +   K L    G+                L+++ ++++   +++       TN 
Sbjct: 341 EKVAKYVAPTKALITETGSPITVGPNRACPTPVVSLTDDFDKLRKAASEMTEWNGSGTNV 400

Query: 278 YPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN--------- 327
              +    R L      +      +  + K V+ +TDGEN    A +             
Sbjct: 401 SEGLSWGMRVLSPAAPYTDGAPWKTPGISKIVLLLTDGENVVYGASEQPTKSDYTSYGYL 460

Query: 328 --------------------TLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQ 366
                               T  +C  ++N G++IY++ + +       L   C      
Sbjct: 461 AGGRFGSDDQTAAARNVDGWTKSVCTQLKNQGVQIYTMVLQSDTAANRALYSACASDPSG 520

Query: 367 FFAVNDSRELLESFDKITDKIQ 388
           ++AVND  +L + F  I +K  
Sbjct: 521 YYAVNDPAKLPDVFQHIANKFS 542



 Score = 49.1 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 63/182 (34%), Gaps = 27/182 (14%)

Query: 6   ISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFK 65
           +      + +A+D++ +M  ++ +Q+ALDAA L+               ++ D     F+
Sbjct: 22  LPAILSAVAFAVDVSTVMRAKSNLQNALDAANLASSHL------GDLDISRTDAFDRYFQ 75

Query: 66  KQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP 125
             I  H      +      +     +N  K          ++ A  ++   NL    L  
Sbjct: 76  ANIAGH----GELANAQATLTVDRGVNFIKT---------KAVASADV---NLNFGFLFG 119

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
               ++++ ++ +   +     + + +VLD + SM    +           +       P
Sbjct: 120 HNR-HIAVDASAVESDNQ----LEVVLVLDNTGSMAGARMTALRTATKSLLDTLEATKSP 174

Query: 186 KK 187
            +
Sbjct: 175 TR 176


>gi|260466792|ref|ZP_05812977.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029404|gb|EEW30695.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 492

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 58/479 (12%), Positives = 141/479 (29%), Gaps = 118/479 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +     SV  L   ++++++ +   ++ +Q  +DAAV S        R +     K+   
Sbjct: 25  LFGFAASVLALAAGFSVNISQLYNAKSSLQGVVDAAVTSTA------RDLTTGVIKEADA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               K  +         +  +A  I Q  Q+ + K   +      ++    ++       
Sbjct: 79  DNSVKAFL---------VANSAAGILQPDQVVLDKLIVDKTAKTVQANVHVDVALYFPLF 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                  + ++   +       S +  + + M+LD++ SM          +    +   +
Sbjct: 130 G------IGDMQRVAASTTALYS-DKTVEVAMMLDITGSMAKRGNVDKIGDLRAAARNAV 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKID----------------------------V 212
                 +         +    A      K+                              
Sbjct: 183 QTMLQNQDPKRPRIRVAIVPYASGVNAGKLAENVYAETQGSSELPPVAGSSLLVAKTGKA 242

Query: 213 LIESAGNLVNSIQKAIQEKKN-------------------LSVRI---GTIAYN------ 244
           L+ S  + ++ +  A+    N                    +VR    G   Y       
Sbjct: 243 LLPSFSDYISIVGAAMPHPDNCTTERKNKNGDADLSADGPDTVRTDRNGKKYYALVNRDD 302

Query: 245 -------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
                        +  PL+ + + +   ++       T    A+   Y  L  +  ++  
Sbjct: 303 HLDGGGMNRCPDAEVIPLTADSDALLDSIDDFRAAGYTAGAIAIQWTYYMLSPQWRAAIK 362

Query: 298 T---------IGSTRLKKFVIFITDGE-NSGASAYQNTLN---------TLQICEYMRNA 338
                       + ++ K  I +TDG+ N+  +    + N            +C  M+N 
Sbjct: 363 NVGLGNGASDANAKKIAKVAILMTDGQFNTAFAGAGGSYNGQGDLARGNAEALCGNMKND 422

Query: 339 GMKIYSVAV---------SAPPEGQDLLRKCTDSSG-----QFFAVNDSRELLESFDKI 383
           G++I+++           +   + + +L+ C+          +F  +   EL  +F +I
Sbjct: 423 GIEIFTIGFDLNDKDMSATERDQAKAVLKGCSSKDASAAERHYFEASTGAELDAAFQEI 481


>gi|329888464|ref|ZP_08267062.1| hypothetical protein BDIM_03870 [Brevundimonas diminuta ATCC 11568]
 gi|328847020|gb|EGF96582.1| hypothetical protein BDIM_03870 [Brevundimonas diminuta ATCC 11568]
          Length = 650

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/286 (16%), Positives = 92/286 (32%), Gaps = 54/286 (18%)

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
            +VLD +RS+    L   +      S+   L      S W    T        A     +
Sbjct: 377 QVVLDTTRSLG---LAGASKGGVTYSSGGKLMNGRDGSEWRVFPT--------ADGYVNV 425

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                     V   +          V    ++ +      + + LS + + +KS++++++
Sbjct: 426 HASSTCVSERVGVERYTDARPSTAYVGRSYLSSSNSCPSAELSALSTSASSLKSKIDQMS 485

Query: 271 PYENTNTYPAMHHAYRELYNE------KESSHNTIGSTRLKKFVIFITDGENSGA----- 319
              +T     +  A+  L  +       E        +   K  I +TDGE +       
Sbjct: 486 AGGSTAGQIGIAWAWYALSPDFASLFSGEGQPGAYAPSDTLKVAILMTDGEFNTPFRDGV 545

Query: 320 --------------------SAYQNTLNTLQICEYMRNAGMKIYSVAV---------SAP 350
                               S       ++ +C+ M+  G+ +Y+V              
Sbjct: 546 IALDAGTGSGGLDSHIDLNSSNGDPFAQSVALCQAMQAKGVVVYTVGFDLGSATGREGVV 605

Query: 351 PEGQDLLRKCTDSSG-QFFAVNDSRELLESFDKITDKIQEQSVRIA 395
               D++R+C  +    FF  +D  +L E+F  I   I    +RIA
Sbjct: 606 DTALDVMRECATNEQTHFFQADDGTDLKEAFRAIGRDIT--RLRIA 649


>gi|323136279|ref|ZP_08071361.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
 gi|322398353|gb|EFY00873.1| von Willebrand factor type A [Methylocystis sp. ATCC 49242]
          Length = 577

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 68/203 (33%), Gaps = 61/203 (30%)

Query: 248 VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKK 306
                  L+   + + +++ +L    +TN +  +  A+R +  N   S+ +   +  ++K
Sbjct: 370 ATQTALQLTPTQSTITAKIAQLTAAGDTNLHEGVMWAWRSISPNPPFSAGSAYNTAGVRK 429

Query: 307 FVIFITDG--------------------------------------------------EN 316
            ++ +TDG                                                   N
Sbjct: 430 ILVLMTDGYNNWTSNTNTVGGSYYEALGYYSYNGAKNRRLPDGTQGNGVDYQSQLDGAAN 489

Query: 317 SGASAYQNTLN-----TLQICEYMRNAGMKIYSVAVSAPPE-----GQDLLRKCTDSSGQ 366
           S       +       T Q CE  +  G++IYS+A S         G +LL+ C  ++  
Sbjct: 490 SWTDYKSVSRQAQDELTRQSCENAKAKGIEIYSIAFSVSTNPIDAAGINLLKSCATNADH 549

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           +    DS ++  +F +I   + +
Sbjct: 550 YLLATDSTQIDRAFSQIAMNLSK 572



 Score = 48.0 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 51/160 (31%), Gaps = 26/160 (16%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +I V  +    A+D A  +     +Q   D A L+  + I +  +  D   +        
Sbjct: 24  VIPVMMM-AGAAVDYARGVTTHKVLQQGADTAALAVASRITAATSTADAIKQAQNVLRSA 82

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            +++       + I  +       AQ++I                   +  +   +  + 
Sbjct: 83  SQRLAAATISNATISADRKTFCIDAQVSIPT-----------------MIMKIARIDSMA 125

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY 164
           P+      + S   I   S N    I + LD S SM +  
Sbjct: 126 PA------VMSCAEIGGGSTN--YEIALALDNSGSMNESA 157


>gi|114571147|ref|YP_757827.1| hypothetical protein Mmar10_2603 [Maricaulis maris MCS10]
 gi|114341609|gb|ABI66889.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 520

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 32/178 (17%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGST 302
           N        TPL++    V + +  +     TN    +    R +      +  +     
Sbjct: 338 NRSCTTTPVTPLTSTERTVLNAIGDMGASGTTNIPNGVGWGIRLISPGAPFTEGSAWDDD 397

Query: 303 RLKKFVIFITDGEN----------------------------SGASAYQNTLN--TLQIC 332
              K ++ +TDG+N                            S ++   N L+  T   C
Sbjct: 398 EYIKAMVILTDGDNVMRGRNTDQMSDYEAYGFVADGRLGRRSSSSNVLSNELDDRTEAAC 457

Query: 333 EYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            Y R+ G+++Y++         + L++ C  +   +F    S  L ++F+ I   +  
Sbjct: 458 AYARSLGIRVYTITFQVNSSSTRSLMQNCASNPSLYFDSPSSEALEDAFEMIAGDLTN 515


>gi|114571146|ref|YP_757826.1| Flp pilus assembly protein TadG [Maricaulis maris MCS10]
 gi|114341608|gb|ABI66888.1| Flp pilus assembly protein TadG [Maricaulis maris MCS10]
          Length = 500

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 59/177 (33%), Gaps = 32/177 (18%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-KESSHNTIGSTR 303
            G      TPL+N  N +   +  +     TN    +    R L      +   +     
Sbjct: 319 WGCTARPITPLTNQRNVIDDAIEDMIASGTTNIPIGISWGVRVLSPGMPFTEGVSYDEEG 378

Query: 304 LKKFVIFITDGEN----------------------------SGASAYQNTLN--TLQICE 333
             K ++ +TDGEN                            S  S  +N LN  T   CE
Sbjct: 379 TIKAMVVLTDGENYLDGRNNPNYSHYSGYGYMRDGRLGIQTSSDSTIRNALNDRTEAACE 438

Query: 334 YMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           Y ++ G+++Y++         +D++R C      +F       L  +F+ I   +  
Sbjct: 439 YAKSLGIRVYTITFQVNSSSTRDMMRDCATHPTLYFDSPSDDALRSAFEMIAGDLTN 495


>gi|299139026|ref|ZP_07032203.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298599180|gb|EFI55341.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 318

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 67/151 (44%), Gaps = 20/151 (13%)

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
           ++    ++++ ++ S L +++  + T  Y A++ A + L     S+         ++ ++
Sbjct: 137 DELVSFTSDVQKIDSGLGRIHHGDATALYDAVYLASQRLGETPTSAGQ-------RRVLV 189

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS-VAVSAPPEG-------QDLLRKCT 361
            ITDGEN+         +     E  + AG  IY+ + V    +          L++   
Sbjct: 190 LITDGENTTHHG-----SYDAALEQAQRAGAMIYALIIVPVSADAGRNTGGEHALIQLAR 244

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           D+ G+++ V D  +L  +F  ++D ++ Q  
Sbjct: 245 DTGGKYYYVEDKHDLAPAFQHVSDDLRTQYT 275


>gi|37680183|ref|NP_934792.1| hypothetical protein VV1999 [Vibrio vulnificus YJ016]
 gi|37198930|dbj|BAC94763.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 481

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/460 (12%), Positives = 127/460 (27%), Gaps = 83/460 (18%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSG----------------------C 41
           +++    +F  + +D+  I  + NQM +A DAA+ S                        
Sbjct: 30  VLLMSMLVFAAWVMDVMRIYSVHNQMANATDAALASAIISEVPESTAVELLHANLTSGAA 89

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
           +  V +  +     +++++  +    +   L   +   + +  I   A+  I+    N  
Sbjct: 90  SPYVEEVRLTHLRDEQEESLQVVLDFVPNSL---NIAAQESVPIRTNAKAGISS---NKA 143

Query: 102 QYIAESKAQYEIPTENLFLKGLI-----------PSALTNLSLRSTGIIERSSENLAISI 150
           + +        +  E +                  +   N  +         +      I
Sbjct: 144 EIVFMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEI 203

Query: 151 CM-------------------VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
            +                   + D +              N M  +       P      
Sbjct: 204 YLGSFRRYDHAQVKRENRWSDMFDRAS--GRTPAVPGRQRNAMCRDLDFEGNNPATLGLR 261

Query: 192 KNTTKSKYAPAPAPANRKI-------DVLIESAGNLVNSIQKAIQEKKNLS---VRIGTI 241
                 K     +  +++I        VL    G  ++          N          I
Sbjct: 262 YFRNLEKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAI 321

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--------NEKE 293
             +I    N   P        +S + +L P  NTN    M  A R L           + 
Sbjct: 322 FDDIECHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRP 381

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPP 351
                       K+++  +DG N              IC  ++    G+K+ +V      
Sbjct: 382 ELPRRYSDETSNKYLVMFSDG-NHLIDPAFRDKKMKLICTQLKQPGRGVKVMTVNFGG-A 439

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             + L++ C      ++ V     + + F++I +++   S
Sbjct: 440 ASERLMQSCASGPE-YYHVASLFSVEKVFEQIAEQVISSS 478


>gi|307942638|ref|ZP_07657986.1| hypothetical protein TRICHSKD4_1260 [Roseibium sp. TrichSKD4]
 gi|307774277|gb|EFO33490.1| hypothetical protein TRICHSKD4_1260 [Roseibium sp. TrichSKD4]
          Length = 403

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 63/397 (15%), Positives = 132/397 (33%), Gaps = 59/397 (14%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
           +  ID++     R+Q Q   D   L    +    R        K+Q     +   +K L 
Sbjct: 36  SVGIDMSFAYNKRDQSQLVADEVSLFAVTTF---RKYVADGMSKNQARKRAETDARKFL- 91

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
             +   ++     +K  I I           A      +      ++   +     + + 
Sbjct: 92  --TARTKSLDGTTEKFSIKINIVDREAKVVKANVNISGK---HESYMTHAMGFDNIDYTA 146

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
            S   I    +     I +V DVS SM      +                 P    W  +
Sbjct: 147 DSESTI-SFGQGKYEFIFLV-DVSPSMGIGASNRDRQIMQRAIGCQFACHEP----WYSS 200

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
            +++K A A      +IDV+ ++  +LV  +++A +    + +R G  +++  +     T
Sbjct: 201 VSRAKSAGARL----RIDVVKDALKSLVTQLEEATE----VDLRTGLYSFSNYLHIQ--T 250

Query: 254 PLSNNLNEVKSRLNKLN------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
            L+  +++ K   NK+           TN +          +N    S        +K+ 
Sbjct: 251 GLNKGISKFKREANKIAIHREYLRGGGTNFHGVFSD-----FNGVLRS--LKPKADVKQH 303

Query: 308 VIFITDGEN-------SGASAYQNTLNTL--------QICEYMRNAGMKIYSVAVSAPPE 352
           +I I+DG N       +    +  T N          + C+  +   ++     +  P  
Sbjct: 304 IIIISDGVNHLNLRSGTNRHLWNQTPNWRPYNYSFNPRWCDEFKKGEVRTVHTMLVEPDR 363

Query: 353 GQDL------LRKCTDSSGQFFAVNDSRELLESFDKI 383
              +      +R C  S+  F++ N + E+ ++   +
Sbjct: 364 AHYVRASTSSMRACATSADFFYSANSAAEIDKASKTV 400


>gi|27365660|ref|NP_761188.1| hypothetical protein VV1_2340 [Vibrio vulnificus CMCP6]
 gi|27361808|gb|AAO10715.1| hypothetical protein VV1_2340 [Vibrio vulnificus CMCP6]
          Length = 465

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/460 (12%), Positives = 126/460 (27%), Gaps = 83/460 (18%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSG----------------------C 41
           +++    +F  +  D+  I  + NQM +A DAA+ S                        
Sbjct: 14  VLLMSMLVFAAWVTDVMRIYSVHNQMANATDAALASAIISEVPESTAVELLHANLTSGAA 73

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
           +  V +  +     +++++  +    +   L   +   + +  I   A+  I+    N  
Sbjct: 74  SPYVEEVRLTHLRDEQEESLQVALDFVPNSL---NIAAQESVPIRTNAKAGISS---NKA 127

Query: 102 QYIAESKAQYEIPTENLFLKGLI-----------PSALTNLSLRSTGIIERSSENLAISI 150
           + +        +  E +                  +   N  +         +      I
Sbjct: 128 EIVFMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEI 187

Query: 151 CM-------------------VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
            +                   + D +              N M  +       P      
Sbjct: 188 YLGSFRRYDHAQVKRENRWSDMFDRAS--GRTPAVPGRQRNAMCRDLDFEGNNPATLGLR 245

Query: 192 KNTTKSKYAPAPAPANRKI-------DVLIESAGNLVNSIQKAIQEKKNLS---VRIGTI 241
                 K     +  +++I        VL    G  ++          N          I
Sbjct: 246 YFRNLEKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAI 305

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--------NEKE 293
             +I    N   P        +S + +L P  NTN    M  A R L           + 
Sbjct: 306 FDDIECHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRP 365

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPP 351
                       K+++  +DG N              IC  ++    G+K+ +V      
Sbjct: 366 ELPRRYSDETSNKYLVMFSDG-NHLIDPAFRDKKMKLICTQLKQPGRGVKVMTVNFGG-A 423

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             + L++ C      ++ V     + + F++I +++   S
Sbjct: 424 ASERLMQSCASGPE-YYHVASLFSVEKVFEQIAEQVISSS 462


>gi|329850248|ref|ZP_08265093.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328840563|gb|EGF90134.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 575

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 55/144 (38%), Gaps = 7/144 (4%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKFVI 309
               L+ ++   ++   ++ P  NTN    +      L      S         + K++I
Sbjct: 429 PVMALTQDIAAARTYAARMAPAGNTNVTIGVQWGMEVLSPTAPFSEGGAFTDKAVLKYMI 488

Query: 310 FITDGENSGASAYQNTLNTLQ----ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG 365
            +TDG N+      N           C   +N G+ +++V V         L+ C   + 
Sbjct: 489 VLTDGINTQNRWTTNNSQINARLALACTNAKNLGITVFTVRV--EQGDSTTLQNCASQTA 546

Query: 366 QFFAVNDSRELLESFDKITDKIQE 389
            ++ ++++ +L  +  KI   I++
Sbjct: 547 YYYNLSNADQLPATMSKIMKSIRK 570



 Score = 46.1 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 55/163 (33%), Gaps = 15/163 (9%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +I +        +D A+I   R ++Q A+DA  ++     +        TT++      F
Sbjct: 27  VIPIVAAVGG-GLDFANIQAARAKLQDAVDAGAIAAT---IDPTATPTQTTREAVAKKAF 82

Query: 65  KKQIK--KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
              IK    L+           +   +    T   NN +     + A         +L G
Sbjct: 83  CGNIKQSGGLQNSFCNTTTLDTLGTASATLSTATSNNIMTVTYSATAHV-----PTYLLG 137

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
           L+     ++   +   +  S+  +A     VLD + SM     
Sbjct: 138 LVGIDTVDIDAVAKSGVSTSTAEVAF----VLDNTGSMSSNNK 176


>gi|294139879|ref|YP_003555857.1| hypothetical protein SVI_1108 [Shewanella violacea DSS12]
 gi|293326348|dbj|BAJ01079.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 405

 Score = 83.8 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 68/403 (16%), Positives = 128/403 (31%), Gaps = 53/403 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I +      I  +I LA  +    +   A DAA L+   S  +D+ +        + 
Sbjct: 17  MFVICLPFILTMIAVSILLAMYLLTVTRAGQASDAASLACGYSQRADQDLLVGILDYYR- 75

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                                 G +    +  ++ D  N      E+  ++        +
Sbjct: 76  ---------------------PGFVVHDGEALVSIDGKNRCS--IEATYRF----NPTMM 108

Query: 121 KGLIPSALTNLSLRS----TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
             L  SA T++SL S    T  +  +S  L + + +VLD+S SM     Q     N    
Sbjct: 109 ALLPESARTHVSLSSDTGATSHLVINSTPLPMDLALVLDISSSMSAQLPQLKLIINGALE 168

Query: 177 NKYLLPPPPKKSF-WSKNTTKSKYAPAPAPANRKIDVLIESAGNL------------VNS 223
                 P       +S    ++      AP   K    +     L            V+ 
Sbjct: 169 EIRQQDPNEVGGVRFSLVPFETGVGVLNAPWMPKSAAKVTCVDGLSYGQHSVDYARTVDD 228

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGN-QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
           + +        SV      +      +    PL+ +LN VK R++ L     T++Y  + 
Sbjct: 229 LAEPAANLNIKSVF--ASQWLDACSMDATILPLTQDLNLVKQRVDALVTSGTTSSYQGLI 286

Query: 283 HAYRELYNEKESSHNTIGSTRLKKF--VIFITDGENSGASAYQNTLNTLQICEYMRNA-G 339
              R L  + +                ++  TDG + G          L  C  +++   
Sbjct: 287 WGVRTLLPQWQEEWQIPPVESPALIQRLVLFTDGADQGFHLDDLIEQGL--CRVIQDKHH 344

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           +++  +            R+C    G+ +   +++EL   F +
Sbjct: 345 IEMSFIGFGVSDRRLQQFRECAGDKGKVYDAQNTQELEAFFRE 387


>gi|323138519|ref|ZP_08073587.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
 gi|322396153|gb|EFX98686.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
          Length = 458

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 63/435 (14%), Positives = 141/435 (32%), Gaps = 68/435 (15%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI- 63
           +I   F+ +  A+D    + +R+++    D A L+   +     +        +  S   
Sbjct: 38  LIP-MFMMMGAAVDYTQAVTVRSRLNHLADRAALAAVKAAAQKESDCVANPAGNNVSNFQ 96

Query: 64  ---FKKQIKKHLKQG---SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
               K  IK  +  G              +K  I ++  +     + A      +IPT  
Sbjct: 97  GCGQKDIIKAGVAAGVQYMNGDPLMRGADRKPTIELSSSEG---SWSATVNYSADIPTN- 152

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
             +  L+      ++ + T  I     ++ ++  ++LD S SM               + 
Sbjct: 153 --IARLMGVQTIPVNGKVTSNIAL-GTHMYLNFHLLLDRSMSMGIGATSDDISRLQALTG 209

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                          +  K++          +ID L ++ G LV   +          ++
Sbjct: 210 CAFACHSEGYEAQYYDQPKAQGIRF------RIDDLRDATGALVAQAKMVASANAREHIQ 263

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL---NPYENTNTYPAMHHAYRELYNEKES 294
           +G  A+N  +  +    ++++L  V + +  L      + T    A+      + N+ + 
Sbjct: 264 MGVYAFNHHV--SPLVEMTSDLTNVANAVKNLDLPTHDDGTQAADAVTW---LVANKIKG 318

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------------------LQIC 332
           +   + S    + V  +TDG   G     N +                        +  C
Sbjct: 319 NGTGLTSAAPLEIVFLVTDGVEDGIYTGWNKMVGPTGLPLPWWPSWMTKAPTSAFPVTAC 378

Query: 333 EYMRNAGMK---IYSVAVSAPPEGQ--DL-----------LRKCTDSSGQFFAVNDSREL 376
           + +++ G     +Y+  V  P   Q   L           L+ C  S G FF  ++  ++
Sbjct: 379 DALKSKGAIVAVVYTTYVPFPGTVQYDRLIGPFAPNISPNLQGCA-SQGYFFTASEPGDI 437

Query: 377 LESFDKITDKIQEQS 391
                 + ++  ++ 
Sbjct: 438 TRGMQSLFNRALQEL 452


>gi|241204947|ref|YP_002976043.1| hypothetical protein Rleg_2227 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858837|gb|ACS56504.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 429

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 66/430 (15%), Positives = 151/430 (35%), Gaps = 78/430 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----------ALDAAVLSGCASIVSDRTI 50
           MTA+++   F     A+D AH + +R Q+ +          A  +  ++   ++  + TI
Sbjct: 19  MTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMSGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
              +  KD   +IF  QI   L           D+     I++TK   N L       A 
Sbjct: 79  ---SLGKDDARSIFMSQISGEL----------TDVQVDLGIDVTKT-ANKLNSQVSFSA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME-DLYLQKHN 169
               T       ++      +S  +T   + +S    +   ++LD + SM         +
Sbjct: 124 ----TVPTTFMRVLGRDSITISGTATAEYQTAS---FMDFYILLDNTPSMGVGATATDVS 176

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                TS+         ++  +      K        + +IDV+ ++   L  + +    
Sbjct: 177 TMEKNTSDTCAFACHETQNNNNYYNLAKKLG-----VSMRIDVVRQATKELTVTAKSTRV 231

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPL---SNNLNEVKSRLNKLN------PYENTNTYPA 280
                  R+G   +       + T +   +++L++V+S  + ++         N +   +
Sbjct: 232 SSNQ--FRMGVYTFGTKAEDAKLTTISDPTDDLDKVRSYTDAVDLMTIPFQGYNNDQQTS 289

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-----------ENSGASAYQNTLNTL 329
              A  ++     +  +   +T  +K + F++DG           +    +  Q  ++T 
Sbjct: 290 FDSALTQMKTIITTPGDGSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDT- 348

Query: 330 QICEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDS 373
             C+ +++  ++I   Y+  +  P                   ++ C  S G +F V  +
Sbjct: 349 SFCQPLKDKSIRIAVLYTTYLPLPKNSWYNTWIKPFQGEIPTKMQACA-SPGLYFEVTPT 407

Query: 374 RELLESFDKI 383
             + ++   +
Sbjct: 408 EGIADAMKAL 417


>gi|116252440|ref|YP_768278.1| hypothetical protein RL2693 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257088|emb|CAK08182.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 427

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 65/428 (15%), Positives = 144/428 (33%), Gaps = 76/428 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----------ALDAAVLSGCASIVSDRTI 50
           MTA+++   F     A+D AH + +R Q+ +          A  +  ++   ++  + TI
Sbjct: 19  MTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMSGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
              +  KD    IF  Q+   L           D+     IN+TK   N L       A 
Sbjct: 79  ---SLGKDDARNIFMSQMSGEL----------TDVHIDLGINVTKT-ANKLNSQVSFSA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       ++      +S  +T   + +     +   ++LD + SM          
Sbjct: 124 ----TVPTTFMRILGRDSITISGAATAEYQTA---AFMDFYILLDNTPSMGVGATANDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +          +S  +    K            +IDV+ ++   L ++ +   + 
Sbjct: 177 KLQAKTGCAFACHQMDQSTNNYTIAKGLGVAM------RIDVVRQATQALTDTAK--TER 228

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPL---SNNLNEVKSRLNKLNPYE------NTNTYPAM 281
             +   R+G   +       + T +   +++L +VK+  + ++         N +   + 
Sbjct: 229 VSSDQFRMGVYTFGTKAEDAKLTTISSPTSDLTKVKNYTDTVDLMTIPYQNYNQDQLTSF 288

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------LQI 331
             A  ++    + + +   +   +K + F++DG          T  T             
Sbjct: 289 DSALTQMNTIIDPAGDGTSNISPEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSF 348

Query: 332 CEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRE 375
           C+ +++ G+KI   Y+  +  P                   ++ C  S G +F V  +  
Sbjct: 349 CKPLKDRGVKIAVLYTTYLPLPSNDWYNKWISPFQSEIPTKMQACA-SPGFYFEVTPTEG 407

Query: 376 LLESFDKI 383
           + ++   +
Sbjct: 408 ITDAMKAL 415


>gi|148976298|ref|ZP_01813022.1| hypothetical protein VSWAT3_18848 [Vibrionales bacterium SWAT-3]
 gi|145964392|gb|EDK29647.1| hypothetical protein VSWAT3_18848 [Vibrionales bacterium SWAT-3]
          Length = 401

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 85/264 (32%), Gaps = 19/264 (7%)

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK---- 192
           G++E     +   + +VLDVS SM        +  +N  +                    
Sbjct: 127 GVVESKHSAIPTELVLVLDVSGSMSPNIQSLKSILSNALNTIQSQSNNANDLDSVSISIV 186

Query: 193 ------NTTKSKYAPAPAPANRKIDVLIESAGNLVNSI---QKAIQEKKNLSVRIGTIAY 243
                  T +  +          ID L    G+   S+     A    +          +
Sbjct: 187 PFDSGVATHRPPWLSEETAGIYCIDGLSYRNGDFSASLTVDNLATLHSERPVKFTPPSKW 246

Query: 244 NIGIVGNQCT-PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
                      PL+N  + V++ +N L     T +Y  +    R+L    + +     S+
Sbjct: 247 LSDCNQESPMLPLTNVFSRVQNSINSLTANGGTRSYQGLVWGVRQLIPSWQQAWGMKVSS 306

Query: 303 RL--KKFVIFITDGENSGASAYQNTLNTLQICEYM-RNAGMKIYSVAVSAPPEGQDLLRK 359
               ++ ++  TDG + G +  Q  L     C    +  G+++  +     P        
Sbjct: 307 VPETRRKLVLFTDGADEGDAFNQ--LVNAGFCTTAIKQYGIEMNFIGYGVSPSRITQFEN 364

Query: 360 CTDSSGQFFAVNDSRELLESFDKI 383
           C  +  + F+  ++ +L E F  I
Sbjct: 365 CAGNPLRVFSATNTTQLNEYFSDI 388


>gi|327541799|gb|EGF28311.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 363

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 49/389 (12%), Positives = 121/389 (31%), Gaps = 79/389 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI++ +  + + ++ID+A +   R +++S   +   +  A+  +     D      + 
Sbjct: 40  LIAIMMFLFLIVVAFSIDIAQMHLARTELRS---STDAAANAAATTLADTLDRNLAIQRG 96

Query: 61  STIFKKQIKKH----LKQGSYI-RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
             I +  +       L  G +    +   +  K   N  +   N ++   +  A      
Sbjct: 97  QQIAQANLVNGQPLLLADGDFQFGRSDRQVNGKYAFNAGEAPFNGVRVNGQRTAGSLSGP 156

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
             LF   +  +++      +T             I +V+D S SM               
Sbjct: 157 VPLFFGNVTGTSIFEPEAFATATYVER------DITLVVDRSGSMAGSRFND-------- 202

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                                L  +     + +     ++    
Sbjct: 203 -------------------------------------LQAAIRIFTDLLATTPVDE---- 221

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
            +IG  +YN     ++   L+ N  EV + +++L     T+    M          +E +
Sbjct: 222 -QIGLASYNDR--ASEDVQLTENFAEVNNAMDRLRTGGFTSISRGMQAG-------QEIA 271

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
                   +++ +I +TDG ++             +   +   G+ I+++   A  +   
Sbjct: 272 LRGRPPEFVERTMIVMTDGRHN------RGPEPRVVATDLAADGVTIHTITFGAGADFGR 325

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +        G+ F   +  +L + + +I 
Sbjct: 326 MQDVARIGGGRHFHATNGDQLRDIYREIA 354


>gi|32474857|ref|NP_867851.1| chloride channel [Rhodopirellula baltica SH 1]
 gi|32445397|emb|CAD75398.1| conserved hypothetical protein-putative chloride channel
           [Rhodopirellula baltica SH 1]
          Length = 900

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 95/274 (34%), Gaps = 74/274 (27%)

Query: 122 GLIPSALTNLS--LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           GL     T +   L      E+  E  ++++ +V+D S SM                   
Sbjct: 435 GLGGYYRTQIEEILPVRSNFEKEREKPSLAMMLVIDKSGSMGG----------------- 477

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                                       +KI++  ++A   V  +       K+    IG
Sbjct: 478 ----------------------------QKIELAKDAAQAAVELL-----GPKDA---IG 501

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
            IA++           +++   +   ++ +     TN YPAM  AY  L           
Sbjct: 502 VIAFDGDSYTVSELRSTSDRGAISDAISTIEASGGTNMYPAMADAYEALL---------- 551

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
           G+T   K VI +TDG +S             +   M  + + + +VA+      +DLL +
Sbjct: 552 GATAKLKHVILMTDGVSSPGDFQG-------VAGDMSASRITLSTVALG-QGSSEDLLEE 603

Query: 360 CTD-SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                 G+++  +D + + + F K T +  + ++
Sbjct: 604 LAQIGGGRYYFCDDPQSVPQVFAKETVEASKSAI 637


>gi|331090683|ref|ZP_08339532.1| hypothetical protein HMPREF9477_00175 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330400097|gb|EGG79748.1| hypothetical protein HMPREF9477_00175 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 3699

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 64/394 (16%), Positives = 122/394 (30%), Gaps = 69/394 (17%)

Query: 55  TKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
                  +  +    +         E    + + +  NI +   +        K      
Sbjct: 39  KSAGNVKSQPRAAFDEESVSDESSLETWTKVVENSTENIGRIWVDKTVSDKNIKLPASSQ 98

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
            + + +       L  LS  S+     +  +  + I  VLD S SM D     ++   N+
Sbjct: 99  GKEIEIDKGTSDFLVGLSALSSTSNISTVADKPLDIVFVLDTSGSMSDPMEYIYSPTYNV 158

Query: 175 TSNK------------------------------YLLPPPPKKSFWSKNTTKSKYAPAPA 204
            ++                                     PKK+    N  +        
Sbjct: 159 VTDGRVEYYAEVEGNYVKIDRITGLFGFFKHWEVAGKEVTPKKNESDTNGIQFYTRREKP 218

Query: 205 PANRKIDVLIESAGNLVNSIQK---AIQEKKNLSVRIGTIAYNIGIVGNQCTPL--SNNL 259
            +  K+  L  +         K   +I +      R+  + ++      Q      SN +
Sbjct: 219 NSQSKMGALKIAVNQFAQETAKRNDSITDAAKQ-HRMSIVTFSSESYIRQSLKAYNSNTV 277

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
           +E +  +N LN    T     M  A   L N +E +         +K VIF TDG    +
Sbjct: 278 SEFERTINGLNANGATYANLGMEKAKESLKNVREKA---------QKVVIFFTDGTPGRS 328

Query: 320 SAYQNTL-NTLQICEYMRNAGMKIYSVA-------------VSAPPEG----------QD 355
               +T  NT+Q  + +++   KIYS+               +A   G            
Sbjct: 329 GFDDDTANNTIQAAKSLKDDLTKIYSIGVFDQANPDNTSSSFNAYMHGVSSNYPNATKWT 388

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            L +  ++S  + A  D+ EL + F++I +++  
Sbjct: 389 ELGERAENSNYYKAAQDADELNKIFEEIFEEMNS 422


>gi|32474888|ref|NP_867882.1| hypothetical protein RB7557 [Rhodopirellula baltica SH 1]
 gi|32445428|emb|CAD75429.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 327

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 48/389 (12%), Positives = 119/389 (30%), Gaps = 79/389 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI++ +  + + ++ID+A +   R +++S   +   +  A+  +     D      + 
Sbjct: 4   LIAIMMFLFLIVVAFSIDIAQMHLARTELRS---STDAAANAAATTLADTLDRNLAIQRG 60

Query: 61  STIFKKQIKKH----LKQGSYI-RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
             I +  +       L  G +    +   +  K   N  +   N ++   +         
Sbjct: 61  QQIAQANLVNGQPLLLADGDFQFGRSDRQVNGKYAFNAGEAPFNGVRVNGQRTTGSLSGP 120

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
             LF   +  +++      +T             I +V+D S SM               
Sbjct: 121 VPLFFGNVTGTSIFEPEAFATATYVER------DITLVVDRSGSMAGSRFND-------- 166

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                                L  +     + +     ++    
Sbjct: 167 -------------------------------------LQAAIRIFTDLLATTPVDE---- 185

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
            +IG  +YN     +    L+ N  EV + +++L     T+    M          +E +
Sbjct: 186 -QIGLASYNDRASED--VQLTENFAEVNNAMDRLRTGGFTSISRGMQAG-------QEIA 235

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
                   +++ +I +TDG ++             +   +   G+ I+++   A  +   
Sbjct: 236 LRGRPPEFVERTMIVMTDGRHN------RGPEPRVVATDLAADGVTIHTITFGAGADFGR 289

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +        G+ F   +  +L + + +I 
Sbjct: 290 MQDVARIGGGRHFHATNGDQLRDIYREIA 318


>gi|86357991|ref|YP_469883.1| hypothetical protein RHE_CH02376 [Rhizobium etli CFN 42]
 gi|86282093|gb|ABC91156.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 427

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 65/428 (15%), Positives = 141/428 (32%), Gaps = 76/428 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----------ALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D+AH + +R Q+ +          A  +  ++   ++  + T+
Sbjct: 19  MTALLMVPLMGAAGMAVDVAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMNGNGTV 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
               T       IF  Q    L           DI     I++TK   N L       A 
Sbjct: 79  SLGKT---DARNIFMSQTSGEL----------TDIHIDLGIDVTKT-ANKLNSQVSFTA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T   + +     +   ++LD + SM          
Sbjct: 124 ----TVPTTFMRIFGRDSIIISGTATAEYQTA---AFMDFYILLDNTPSMGVGATASDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +          +S  +    KS           +IDV+ ++   L ++ +   + 
Sbjct: 177 KLQAKTGCAFACHQMDQSTNNYTIAKSLGVTM------RIDVVRQATQALTDTAKA--ER 228

Query: 231 KKNLSVRIGTIAYNIGIVGNQCT---PLSNNLNEVKSRLNKLNPYE------NTNTYPAM 281
             +   R+G   +       + T    L+++L +VK+  N ++         N++   + 
Sbjct: 229 VSSDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKNYTNAVDLMTIPYQNYNSDQLTSF 288

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------LQI 331
             A  ++    + + +   +   +K + F+ DG          T  T             
Sbjct: 289 DSAMTQINTIIDPAGDGTSNISPEKILFFVADGVGDSYKPSTCTKKTTGGRCQEPIDTTF 348

Query: 332 CEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRE 375
           C+ +++ G+KI   Y+  +  P                   ++ C  S G +F V  +  
Sbjct: 349 CKPLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQNEIPTKMQACA-SPGLYFEVTPTDG 407

Query: 376 LLESFDKI 383
           + ++   +
Sbjct: 408 IADAMKAL 415


>gi|85716351|ref|ZP_01047324.1| hypothetical protein NB311A_19225 [Nitrobacter sp. Nb-311A]
 gi|85696867|gb|EAQ34752.1| hypothetical protein NB311A_19225 [Nitrobacter sp. Nb-311A]
          Length = 542

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 74/162 (45%), Gaps = 16/162 (9%)

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL--YNEKESSHNTIGSTRL 304
            +    T +S+  + +K++++ + P  NTN    +   ++ L   N   ++         
Sbjct: 383 CLPATITAMSSQWSTLKNQIDAMTPSGNTNQSIGLAWGWQSLSTTNGPIAAPGKESGYVY 442

Query: 305 KKFVIFITDGENSGASAYQ-------NTLNTLQI--CEYMRNAGMKIYSVAVSAPPEG-- 353
           + +++ ++DG N+    Y         T++  Q   C+ ++++G+ I+++ V+   +   
Sbjct: 443 QDYIVLLSDGLNTQNRWYSCPPSGPCPTIDARQALLCQKVKDSGVTIFTIQVNVGSKDPL 502

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
             +L+ C    G F  +  + E  ++F  I  +I +  +R+A
Sbjct: 503 SQVLQNCASD-GNFQMITSATETADAFQNILTQISQ--LRLA 541


>gi|320156062|ref|YP_004188441.1| hypothetical protein VVM_02402 [Vibrio vulnificus MO6-24/O]
 gi|319931374|gb|ADV86238.1| hypothetical protein VVMO6_01216 [Vibrio vulnificus MO6-24/O]
          Length = 465

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 56/458 (12%), Positives = 127/458 (27%), Gaps = 79/458 (17%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSG----------------------C 41
           +++    +F  +  D+  I  + NQ+ +A DAA+ S                        
Sbjct: 14  VLLMSMLVFAAWVTDVMRIYSVHNQIANATDAALASAIISEVPESTAVELLHANLTSGAA 73

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
           +  V +  +     +++++  +    +   L   +   + +  I   A+  I+    N  
Sbjct: 74  SPYVEEVRLTHLRDEQEESLQVALDFVPNSL---NIAAQESVPIRTNAKAGISS---NKA 127

Query: 102 QYIAESKAQYEIPTENLFLKGLI-----------PSALTNLSLRSTGIIERSSENLAISI 150
           + +        +  E +                  +   N  +         +      I
Sbjct: 128 EIVFMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEI 187

Query: 151 CM---------VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP--------PPKKSFWSKN 193
            +          +       D++ +       +   +              P        
Sbjct: 188 YLGSFRRYDHAQVKRENRWSDMFDKASGRTPAVPGRQRNAMCRDLDFEGNNPATLGLRYF 247

Query: 194 TTKSKYAPAPAPANRKI-------DVLIESAGNLVNSIQKAIQEKKNLS---VRIGTIAY 243
               K     +  +++I        VL    G  ++          N          I  
Sbjct: 248 RNLEKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAIFD 307

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--------NEKESS 295
           +I    N   P        +S + +L P  NTN    M  A R L           +   
Sbjct: 308 DIECHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRPEL 367

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPPEG 353
                     K+++  +DG N              IC  ++    G+K+ +V        
Sbjct: 368 PRRYSDETSNKYLVMFSDG-NHLIDPAFRDKKMKLICTQLKQPGRGVKVMTVNFGG-AAS 425

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           + L++ C      ++ V     + + F++I +++   S
Sbjct: 426 ERLMQSCASGPE-YYHVASLFSVEKVFEQIAEQVISSS 462


>gi|312794604|ref|YP_004027527.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181744|gb|ADQ41914.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 900

 Score = 81.9 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 52/342 (15%), Positives = 102/342 (29%), Gaps = 73/342 (21%)

Query: 52  DPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY 111
           D          + K      +   +  RE+  D    A     KD    L  I    +  
Sbjct: 319 DVVKSDQANFGLDKLLGYSFVILCNVSRESFSDNFLNAVEKYVKDLGGGLVVIGGVNSYA 378

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
                N  L+ ++P             ++   +   I + +VLD S SM D         
Sbjct: 379 LGNYSNSVLEKMLPVK---------MELKNKEKEKNIDVMLVLDHSGSMADTEDA----- 424

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
                                                K+++   ++  +V  ++ +    
Sbjct: 425 ----------------------------------GIPKLEIAKSASAKMVEHLESSDG-- 448

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
                 +G IA++                +V   ++ +     T   P +  A + L   
Sbjct: 449 ------VGVIAFDHNYYWAYKFGKLVRKEDVIESISSIEVGGGTAIIPPLSEAVKTL--- 499

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
                    S    K V+ +TDG        Q+        +  +   +KI ++ V    
Sbjct: 500 -------KKSKAKNKLVVLLTDG-----MGEQSGYEIPA--DEAKRNNIKITTIGVGKFV 545

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
               L      +SG+F+ V++  EL++ F K T  I+ + ++
Sbjct: 546 NASVLSWIAAYTSGRFYLVSNPSELVDVFLKETKIIKGKYIK 587


>gi|327190622|gb|EGE57710.1| hypothetical protein RHECNPAF_409007 [Rhizobium etli CNPAF512]
          Length = 427

 Score = 81.9 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 65/428 (15%), Positives = 142/428 (33%), Gaps = 76/428 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----------ALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH + +R Q+ +          A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMAMNGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
               T       IF  Q+   L +          +     I++TK   N L       A 
Sbjct: 79  SLGKT---DARDIFMSQVSGELAE----------VHVDLGIDVTKT-ANKLNSQVSFTA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T   + +     +   ++LD + SM          
Sbjct: 124 ----TVPTTFMRIFGRDSITISGTATAEYQTA---AFMDFYILLDNTPSMGVGATPSDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                           KS  +    KS           +IDV+ ++   L ++ +   + 
Sbjct: 177 KLEAKVGCAFACHQMDKSTNNYTIAKSLGVAM------RIDVVRQATQALTDTAK--TER 228

Query: 231 KKNLSVRIGTIAYNIGIVGNQCT---PLSNNLNEVKSRLNKLNPYE------NTNTYPAM 281
             +   R+G   +       + T    L+++L +VK+  + ++         N++     
Sbjct: 229 VSSDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKNYTDAVDLMTIPYQNYNSDQITNF 288

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------LQI 331
             A  ++    + + +   +T  +K + F++DG          T  T             
Sbjct: 289 DSAMTQMNTIIDLAGDGTSNTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSF 348

Query: 332 CEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRE 375
           C+ +++ G+KI   Y+  +  P                   ++ C  S G +F V+ +  
Sbjct: 349 CKPLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQSEIPTKMQACA-SPGFYFEVSPTDG 407

Query: 376 LLESFDKI 383
           + ++   +
Sbjct: 408 ITDAMKAL 415


>gi|90420284|ref|ZP_01228192.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335618|gb|EAS49368.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 593

 Score = 81.9 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 70/212 (33%), Gaps = 63/212 (29%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
           N G +    TPL++N   + + +N ++    TN    +   +R L   +  +       +
Sbjct: 380 NRGCLSTPVTPLTDNQATINAAINAMDADGETNIPEGIAWGWRLLSAREPFTQGRANDAK 439

Query: 304 LK-KFVIFITDGENSGASAYQN-------------------------------------- 324
              K ++ +TDG+N+  S   +                                      
Sbjct: 440 DNLKVLVLMTDGDNNYGSDENDYNESGYGTFGYASTYDAYGNHSWGRIFDDTSTTSKRAN 499

Query: 325 --------TLNTLQICEYMRN--------AGMKIYSVAVSAPPEG--QDLLRKCTD---- 362
                         IC+ +++         G+ I+++A         + L+ +C      
Sbjct: 500 RSSFVSAMNEKVAAICQNIKDDGRKATGEDGIVIFTIAFDLNDGSSVKKLMEQCASYGIT 559

Query: 363 --SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             +   ++    S +L+ +FD IT+++    +
Sbjct: 560 DPTKKLYYDAKSSSDLMAAFDSITEQVSSLRI 591



 Score = 53.0 bits (125), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 34/244 (13%), Positives = 77/244 (31%), Gaps = 53/244 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + + +    +  A+D++ I   +  +Q ++D A L+      +++     +   +  
Sbjct: 26  VFGLTLPILACCMGAAVDISGIYASKRNLQHSVDIAALAAGREYSNNQQDSHLSKVAEGY 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F+           +  +   +      + ++  + +P  +             +   
Sbjct: 86  --FFENAGADARANTDFSYDGIFNEDGSTVLQVSAARRHPTIFG---------DLLSFVT 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G +      L+ RS  +++    N +I + MVLD S SM                    
Sbjct: 135 AGELDWRAFPLAARSQIVVQ----NQSIELVMVLDNSGSM-------------------- 170

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS-IQKAIQEKKNLSVRIG 239
                               P      RKID + E+A  L    ++ A      L V+ G
Sbjct: 171 -----------------TGRPKSGGGKRKIDTIKEAAIGLTGQFLKGAASSTLKLPVQFG 213

Query: 240 TIAY 243
            + +
Sbjct: 214 VVPF 217


>gi|315649108|ref|ZP_07902201.1| von Willebrand factor type A [Paenibacillus vortex V453]
 gi|315275543|gb|EFU38898.1| von Willebrand factor type A [Paenibacillus vortex V453]
          Length = 983

 Score = 81.9 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 88/267 (32%), Gaps = 69/267 (25%)

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
                 +L  +  +E   E  ++ + +V+D S SM+                        
Sbjct: 385 KTPIEKALPVSMELEGKREIPSLGLILVIDRSGSMDG----------------------- 421

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
                                  KI++  ESA   V  ++            +G +A++ 
Sbjct: 422 ----------------------TKIELAKESAMRTVELLRSKDT--------VGVVAFDD 451

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                       N  EV S +  +     TN YPA+  A  E+   K            +
Sbjct: 452 QPWWVVPPQKLGNKEEVLSSIQSIPSAGGTNIYPAVSSALEEMLKIKSQ----------R 501

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG 365
           + +I +TDG+++  S YQ+  +T      M    + + SVAV    +   L      + G
Sbjct: 502 RHIILMTDGQSAMNSGYQDLTDT------MVENKITMSSVAVGTDADTHLLQSLAEAAKG 555

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSV 392
           +++ V D   L   F +    + +  +
Sbjct: 556 RYYFVEDETTLPAVFSREAVMLAKSYI 582


>gi|254477542|ref|ZP_05090928.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214031785|gb|EEB72620.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 523

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 48/113 (42%), Gaps = 10/113 (8%)

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
              ++ + Y+ L+ +   +     S     +        +S  ++ +N   T  IC+  +
Sbjct: 416 ARTSLRYVYQRLFADWMGNSAAKNSWYYGVY--------DSWGTSTKNAR-TKAICDAAK 466

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
             G+ +Y++   AP  G  +L+ C  S   +F V    E+ ++F  I   I++
Sbjct: 467 ARGIVVYTIGFEAPSGGVSVLKDCASSDAHYFDVQ-GLEISDAFASIATSIRQ 518



 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 46/365 (12%), Positives = 87/365 (23%), Gaps = 73/365 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A ++S         IDL  +   R  +Q  LD AVL+     +      D   +    
Sbjct: 6   MIAFLLS-MVAVGGIGIDLMRMERDRTILQYTLDRAVLAAAD--LDQPLPPDVVVQDYLN 62

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                +  +  + +     +                                   E  +L
Sbjct: 63  KANLSEYYQPPIAETGIGYKRVESTIDTT-------------------------FETQWL 97

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------DLY 164
                       +              + I +VLDVS SM                 D  
Sbjct: 98  DFSGGQ-----DMPLYANSRAEESIDGLEISLVLDVSGSMNSNSRLYNLKNAARDFIDTM 152

Query: 165 LQKHNDNN-NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
           +    DN  +++   Y       K    +     ++  +                   + 
Sbjct: 153 VANTADNKMSVSIVPYATQVSLPKDMLDQYNVTDEHEYSNCVNFTGTHFTSTGLSTTASL 212

Query: 224 IQKAIQEK---KNLSVRIGTIAYN--IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            +          +     G I Y         +  P   + N +K  +  L  + NT+  
Sbjct: 213 NRTMHFTPWWSGDARPSNGLIQYPVCDERAHREVMPFQKDANRLKDFIQNLQAWGNTSID 272

Query: 279 PAMHHAYRELYNEKE------------------SSHNTIGSTRLKKFVIFITDGENSGAS 320
             M      L    +                          T   K ++ +TDG+N+   
Sbjct: 273 VGMKWGTVLLDPSAQPVISALTSSSVNVPGVFADRPAAYNDTETVKVIVLMTDGQNTSQY 332

Query: 321 AYQNT 325
             ++ 
Sbjct: 333 YVESD 337


>gi|254420933|ref|ZP_05034657.1| hypothetical protein BBAL3_3243 [Brevundimonas sp. BAL3]
 gi|196187110|gb|EDX82086.1| hypothetical protein BBAL3_3243 [Brevundimonas sp. BAL3]
          Length = 646

 Score = 81.5 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 62/187 (33%), Gaps = 39/187 (20%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-----KESSHNTI 299
                +Q  PL+N    +   ++ +    +T  +  +   +  +           +    
Sbjct: 458 NACPASQIVPLTNVKKTLTDAVDGMTAVGSTAGHIGLAWGWYLVSPNFGLWSGLGAPAAY 517

Query: 300 GSTRLKKFVIFITDGE-------------------------NSGASAYQNTLNTLQICEY 334
            S++  K V+ +TDGE                         N  A+   +     ++CE 
Sbjct: 518 DSSKTLKAVVLMTDGEFNTPYFRGVIASDAGNGSGGADTHINQPATNGSSFEQAYRLCEN 577

Query: 335 MRNAGMKIYSVAVSAPPE---------GQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           M+ A + +Y+V                  +L+ +C  +  + F  + S +L ++F  I  
Sbjct: 578 MKAADVIVYTVGFDIGAARNMTGPIDSAGELMARCATNPDRAFQASSSTDLSDAFRDIGR 637

Query: 386 KIQEQSV 392
            I    +
Sbjct: 638 DITRLRI 644


>gi|190892054|ref|YP_001978596.1| hypothetical protein RHECIAT_CH0002466 [Rhizobium etli CIAT 652]
 gi|190697333|gb|ACE91418.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 427

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 66/428 (15%), Positives = 142/428 (33%), Gaps = 76/428 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----------ALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH + +R Q+ +          A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMAMNGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
               T       IF  Q+   L +          +     I++TK   N L       A 
Sbjct: 79  SLGKT---DARNIFMSQVSGELAE----------VHVDLGIDVTKT-ANKLNSQVSFTA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T   + +     +   ++LD + SM          
Sbjct: 124 ----TVPTTFMQIFGRDSITISGTATAEYQTA---AFMDFYILLDNTPSMGVGATPSDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                           KS  +    KS           +IDV+ ++   L ++ +   + 
Sbjct: 177 KLEAKVGCAFACHQMDKSTNNYTIAKSLGVAM------RIDVVRQATQALTDTAK--TER 228

Query: 231 KKNLSVRIGTIAYNIGIVGNQCT---PLSNNLNEVKSRLNKLNPYE------NTNTYPAM 281
             +   R+G   +       + T    L+++L +VKS  + ++         N++     
Sbjct: 229 VSSDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKSYTDAVDLMTIPYQNYNSDQITNF 288

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------LQI 331
             A  ++    + + +   +T  +K + F++DG          T  T             
Sbjct: 289 DSAMTQMNTIIDPAGDGTSNTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSF 348

Query: 332 CEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRE 375
           C+ +++ G+KI   Y+  +  P                   ++ C  S G +F V+ +  
Sbjct: 349 CKPLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQSEIPTKMQACA-SPGFYFEVSPTDG 407

Query: 376 LLESFDKI 383
           + ++   +
Sbjct: 408 ITDAMKAL 415


>gi|159044810|ref|YP_001533604.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
 gi|157912570|gb|ABV94003.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
          Length = 553

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           T QIC+ ++   + I+++   AP  GQDL+R C  SSG +F V    E+ E+F  I + I
Sbjct: 488 TEQICDQLKAQDVVIFTIGFEAPQRGQDLMRYCASSSGHYFDVE-GVEISEAFSSIANTI 546

Query: 388 QEQSVRI 394
           Q+  + +
Sbjct: 547 QQLRLSL 553



 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 59/369 (15%), Positives = 104/369 (28%), Gaps = 78/369 (21%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           I  +  +     IDL     +R ++Q+  D AVL+          +   T  K      F
Sbjct: 39  IFILMMMIAGLTIDLMRYEAVRTRLQATSDRAVLAAA-------DLDQTTNAKAVVEDYF 91

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            K        G  + +       +AQ++ T                  IPT  + + G  
Sbjct: 92  AKAGMSQYLDGVQVSKGLNFKEVEAQVSAT------------------IPTWFMNMSG-- 131

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------------- 161
              +  L   +    E   +N+ +S  +VLD+S SM                        
Sbjct: 132 ---IETLDAFARSKAEERIQNIEVS--LVLDISGSMGWDGKLANMRTAADQFVRTMMAGN 186

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG--N 219
           D          +++   Y            +    ++   +        D    S     
Sbjct: 187 DNVAADGTGLTSVSIIPYHAVVNVPDELLDEYAVSTQQTVSNCVRFTATDFQSISIDRTK 246

Query: 220 LVNSIQKAIQEKKNLSVRIG--TIAYNIGIVGNQCTPLSNNLN--EVKSRLNKLNPYENT 275
            ++ +    +   NL    G   I      VG     L  + +  ++ +++ +L    NT
Sbjct: 247 TLDRLAHFDRNNSNLHTFNGDRLIGRPWCQVGTYGAILPWSTSVTDLTNKVAELGASGNT 306

Query: 276 NTYPAMHHAYREL---YNEKESSHNTIGSTRLK--------------KFVIFITDGENSG 318
            T   M  A   L              G                   K V+ +TDGEN+ 
Sbjct: 307 ATDIGMKWAAALLDPGTQNIVDDMIDGGHLEADLAGRPVLYSDPETIKVVVLMTDGENTS 366

Query: 319 ASAYQNTLN 327
               +N   
Sbjct: 367 QYDLKNEFK 375


>gi|87306401|ref|ZP_01088548.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
 gi|87290580|gb|EAQ82467.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
          Length = 578

 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/263 (14%), Positives = 93/263 (35%), Gaps = 27/263 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK--- 57
           + A+++ V   F+  ++D+ ++  +++Q+Q ++D+A L+G  +++    +   T  +   
Sbjct: 26  LAAVLMIVMMGFMALSVDVGYMFTMQSQLQRSVDSAALAGAGTLIEGEDVATGTVHEYLT 85

Query: 58  -DQTSTIFKKQIKKHLKQGS--YIRENAGDIA------QKAQINITKDKNNPLQYIAESK 108
            +     +K+  + +       ++ +    +             +   + NP        
Sbjct: 86  HNPVGLQWKEFTEGNTADNVDKFLTKYGDGLQLTIGEWNDTSGQVVAAEKNPTTVSVRMT 145

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH 168
            +        F   L+     +++  S    +         I +VLD+S SM D      
Sbjct: 146 YE----NMPFFFGHLLGRDSFDITAESIATYQSR------DIMLVLDLSGSMNDDSEFNS 195

Query: 169 NDN---NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS-I 224
                 +++ SN   +        +       +YA    P  +       S     NS +
Sbjct: 196 IGKLGFDHIYSNSQQMYADLGSPIFGNLQFDPQYAVVNGPTPQSSGQAKSSVTYRGNSVV 255

Query: 225 QKAIQEKKNLSVRIG-TIAYNIG 246
            K+ +  K +SV+      YN  
Sbjct: 256 VKSDKTIKQISVKTSNGSTYNYY 278



 Score = 45.7 bits (106), Expect = 0.013,   Method: Composition-based stats.
 Identities = 39/244 (15%), Positives = 77/244 (31%), Gaps = 34/244 (13%)

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ 225
           Q +N         +       +  +S N+T   +  +  P    I  +  S    ++ +Q
Sbjct: 353 QNNNAGYRYRFGYFNWINYLLERQYSSNSTPDLWKASAQP----ITAVKNSVDLFIHFMQ 408

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTP-LSNNLNEVKSRLNKLNPY---ENTNTYPAM 281
           +          RIG   YN           L+ NL  + ++  +         TN    M
Sbjct: 409 EGDGR-----DRIGLAVYNAPNGDGLLESTLTENLPFIMTQSRQRQAGHYHNYTNIGGGM 463

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC-EYM---RN 337
                EL                 K ++ +TDG+ +  +   N                +
Sbjct: 464 TVGREELQTRGRKGAV--------KMMVLLTDGQANWVNGGVNNNAAKNYVLNEAYLCAD 515

Query: 338 AGMKIYSVAVSAPPEGQDLL-RKCTDSSGQFFAV-------NDSRELLESFDKITDKIQE 389
            G  I ++++ A  + + L+ +    + G  F V         S +L E F ++      
Sbjct: 516 QGFTIITISLGAGAD-KALMDQVAEITGGVHFNVPGGQTVDEYSEDLTEIFRQVAGHRPL 574

Query: 390 QSVR 393
           + V+
Sbjct: 575 KLVK 578


>gi|222147837|ref|YP_002548794.1| hypothetical protein Avi_1104 [Agrobacterium vitis S4]
 gi|221734825|gb|ACM35788.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 483

 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 62/480 (12%), Positives = 148/480 (30%), Gaps = 105/480 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M+AI++    L +  A+D +     RN +Q       ++  ++I++  +    ++  D  
Sbjct: 21  MSAILLMPLLLAVGAAVDYSSARDHRNDIQ-------VTADSAILAAASSYSSSSGVDSL 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +      +   L        +   + ++            +  +                
Sbjct: 74  AAGIDSYLDSKLTDQGSNDVDTAAVPKRLSGPTLSADGKEICIVVG-------EGVPTSF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-------------------- 160
             L      ++S +S   +     N+ + + +VLDVS SM                    
Sbjct: 127 MQLAGVKTVDVSAKSCAAL---PGNIDLEVSLVLDVSSSMIEEGRFVPMQTAVKSFLTSF 183

Query: 161 -EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
             D  + K +       +         K +                          S   
Sbjct: 184 ANDATVAKRSKIAIAPFSSRFNIGLTHKDWLKAYGGNDAVPSRWTDPKSYYKDSKYSFSQ 243

Query: 220 LVNSIQKAIQEKKNLS----------VRI---GTIA------------------YNIGIV 248
            ++++        N            V +   G I                   YN G  
Sbjct: 244 WIDNVTTLAYTSSNYYWIGCVEPRADVEMKDNGAIGTYGLSDAPPSTEAFVAQDYNTGSS 303

Query: 249 GNQCTP----LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-----KESSHNTI 299
            + C P    L+++ + ++S +  +    +T     M   +  L  +        +    
Sbjct: 304 TSFCPPPIVPLTSSFSTLQSAIADMTSEGSTRLDAGMLAGWYTLSPKWRSAWGGGTAPAD 363

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNT-------------------------LQICEY 334
            S ++KK ++F+TDGE +      +   +                         L  C+ 
Sbjct: 364 YSEKVKKVIVFMTDGEMNVKFGSTDPAKSSTEKLDWICDKNRTKSCNDTATNALLTTCDS 423

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +++  ++IY+++ S+  + Q+L + C+  +  +F+   +  + + +  I+  I   +VR+
Sbjct: 424 IKSNNIEIYAISYSSEADVQNL-QTCSSGTKYYFSA-STTNIKDVYTAISKNIIGSTVRL 481


>gi|209549601|ref|YP_002281518.1| hypothetical protein Rleg2_2008 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535357|gb|ACI55292.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 429

 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 62/429 (14%), Positives = 146/429 (34%), Gaps = 76/429 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH M +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLLGTAGMAVDFAHAMSLRTQLFAAADAAAVGSIAEKSGAVAAAMTMTGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
               T      +IF  Q+   L           D+     I++TK   N L       A 
Sbjct: 79  SLGKT---DARSIFLSQVSGELA----------DVNVDLGIDVTKT-ANKLNSQVSFTA- 123

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                       ++      +S  +T     +S    +   ++LD + SM      K   
Sbjct: 124 ----VVPTTFMRVLGKDSITISGTATAEYLTAS---FMDFYILLDNTPSMGVGATAKDVA 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                ++        +    +     +K        + +IDV+ ++   L  + +     
Sbjct: 177 TMEKNTSDSCAFACHETENKNNYYNLAKTLG----VSMRIDVVRQATKELTLTAKSTRVS 232

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPL---SNNLNEVKSRLNKL------NPYENTNTYPAM 281
                 R+G   +         T +   +++L++V++  + +          N +   + 
Sbjct: 233 TNQ--FRMGVYTFGTKAEDANLTTISDPTDDLDKVRTYTDAVDLMTIPKQGYNNDQQTSF 290

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-----------ENSGASAYQNTLNTLQ 330
            +A  ++ +   +  +   +T  +K + F++DG           +    +  Q  ++T  
Sbjct: 291 DNALTQMKDIITTPGDGSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDT-S 349

Query: 331 ICEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSR 374
            C+ +++ G++I   Y+  +  P                   +++C  S G +F V  + 
Sbjct: 350 FCKPLKDKGIRIAVLYTTYLPLPKNSWYNTWISPFQSQIPTKMQECA-SPGLYFEVTPTE 408

Query: 375 ELLESFDKI 383
            + ++   +
Sbjct: 409 GIADAMKAL 417


>gi|319784437|ref|YP_004143913.1| hypothetical protein Mesci_4754 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170325|gb|ADV13863.1| hypothetical protein Mesci_4754 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 553

 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 64/173 (36%), Gaps = 34/173 (19%)

Query: 251 QCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKF 307
              PL+++ ++++   +++       TN    +    R L      +      +  + K 
Sbjct: 376 PVVPLTDDFDKLRKAASQMTEWNGSGTNVSEGLSWGMRVLSPAAPYTDGAPWKTPGISKI 435

Query: 308 VIFITDGEN-----------------------------SGASAYQNTLN-TLQICEYMRN 337
           V+ +TDGEN                             +  +A +N    T  +C  ++N
Sbjct: 436 VLLLTDGENVVYGASEQEPTKSDYTSYGYLAGGRFGSDNQTTAARNVDGWTKNVCTQLKN 495

Query: 338 AGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            G++IY++ + +       L   C      ++AVND  +L   F +I +   +
Sbjct: 496 EGVQIYTMVLQSDTAANRALYSACASDPSNYYAVNDPTKLPNVFLQIANNFTK 548



 Score = 51.1 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 63/182 (34%), Gaps = 27/182 (14%)

Query: 6   ISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFK 65
           + V    + +A D++ +M  ++ +Q+ALD+A L+               T+ D  +  F+
Sbjct: 22  LPVILTAVAFATDVSTLMRAKSNLQNALDSANLASSHL------GDLDITRNDAFNRYFQ 75

Query: 66  KQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP 125
             I  H      +      +     +N  K          ++ A  ++     FL G   
Sbjct: 76  ANIVGH----GELDNAQATLTVDKGVNFVKT---------KAVASADVHLNFAFLFG--- 119

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
               ++ + ++ +      N  + + +VLD + SM    +           +       P
Sbjct: 120 -DSKHIVVDASAV----ESNNQLEVVLVLDNTGSMAGARMTALRTATKSLLDTLEAAKSP 174

Query: 186 KK 187
            +
Sbjct: 175 TR 176


>gi|254506100|ref|ZP_05118244.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
 gi|219550918|gb|EED27899.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
          Length = 415

 Score = 80.7 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 64/414 (15%), Positives = 130/414 (31%), Gaps = 43/414 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+II   F   T A D A  +  + +++ A + AVL+  A    ++  +   +     
Sbjct: 14  LFAMIIPGLFGIFTLATDGARALQTKARIEDASEIAVLAIAAHNDDNQDSQGAGSGSRVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  +L+  +   +  G   +K   +   +    L        QYEI   ++  
Sbjct: 74  RQIATDYLNAYLRDST---QLTGLKVKKYNCDQIAECRAGLARGEPRFFQYEIEVSSVQD 130

Query: 121 KGLIPSALT-----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                +          S +   +  +     A+ I  V D S SM   +    N      
Sbjct: 131 TWFPGNDSIEGFGDTFSAKGAAVARKYQSE-AVDIIFVSDYSGSMAWNWSGGRNRKYIDL 189

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKK-N 233
            N         + F   N T +      A     K      S    +  +         +
Sbjct: 190 RNIIQEVTDELQKFNDLNNTDNNTVGLTAFNYYTKTVPSNRSNHCFMTQLVNPNGRFSAS 249

Query: 234 LSVRIGTIAYNIGIVGN-------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
            +VR   +  N     N       Q  PL++N +   + +    P   T ++  +    +
Sbjct: 250 QTVRNIFVEKNNRYCVNHGDSSRFQDLPLTDNYSSFNNSVRSFYPNHGTASFQGIIRGAQ 309

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM----------- 335
            L                ++ +I ++DGE+   S +   +N   +C  +           
Sbjct: 310 ML----------RKGRNPRRLLIVLSDGEDGDPSRHMQLVNA-GMCSTIVNTLSGDLTPD 358

Query: 336 -RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDKI 387
                 ++  V           L+KC   +   +   +  + L +  + IT++I
Sbjct: 359 GHKVKARLAVVGFDYDVNKNRALQKCV-GAENVYKAQNRDDILNKILELITEEI 411


>gi|315649824|ref|ZP_07902907.1| von Willebrand factor type A [Paenibacillus vortex V453]
 gi|315274798|gb|EFU38179.1| von Willebrand factor type A [Paenibacillus vortex V453]
          Length = 1316

 Score = 80.3 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 68/186 (36%), Gaps = 24/186 (12%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            K+   I SA   ++ +  +         ++G + Y+         PLS +   VK+ +N
Sbjct: 84  NKMQSAINSAKGFIDLMDLSK-------HKVGIVDYSS-ANNISSFPLSTDKEAVKNYVN 135

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     T T  A+  A   L N +  +         +  ++ +TDG+ +  +       
Sbjct: 136 GLRANGGTATGDAIKKARELLVNHRPDA---------QPVIVLLTDGDATEPNGNAYNY- 185

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQD------LLRKCTDSSGQFFAVNDSRELLESFD 381
            L      +  G+  Y++A+       D      LL++   +S     V  S  L + + 
Sbjct: 186 ALTNSNEAKQEGIVFYTIALLNTNANPDTSGPNLLLKQMATTSHHHHFVLGSVGLGDIYA 245

Query: 382 KITDKI 387
            I  +I
Sbjct: 246 AIVQEI 251


>gi|94498567|ref|ZP_01305122.1| hypothetical protein SKA58_08339 [Sphingomonas sp. SKA58]
 gi|94422010|gb|EAT07056.1| hypothetical protein SKA58_08339 [Sphingomonas sp. SKA58]
          Length = 678

 Score = 80.3 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 56/178 (31%), Gaps = 35/178 (19%)

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK---ESSH 296
             +Y            S N     S ++ L     T     M    R L  +      ++
Sbjct: 499 LTSYTNRTSTPTGQSSSFN-----SYIDNLIAVGGTYHDIGMLWGARFLSPKGIFASDNN 553

Query: 297 NTIGSTRLKKFVIFITDGENSGAS---------------AYQNTLNTLQI---------- 331
           +      + + ++F+TDG+ S                  A  NT +T             
Sbjct: 554 SAPNGFNISRHIVFMTDGDMSAYQQVYGAYGYQQLDARVAPGNTSDTDLTAIHNTRLQML 613

Query: 332 CEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           C  ++  G+ I+ +      EG  Q  L+ C  SS  +    D+  L + F  I   I
Sbjct: 614 CNAIKAKGITIWVIGFRNQSEGNIQTPLQNCATSSNHWTMAYDATSLSQKFKDIAKNI 671



 Score = 49.1 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 48/148 (32%), Gaps = 23/148 (15%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
              +D+      R +MQ A DAA L+G  ++ +       ++         KK    +  
Sbjct: 39  GGGLDMGRAYMARARMQQACDAAALAGRRAMTT-------SSMTQANKDEAKKFFDFNFP 91

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
           QG++       + +      T           +  A   +PT  + +          L L
Sbjct: 92  QGTFQAATFTPVIRSKPGETTT---------VQVTASTTMPTTVMKIFR-----YETLPL 137

Query: 134 RSTGIIERSSENLAISICMVLDVSRSME 161
             T        N    + +VLD + SM 
Sbjct: 138 SVTCEARFDIGNT--DVMLVLDTTGSMA 163


>gi|316933619|ref|YP_004108601.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
 gi|315601333|gb|ADU43868.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
          Length = 483

 Score = 80.3 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/455 (12%), Positives = 135/455 (29%), Gaps = 64/455 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I +     F+  A+D +     R  MQSALD+  L     + S +   +       T
Sbjct: 28  IFGIALLPLLGFVGAAVDYSRASRARTAMQSALDSTALMVAKDLTSGKITAENVQSAANT 87

Query: 61  S---------------------TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
                                     +  K  +     I      +   +Q+++      
Sbjct: 88  YFTSLYKNTDAPSIDVTATYTPKTSSENAKLTVGGTGSINTEFMKVMNISQMSLGASSTT 147

Query: 100 PLQ-------YIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM 152
                        +     +   +   +K      +  L   ST   +     +  ++ +
Sbjct: 148 TWGGTRLRVALALDVTGSMDSAGKLSAMKTAAKQLIDTLKATSTTKEDVYISIVPFNVMV 207

Query: 153 VL---DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA--- 206
            +   + + +  D      +  +  T+           ++WS      K   +   A   
Sbjct: 208 NVGPGNKNATWLDWDTSYGSCKSKYTTKNACQAGGDSWNYWSNTCQSQKTLKSACQAGGH 267

Query: 207 ---NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL-------- 255
                 ++       +   +      E  + +     +A N         P+        
Sbjct: 268 TWTASNVNSWKGCVTDRTQNYDTTKTEPTSATPDTLFLAQNYSDCMASLLPMKSAYEATE 327

Query: 256 ---SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST-RLKKFVIFI 311
              S +   +K R+N L+    TN    M  A+  L            S  +    ++ +
Sbjct: 328 SDSSTDATTLKGRINTLDAQGGTNQGIGMFWAWMTLQATAPLYTPAKDSEYKYTDAIVLL 387

Query: 312 TDGENSGASAYQNTLN--------TLQICEY--MRNAGM---KIYSVAVSAPPEGQ-DLL 357
           +DG N+    Y N  N           +C+    +  G+    IY++ V+   + +  +L
Sbjct: 388 SDGMNTKNRWYGNGSNWSPQVDDRQKILCDNITTKVNGVPETTIYTIQVNTSGDPESSVL 447

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           + C  + G FF+   +  +  +F ++   + +  +
Sbjct: 448 KYCGSTGG-FFSTTTASGIQSAFQEVGASLTKLRI 481


>gi|269926840|ref|YP_003323463.1| von Willebrand factor type A [Thermobaculum terrenum ATCC BAA-798]
 gi|269790500|gb|ACZ42641.1| von Willebrand factor type A [Thermobaculum terrenum ATCC BAA-798]
          Length = 918

 Score = 80.3 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 56/359 (15%), Positives = 110/359 (30%), Gaps = 68/359 (18%)

Query: 33  LDAAVLSGCASIVSDRTIKDPTT--KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQ 90
            D A         S   + + T        + +   ++       + I ++   +A+   
Sbjct: 279 NDRAASFTYVESPSRVLVAEGTPGEASGLVAALKAGKLVVDTVDSNDIPKDISTLAKYDA 338

Query: 91  INITKDKNNPLQYIAES---------KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIER 141
           + +     N LQ   ++         K    I  +  F  G   +     +L     I  
Sbjct: 339 VVLVNVPANSLQDAGKTLQVYVHDLGKGLVAIGGDRAFALGGYFNTPLEQTLPVDSQIRN 398

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
             E   +++ M +D S SM                                +   SK   
Sbjct: 399 PDEEPQVAVVMAIDKSGSMAAC-----------------------------HCEGSKLLE 429

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI-GIVGNQCTPLSNNLN 260
                  K+D+  ESA      +        ++    G +A++       +  P++ + +
Sbjct: 430 QYPGGIPKVDIAKESA-----ILSSETLGPNDIF---GVVAFDTAPRWVVRPEPVT-DKS 480

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
            +  ++  +     TN Y  +  A   L   K  +          K VI +TDG      
Sbjct: 481 SIAEKVAGIQGSGGTNIYGGLAEAIDSLIKVKAKN----------KHVILLTDG------ 524

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
            + N  N  ++    R  G+ I +V+ +A    Q L        G F+   DS ++ + 
Sbjct: 525 -WSNVGNYDELISKARRHGITISTVS-AAGGSAQLLRSIAEKGGGTFYNTRDSADIPQI 581


>gi|259416688|ref|ZP_05740608.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348127|gb|EEW59904.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 583

 Score = 79.9 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 280 AMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAG 339
           ++ + YR+L+ +  S+ +     RL  +V     G+++  S       TL +C+  +  G
Sbjct: 481 SLRYLYRDLFGDWMSNASWYWYNRLYSYV-----GDSTKDSR------TLAVCDAAKEKG 529

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           + ++++   AP  GQ +L++C  S+  ++ V D  E+ ++F  I   I++
Sbjct: 530 IVVFTIGFEAPWRGQQVLQQCASSASHYYDV-DGLEISDAFASIASAIRQ 578



 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 57/371 (15%), Positives = 107/371 (28%), Gaps = 68/371 (18%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           +I+ + F      +DL  +   R  +Q  LD AVL+            D     D  + +
Sbjct: 41  MILVLMFALGGLGMDLVRMERDRTNLQYTLDRAVLAAA----------DLDQPLDPEAVV 90

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQI--NITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                  ++ +          + + +     +    +        +   YE    N    
Sbjct: 91  I-----DYMSKSGLSDYTTVVVPEVSPTAKRVKASVDTEFTAGWMNSIFYEDYMRNPDTY 145

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            L P     L L ++     S  N+ IS  +VLDVS SM       +         + + 
Sbjct: 146 ELEP---ITLPLLASSTAVESIGNVEIS--LVLDVSGSMRSNNRLVNLKRAAKEFVQTMD 200

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDV----------------LIESAGNLVNSIQ 225
                          S     PA    ++ V                   +  NL    +
Sbjct: 201 DNTEDGKMSISIVPYSTQVSMPAAFLDEMRVSDEHSYSNCINFDGSDFNTTGLNLSREYE 260

Query: 226 KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
           +               +  VR  T A +          +S+N+ +++S ++     ENT+
Sbjct: 261 RTMHFSVWNYYDYRDDDEHVRQPTCASDADNPERTALLMSDNVAQLQSYIDAFEHSENTS 320

Query: 277 TYPAMHHAYREL--------------YNEKESSHNTIGSTRLK-------KFVIFITDGE 315
               M      L               N  +S      +  +        K ++ +TDG+
Sbjct: 321 IDLGMKWGTALLDPSVQPVIATLANDANPNQSIEARYANRPVSYQDTETLKVIVMMTDGQ 380

Query: 316 NSGASAYQNTL 326
           N+     +N  
Sbjct: 381 NTAQYYIKNDY 391


>gi|75675889|ref|YP_318310.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
 gi|74420759|gb|ABA04958.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
          Length = 605

 Score = 79.9 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 96/259 (37%), Gaps = 25/259 (9%)

Query: 155 DVS-----RSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           D S      S         N +   +           K +W  + T +  A   APA+  
Sbjct: 349 DRSVVVSTGSGASCPSTTPNCSCTGSGRNRKCTQAKYKHYWRAHPTDTNQAKDAAPAHS- 407

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN----IGIVGNQCTPLSNNLNEVKSR 265
                    +   +   +  +  + S    +  +      G +    TP+S+  + +K++
Sbjct: 408 --TWTGCINDRDQAYDISNADPSSGSSGTPSTKFYAEQLNGCLPATITPVSSQSSTLKNQ 465

Query: 266 LNKLNPYENTNTYPAMHHAYREL--YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           ++ ++P  +TN    +   ++ L   N    +     +   + +++ ++DG N+      
Sbjct: 466 IDSMSPSGSTNQAIGLAWGWQTLSTTNGPFPAPAKDKAYVYQDYLVLLSDGLNTRNRWSG 525

Query: 324 NTLN--------TLQICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFAVNDS 373
           N  +           +C+ ++++G  I++V V+         +L+ C  + G F  +  +
Sbjct: 526 NGSDHSPEVDVRQALLCQKVKDSGTVIFTVQVNVGNRDPLSQVLQDCASN-GNFQMITSA 584

Query: 374 RELLESFDKITDKIQEQSV 392
            +  ++F  I  +I +  +
Sbjct: 585 NQTADAFQNILTQISQLRI 603



 Score = 42.2 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 61/165 (36%), Gaps = 20/165 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     F+  A+D       R+ MQ+A+D+AVL     +VS     +P     Q 
Sbjct: 28  IFAIALLPVLGFVGAAVDYTRANAARSSMQAAMDSAVL-----MVSRDAAANPAMTSQQI 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +   ++          Y  ++A +++  A    +            +  Q  I T+ + +
Sbjct: 83  TDAVQRYF-----NSLYNDKSAFNVSVSAAYTPSTSSAAAK---ILASGQGAIETDFMKI 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
            G       +    ST        N  + + +VLD + SM D   
Sbjct: 135 AGF---PQLSFGTSSTSTWG----NSRMRVALVLDNTGSMRDNGK 172


>gi|296445280|ref|ZP_06887239.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
 gi|296257235|gb|EFH04303.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
          Length = 575

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 32/199 (16%), Positives = 61/199 (30%), Gaps = 63/199 (31%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-NEKESSHNTIGSTRLKKF 307
                 L+   + + ++++ L     TN +      +R +      ++     +    K 
Sbjct: 367 SQTVLQLTATQSTITTKISGLTENGYTNLHEGFMWGWRTISPTGPFAAGRAYATKDNHKI 426

Query: 308 VIFIT-----------------------------------DGE--NSGASAYQNTLN--- 327
           ++F+T                                   DG   N     YQ TL    
Sbjct: 427 IVFMTDGFNNWQSATSTVTGSAYQAAGYYSYNGTANQRFPDGTATNGNGVNYQTTLEAAA 486

Query: 328 -----------------TLQICEYMRNAGMKIYSVAVSAP-----PEGQDLLRKCTDSSG 365
                            TL+ C   + AG++IY++  S P      +G  +++ C   + 
Sbjct: 487 GSSTDYHDTSRNMQDELTLEACTNAKTAGVEIYTIGFSVPVDPIDAQGLKMMQDCATDAN 546

Query: 366 QFFAVNDSRELLESFDKIT 384
            +FA  D   L  +F  I 
Sbjct: 547 HYFAATDVDSLNAAFASIG 565



 Score = 47.6 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 60/166 (36%), Gaps = 28/166 (16%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
            I +  +     +D    +  ++ +Q A D+A L+   +IV+  T +             
Sbjct: 32  FIPLVLML-GAGVDYGRAVSTKSNLQQATDSAALAVAKTIVATTTNQQ-----------A 79

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           + Q + +L              + A   +TK + +  +      +  +IPT  + +    
Sbjct: 80  QSQAQVYLLTN----------VRNAVAVVTKAEISADRLTLCLDSTAQIPTTIMKI---- 125

Query: 125 PSALTNLSLRSTGIIERS-SENLAISICMVLDVSRSMEDLYLQKHN 169
            + +  ++ ++T   +     N    I +VLD S SM      K  
Sbjct: 126 -AHIETITTKATTCAQTPGGMNGTYEIALVLDNSGSMSKSAGGKSK 170


>gi|320102588|ref|YP_004178179.1| Heat shock protein 70 [Isosphaera pallida ATCC 43644]
 gi|319749870|gb|ADV61630.1| Heat shock protein 70 [Isosphaera pallida ATCC 43644]
          Length = 688

 Score = 79.6 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 67/385 (17%), Positives = 135/385 (35%), Gaps = 36/385 (9%)

Query: 18  DLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
            ++ +     +M   +D AV  G A   +  T         + +    + I+  +     
Sbjct: 319 YVSDMCGKPPRMGVNVDEAVALGAAIQAALETGTHAEDAMPRFTLSGARVIRDVMSHSLG 378

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI----PSALTNLSL 133
               + D  +   +N      N     A +++      E    +  +      +   L  
Sbjct: 379 TVAVSADGTRY--VNDVVVPRNQPIPAANTRSYLHATHEGRNTRLEVYLTQGESERPLDC 436

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQ--KHNDNNNMTSNKYLLPPPPKKSFWS 191
           +  G    +      +  MV DVS S ++  +   +    +  T     + P P+   W 
Sbjct: 437 QILGKYVFNGIQPTQAEVMV-DVSISYDENGMVQVEARQRDCDTPLAMTIEPVPEDLSWL 495

Query: 192 KNTT---KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL----SVRIGTIAYN 244
                    ++   P      IDV    AG  ++  ++A +   +     + R+G I+Y+
Sbjct: 496 DRPPIDVTERHQVEPLAILLLIDVSSSMAGPPLDEAREAARSFLDQCDFTTTRVGLISYS 555

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
             +V    T L++N+ +V++ L +L     TN   A+    R+L     + H        
Sbjct: 556 DQVVLQ--TDLTDNVRKVEAGLARLEADGTTNLAGALELGRRKLAT-VPTGHV------- 605

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
            K+++ +TDG         +  N L    + + +G++I  VA+      Q  L +   + 
Sbjct: 606 -KYLVVLTDG------YPDDPDNALLEAAHAKGSGIEI--VAIGTGEADQAYLDRIASTQ 656

Query: 365 GQFFAVNDSRELLESFDKITDKIQE 389
                     EL+ +F  I   I E
Sbjct: 657 AGSIFARKG-ELVRAFGHIARVIAE 680


>gi|326792960|ref|YP_004310781.1| von Willebrand factor A [Clostridium lentocellum DSM 5427]
 gi|326543724|gb|ADZ85583.1| von Willebrand factor type A [Clostridium lentocellum DSM 5427]
          Length = 903

 Score = 79.6 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 56/373 (15%), Positives = 123/373 (32%), Gaps = 67/373 (17%)

Query: 45  VSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYI 104
           V +    + T++      +FK  +K            +      +  ++     + L   
Sbjct: 139 VDEINFMELTSQAHNKRVVFKTTVKADGSSKGGFSRYSSSNVAASSADVVVVTQDGLTVT 198

Query: 105 AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY 164
             +K   E+  +N+            + +    ++       A  + +VLD S SM    
Sbjct: 199 KTAK---ELAAKNV--------WEIEVKVEGKNVVL----QEATDVVLVLDRSGSMG-QG 242

Query: 165 LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN----------------R 208
           +   N+ N             +    + +    +Y       N                 
Sbjct: 243 VVDKNNPNAQKCTVLTCTNSNRWHRHNADCYDEEYYILKCTQNHTHTLPGDFIANSCYVS 302

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           + D + +++   ++++Q+         V I  + Y         + L    + ++S  N 
Sbjct: 303 RADKVKDASYTFLDTLQE------KEDVNISVVTYAGTASKVTNSNL---KSGIESAYNV 353

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L   + TNT   +  A + L N          ST   K ++ ++DGE++  ++       
Sbjct: 354 L-GTDGTNTGRGIEIASQILSN----------STAPNKMIVVLSDGESNAGNS------- 395

Query: 329 LQICEYMRNAGMKIYSV--AVSAPPEGQDLLRKCTDSS-----GQFFAVNDS-RELLESF 380
                  +N G  +Y++   +++   G   L  C          +F+  +D+   L E F
Sbjct: 396 RTAANSAKNKGCIVYTIGAGIASGSNGAKELFDCASVDQSTNKAKFYLADDTGNALNEIF 455

Query: 381 DKITDKIQEQSVR 393
            +I  +IQE   +
Sbjct: 456 AEIAGEIQEAGSK 468


>gi|306821351|ref|ZP_07454960.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550638|gb|EFM38620.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 467

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 68/169 (40%), Gaps = 16/169 (9%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT 277
             L   +     ++   +     I ++           ++N  ++   ++K+     TN 
Sbjct: 45  NGLRREVTHKFIDRLTDNDMAAVIGFDYKATV--LEQFTSNKEKLHDAVDKIRSDGGTNI 102

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
             A+  AY  L+N  +++          KF+I +TDG+   +  Y             + 
Sbjct: 103 GRAVSIAYD-LFNNLDNNRKEK----YPKFLILLTDGDGDYSEEYTIL---------AKK 148

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           AG+KIY++ +      + L      + G++F   D+ +L + F+KI DK
Sbjct: 149 AGIKIYTIGLGNGVSEKLLKDIAKGTDGEYFHAKDASKLNKIFEKIADK 197


>gi|99081991|ref|YP_614145.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
 gi|99038271|gb|ABF64883.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
          Length = 582

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           G  S   +      TL ICE  +  G+ ++++   AP  GQ++L+ C  S+  ++ V D 
Sbjct: 503 GLFSSVGSTTKDARTLDICEAAKAKGVVVFTIGFEAPSRGQEVLQACASSASHYYDV-DG 561

Query: 374 RELLESFDKITDKIQE 389
            E+ ++F  I   I++
Sbjct: 562 LEISDAFASIASAIRQ 577



 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 55/373 (14%), Positives = 117/373 (31%), Gaps = 72/373 (19%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           +I+ + F+     +D+  +   R ++Q  LD AVL+     +      +           
Sbjct: 41  MIVVLMFMIGGLGMDMVRLERDRTKLQYTLDRAVLAAAD--LDQPLDPEAVVLD------ 92

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQ----INITKDKNNPLQYIAESKAQYEIPTENLF 119
                  ++ +          + + +     +  + D N    ++  +   Y+    N  
Sbjct: 93  -------YMSKSGLGDYTTVVVPEVSPTAKRVKASVDTNFTASWM--NNVFYDDYIRNPD 143

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM------------EDLYLQK 167
              L P     L L ++     S  N+ IS  +VLDVS SM               ++Q 
Sbjct: 144 TYQLEP---ITLPLLASSTAVESIGNVEIS--LVLDVSGSMRSNDRLVNLKRAAKEFVQT 198

Query: 168 HNDNN-----NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL-- 220
            +DN      +++   Y       ++F  +    S++  +        D           
Sbjct: 199 MDDNTEDGKMSISIVPYSTQVSMPEAFLDELNVSSEHDYSHCINFSGSDFNNAGISTTQA 258

Query: 221 ------VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
                            +   VR  T A +          LS+N+ ++++ ++   P EN
Sbjct: 259 YERTMHFTVWNSGDYRSRTRLVRQPTCAAHSDNPERTALLLSDNVTQLQNYIDAFVPSEN 318

Query: 275 TNTYPAMHHAY---------------------RELYNEKESSHNTIGSTRLKKFVIFITD 313
           T+    M                         + + +   +       T   K ++ +TD
Sbjct: 319 TSIDLGMKWGSALLDPSVQPVIASLADDANPNQSIASRFANRPVPYTDTETLKVIVMMTD 378

Query: 314 GENSGASAYQNTL 326
           G+N+     +N+ 
Sbjct: 379 GQNTSQYYLRNSY 391


>gi|90418244|ref|ZP_01226156.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337916|gb|EAS51567.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 489

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 72/489 (14%), Positives = 142/489 (29%), Gaps = 130/489 (26%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++    +    AIDL     +R+ +Q  LD  VL+  +            T+    
Sbjct: 26  MTALMLVPMIVISGGAIDLIAHERLRSVLQDGLDRGVLAAASL-----------TQTRPP 74

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +  +K  + +GSY  +   D    A+                 +A     T+  FL
Sbjct: 75  RETIESFLKAAVTKGSYALDVKADELSNAK---------------RVEASATAVTDTAFL 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAI----SICMVLDVSRS----------------- 159
           + LI      +   +    +R +  +++    S  M  D S S                 
Sbjct: 120 R-LIGIDKLTVEAHAEAEEKRKNIEISLLLDMSGSMRFDKSGSYPGPSGAMRINYLRPAA 178

Query: 160 ---MEDLYLQKHNDNNNMTSNKYL-----------------LPPPPKKSFWSKNTTKSKY 199
              M+ +      D   ++   Y                          F       +  
Sbjct: 179 KSFMDMVLADGAEDYTTVSIVPYAGQVSIGPVLFDALARNRRQHDRSSCFQFGRNDFTLG 238

Query: 200 APAPAPA--------NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI-AYNIGIVGN 250
            P  A              D L ++    +        +  +   R GT   +  G   +
Sbjct: 239 VPDFANLPQTQHFTQANHHDALKKAGEAQITEPWWCPDDPHDP--RPGTTPDFVAGEGKD 296

Query: 251 Q----CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA-----------------YRELY 289
                 + LSN+   +K +++    Y+ T T  A+                    YR L 
Sbjct: 297 TDRTSVSFLSNDREYLKRQIDNYKLYDGTGTPIALKWGLLLLDPAIQPMLREAARYRALS 356

Query: 290 NEKESSHNTIG------STRLKKFVIFITDGE-----------------NSGA------S 320
            E +                  KF++ +TDG                  N+G+      S
Sbjct: 357 EELDIDARFSNRPASFTDPDTMKFLVLMTDGAISSQRIPKDASKPVQYYNNGSLNTDLYS 416

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
                     +C   +   + ++++           +  C   + +F+ V ++ ++ ++F
Sbjct: 417 VGDAERFAAALCTAAKQKNVIVFTIGFDVNDTAAKQMSNCASGAERFYRV-NALDIQDAF 475

Query: 381 DKITDKIQE 389
             I   IQ+
Sbjct: 476 KSIATAIQK 484


>gi|284046349|ref|YP_003396689.1| von Willebrand factor A [Conexibacter woesei DSM 14684]
 gi|283950570|gb|ADB53314.1| von Willebrand factor type A [Conexibacter woesei DSM 14684]
          Length = 319

 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 87/261 (33%), Gaps = 80/261 (30%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
           SI +V DVS SM    +Q +                                        
Sbjct: 87  SIALVTDVSGSMLATDVQPN---------------------------------------- 106

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++     +A   V+ + +        +V +G I++N      Q    + N ++V + +++
Sbjct: 107 RMIAAKRAARRFVDEVPR--------TVNLGVISFNNTATVLQSP--TRNRSDVLTAIDR 156

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L     T T  A+  A   L N+   +     S      ++ I+DG ++      N  + 
Sbjct: 157 LAVSGGTATGEAIATATEMLRNQPGENGRRPPSA-----IVLISDGTST------NGRDP 205

Query: 329 LQICEYMRNAGMKIYSVAVS-------------------APPEGQDLLRKCTDSSGQFFA 369
           ++     R   + IY+VA                      PP+   L +    + G+ F 
Sbjct: 206 IEAAAEARRLRIPIYTVAFGTDQGTITVPGRDGVERTERVPPDPTALAQIAEMTGGETFT 265

Query: 370 VNDSRELLESFDKITDKIQEQ 390
            + +  L   F+++  ++  +
Sbjct: 266 ADSADRLDTVFERLGSQLGTR 286


>gi|260461186|ref|ZP_05809435.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033220|gb|EEW34482.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 523

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 59/172 (34%), Gaps = 33/172 (19%)

Query: 251 QCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKF 307
              PL+ +L+++++   ++       TN    +    R L      +      +    K 
Sbjct: 347 PVVPLTADLDKLRTAAAQMQEWNGSGTNVSEGLSWGMRVLSPAPPYTDGAPWKTPNTSKI 406

Query: 308 VIFITDGENSGASAYQNTLN-----------------------------TLQICEYMRNA 338
           V+ +TDGEN    A                                   TL +C+ ++  
Sbjct: 407 VVLLTDGENVVYGASAEPEKSDYTSYGYLSSGRFGTSNQTDAARSVDRWTLDVCDKLKAQ 466

Query: 339 GMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            ++IY++ + +       L  KC  +   ++AVND  +L   F  I  K   
Sbjct: 467 QVQIYTITLQSDTAANRTLYGKCATNPADYYAVNDPSKLPNVFQTIAGKFTT 518



 Score = 44.1 bits (102), Expect = 0.044,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 72/173 (41%), Gaps = 27/173 (15%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
           + +A D++ +M  +  +Q++LDAA LS  +S +SD    D   ++      F+  +  H 
Sbjct: 29  VGFAADVSSVMRAKVNLQNSLDAATLS--SSHLSD----DEAARRLAFDGYFQANVANHP 82

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS 132
           +  +            A++ ++ DK        ++ A  ++   NL+   L      ++ 
Sbjct: 83  ELTN------------AKLTLSVDKGFNY-VKTKAIASADV---NLYFAFLFGDN-QHIE 125

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
           + + G+   ++    + + +VLD + SM    ++   D   +  +       P
Sbjct: 126 VDAGGVEATNN----LEVVLVLDNTGSMAGAKIKALRDATKVLLDNLDGAKSP 174


>gi|261251589|ref|ZP_05944163.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
 gi|260938462|gb|EEX94450.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
          Length = 396

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 62/398 (15%), Positives = 134/398 (33%), Gaps = 52/398 (13%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A++I +     +  + + + + + N+   A DAA L+   S   D T+        +   
Sbjct: 20  AMLIPMIIAAASTIV-IGYQVQLSNRGMQATDAASLACEFSGEYDGTMAQGYLDYYRPK- 77

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
                          I + +G I   +  N++      L Y   +       +  L    
Sbjct: 78  ---------------IDKVSGQIGTHSGCNVS------LSYSLSTI----FTSLTLSDAS 112

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-EDLYLQKHNDNNNMTSNKYLL 181
            + S+  N     T  +        + + +VLD+S SM  DL   K      + S K   
Sbjct: 113 FVVSSTANEKAYVTEDVASE----PLELILVLDISGSMASDLDDLKAILKRGLASLKEQQ 168

Query: 182 PPPPKKSF-------WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                K         +S   + +            ++ + ES G    S    +      
Sbjct: 169 NNALSKDHIKVSIVPFSDGVSVNNAPWLNETGTFCVEGITESGGKF--SAAHTVANLDIT 226

Query: 235 SVRIGTIAYN------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
             +     +            +   PL+ +LN+V + ++ L     T +Y  +    R+L
Sbjct: 227 HDQTPVKTFQPDKWLMDCSAMSVTLPLTADLNQVTNAVDSLRTEGGTASYQGLIWGLRQL 286

Query: 289 YNEKESSHNTIGSTRLKKF---VIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
               + +     +    K    ++ +TDG + G+   +  L    +C+  ++ G+ +  V
Sbjct: 287 TPNWQKAWEVGPNRNFDKVERKLVLMTDGADYGSHFDE--LINAGLCDRAKDYGVALNFV 344

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                    +   +C   +   F+ ++++EL   F ++
Sbjct: 345 GFGVYGARLEQFTRCAGDANGVFSASNTQELDSYFSQL 382


>gi|328541712|ref|YP_004301821.1| hypothetical protein SL003B_0088 [polymorphum gilvum SL003B-26A1]
 gi|326411464|gb|ADZ68527.1| hypothetical protein SL003B_0088 [Polymorphum gilvum SL003B-26A1]
          Length = 454

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 65/443 (14%), Positives = 131/443 (29%), Gaps = 74/443 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  +++++  +     +D    + +R  +  A         A +   R +        + 
Sbjct: 27  MVGVLVALMVVIGGAGLDYGRAIMLRASISHA------LDAAVLAVARQLSVSIMTDSEL 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               K     ++          GD+          D +        + A   +PT  + +
Sbjct: 81  DKAIKDAFAANMASAGLSGATLGDLT------YVLDPDAGT---ISATATALVPTYFIHV 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL P       +      + +     + + MV+DV+ SM +          ++      
Sbjct: 132 GGLGPEN-----VAIAASADATYSRFDVELAMVVDVTGSMRNSMASLRTAAQSVVDILIP 186

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  S                    K+        N V       +         GT
Sbjct: 187 DGTKKSASKVRIALVPYSQGVNLGEYAPKVSNGDAGTQNCVTERMGNEKYTDATYNYNGT 246

Query: 241 IA------YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE--- 291
            +       N      Q  PL++  N + S ++KL     T     +   +  L  +   
Sbjct: 247 SSEFFGGGSNSCASTPQMEPLTSKRNTLTSAISKLKDNGRTAGQTGIAWGWYALSPKWSN 306

Query: 292 ---KESSHNTIGSTRLKKFVIFITDGE------------NSGASAYQNTLNTLQICEY-- 334
               +S   +   + + KF + +TDG+            N       +T    Q+C+   
Sbjct: 307 LWPNDSVPGSYTDSDILKFALIMTDGDFNEYYDKATAQSNCKWQFNWSTFKWEQVCDSSY 366

Query: 335 -------------------------MRNAGMKIYSVAV--SAPPEGQDLLRKCTDSS-GQ 366
                                    ++  G+++YS+    +A   G  +++ C  S+   
Sbjct: 367 VWTAYSEAAGYSNVSSTRAKTLCAAIKQTGIQVYSIYFGSNANSAGAKVMKDCASSTKET 426

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           FF      EL+ +F KI +KIQ 
Sbjct: 427 FFMATSDSELIAAFAKIANKIQN 449


>gi|147921050|ref|YP_685140.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
 gi|110620536|emb|CAJ35814.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
          Length = 1310

 Score = 78.8 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 59/155 (38%), Gaps = 19/155 (12%)

Query: 236  VRIGTIAYNIGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
             ++G +++      N      N   N   VK+ +N L+    T+    +  A  EL    
Sbjct: 924  DQVGVVSFYTSASLNSALKQMNSGTNKTTVKNAINSLSASGGTDISSGIKKAIAEL---- 979

Query: 293  ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
              +H    +   K+++I +TDG +            L   +  +  G  I+++ +    E
Sbjct: 980  -DAHKRSTA---KQYIIVLTDGYSQYPEFD------LIEADKAKAKGYTIFTIGMGMADE 1029

Query: 353  GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
              D L+K       ++ V    +L  ++  I  +I
Sbjct: 1030 --DTLKKIASKPEYYYRVLSPEQLEAAYYDIGQEI 1062


>gi|90424817|ref|YP_533187.1| hypothetical protein RPC_3326 [Rhodopseudomonas palustris BisB18]
 gi|90106831|gb|ABD88868.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 479

 Score = 78.8 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 63/455 (13%), Positives = 145/455 (31%), Gaps = 64/455 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCA------------------ 42
           +  I +     F+  A+D +     R+ MQ A D+A L                      
Sbjct: 28  LFGIAVIPLISFVGVAVDYSRATAARSAMQGAADSATLMVSKDYAAGVIRASDIQATAEK 87

Query: 43  ---SIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
              ++ +   I + T     T+          +     +  +   +A    +  T    +
Sbjct: 88  YFKALYTSPGINNVTVTATYTARSANGSSTVVMNTSGSMPTSFLKVAGFTALPFTASSTS 147

Query: 100 PLQYI-AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM----VL 154
                        ++     +   L       + L +T     +S +  + I +    V+
Sbjct: 148 TWGATRLRVAMALDVTGSMDWDDKLTAMKTAAIKLVNTLK-ATASTDADVYISIIPFNVM 206

Query: 155 DVSRSMEDLYLQKHNDNN------NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN- 207
               +          D +      N T+           S+W+ + T      +   A  
Sbjct: 207 VNVGTANKDAEWLDWDTDYGSCKSNRTTQNSCQAAGETWSWWANSCTSRYTRKSTCVAGG 266

Query: 208 -----RKIDVLIESAGNLVNS----IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  +        +   S    + K        +      +Y+   +       + +
Sbjct: 267 ETWIPSGVSNWKGCVTDRTTSNDYDVIKTPPTTATPATLFLAKSYSACPLSLLPMKAAYS 326

Query: 259 LNE---------VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST-RLKKFV 308
            NE         +K ++NKL+   NTN    +  A+  L      +     +  +    +
Sbjct: 327 SNESDTSTAESTLKGKINKLDAEGNTNQPIGLFWAWMSLQTGVPLNTPAKDTEYKYTDAI 386

Query: 309 IFITDGENS--GASAYQNTLNTLQ--ICEYMRN---AGMKIYSVAVSAPPEGQ-DLLRKC 360
           I ++DG+N+  G S   + ++  Q  +C+ +++       I+++ V+   + +  +L+ C
Sbjct: 387 ILLSDGDNTQSGNSNSVSAIDARQKKLCDNIKDPLNGTTTIFTIQVNTDGDDESAVLKYC 446

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
               GQFF    + ++  +F  I   + +  +R+A
Sbjct: 447 ASD-GQFFQSTTADQIEIAFQSIGSSLTK--LRLA 478


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 97/321 (30%), Gaps = 73/321 (22%)

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
              +  N+G+  + +   ++      +     +     +P  +L     I          
Sbjct: 25  TEALAANSGNTVRVSIREVSTTSQPKIVMTLSANNSKGLPVTDLSADDFIVKE-NGKEQS 83

Query: 135 STGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNT 194
              +         I + + LD S SM D       D                        
Sbjct: 84  DIAVYPFYQNPDPIDVVLALDTSASMNDDAFTAAQD------------------------ 119

Query: 195 TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP 254
                                +A  L+N +        +   ++G I ++         P
Sbjct: 120 ---------------------AAYGLINGL--------SPEDKVGLITFD--KTARVIEP 148

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
           L+ +   V+  + KL+    T  Y  +  A +E+              +  K ++ +TDG
Sbjct: 149 LAQDHARVQESIQKLSRSVGTALYQGLSLAAQEVAK-----------GQNTKAIVLMTDG 197

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
            N+            +     +  G  +++V      + Q L +   ++ G++F+   + 
Sbjct: 198 FNTS-----RNTTLEEAVAKAQEVGASVFTVGFGKKVDTQGLQKIANETGGEYFSAPTNA 252

Query: 375 ELLESFDKITDKIQEQSVRIA 395
           +L   F  I+ K+  Q  R++
Sbjct: 253 QLRRVFADISQKL-HQEYRLS 272


>gi|262196446|ref|YP_003267655.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
 gi|262079793|gb|ACY15762.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
          Length = 903

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 54/263 (20%), Positives = 89/263 (33%), Gaps = 75/263 (28%)

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
             E+  E   ++I +V+D S SM  L                                  
Sbjct: 448 DSEKQREQPHVAIALVVDRSGSMSGL---------------------------------- 473

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY-NIGIVGNQCTPLS 256
                      KI+   ESA        +A  E  + S  I  +A+ N      +    S
Sbjct: 474 -----------KIEAAKESA--------RATAEVLSPSDLITVVAFDNQPTTIVRLQRAS 514

Query: 257 NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
           N +  + + + +L     TN YPA+  AY  L                 K VI ++DG+ 
Sbjct: 515 NRM-RIATDIARLQAGGGTNIYPALREAYEILQGANAK----------VKHVIVLSDGQA 563

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRE 375
                         +C+ MR+A + + +V +       +LL   TD   G+ +  +D   
Sbjct: 564 PYDGIAD-------LCQEMRSARITVSAVGIGDADR--NLLNLITDNGDGRLYMTDDLAA 614

Query: 376 LLESFDKITDKIQEQSVRIAPNR 398
           L   F K T + Q  ++  +P R
Sbjct: 615 LPRIFMKETTEAQRSALVESPVR 637


>gi|87310694|ref|ZP_01092822.1| BatA [Blastopirellula marina DSM 3645]
 gi|87286675|gb|EAQ78581.1| BatA [Blastopirellula marina DSM 3645]
          Length = 355

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 98/289 (33%), Gaps = 72/289 (24%)

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
           +  L+    G  +   EN  I+I MV+D S SM+ +  Q  ++                 
Sbjct: 65  IIALARPREGREQAIVENDGIAIEMVVDRSGSMQAMDFQLGDE----------------- 107

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
                                ++  + + AG+ V           +L   +G I +    
Sbjct: 108 ------------------HVDRLTAIKKVAGDFVTGGDNLDGRLSDL---VGLITFAGYA 146

Query: 248 VGNQCTPL--SNNLNEVK-SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
            G     L  +  ++++  S++      + T    A+  A  +L          I S   
Sbjct: 147 DGVTPPTLDHAFLVSQLNHSQIVTNRSEDGTAIGDAISLAVEKLNALDARRKEKIQS--- 203

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV----------------- 347
            K +I +TDGEN+        L  +Q  E  +  G+K+Y++ V                 
Sbjct: 204 -KIIILLTDGENNAG-----DLEPIQAAELAQTMGIKVYTIGVGTKGRAPMPVTDMFGRQ 257

Query: 348 -----SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                S   + + L +  + + G++F   D+  L + + +I    + + 
Sbjct: 258 SMQWMSVNIDEETLQKVASITGGKYFRATDTDSLAKIYGEIDQLEKTKV 306


>gi|254466920|ref|ZP_05080331.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687828|gb|EDZ48310.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 550

 Score = 78.4 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 55/345 (15%), Positives = 102/345 (29%), Gaps = 67/345 (19%)

Query: 9   CFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQI 68
                   +DL  +   R ++Q  LD AVL+            D     D  + +     
Sbjct: 45  MLAVGGIGVDLMRMERDRTELQYTLDRAVLAAA----------DLDQSLDADAVVLDYLT 94

Query: 69  KKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSAL 128
           K  L+Q                     D    L Y    +A  +   E   LK       
Sbjct: 95  KAGLEQYYSD----------------PDDQKGLGYK-SVEATIDTDFEAYLLKFAGGDN- 136

Query: 129 TNLSLRSTGIIERSSENLAISICMVLDVSRSME------DLYLQKHNDNNNMTSNKYLLP 182
               +             ++ I MVLD+S SM       +L     +    +TSN  +  
Sbjct: 137 ----MSLYANSRAEEIIGSVEISMVLDISGSMNSGNRLVNLQAAAKSFVTQITSNTDVSN 192

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG--- 239
                  ++      +   +      +          + +   K    +    +R     
Sbjct: 193 LSISIIPYATQVNAGEKLLSKYTKVSQEHDYSYCVNFIKDQFSKHTLNQNEDLIRTAHFD 252

Query: 240 TIAYNIGIV---------GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY----- 285
           T  Y++ ++         G+   P +N+  ++ + ++ L    NT+    M         
Sbjct: 253 TFTYSMNMIDRPVCPTRPGSAILPFTNDAAKLHAYIDSLTASGNTSIDIGMKWGSALLDP 312

Query: 286 ------RELYNEKESSHN------TIGSTRLKKFVIFITDGENSG 318
                   L ++K  S N        GS    K +I ++DG+N+ 
Sbjct: 313 TAQPVVNALVDDKVISENFRGRPKAYGSGDTLKIIILMSDGQNTN 357



 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
              +T  IC+  ++ G+ +YSV   AP  G  +L  C  S   FF V    E+ ++F  I
Sbjct: 481 KDQHTKTICDITKDQGVIVYSVGFEAPSAGIKVLEDCASSPAHFFDVE-GLEISDAFSSI 539

Query: 384 TDKIQE 389
              I++
Sbjct: 540 ATSIRQ 545


>gi|16124454|ref|NP_419018.1| hypothetical protein CC_0199 [Caulobacter crescentus CB15]
 gi|221233138|ref|YP_002515574.1| hypothetical protein CCNA_00199 [Caulobacter crescentus NA1000]
 gi|13421322|gb|AAK22186.1| hypothetical protein CC_0199 [Caulobacter crescentus CB15]
 gi|220962310|gb|ACL93666.1| hypothetical protein CCNA_00199 [Caulobacter crescentus NA1000]
          Length = 626

 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/346 (12%), Positives = 98/346 (28%), Gaps = 45/346 (13%)

Query: 92  NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
            +T+   + +   + + +     T    ++  + S    +   ST     + + +  +  
Sbjct: 279 RVTRSDPDKVSLNSTNTSSASNYTNGGTIQKCLTSTCQVVITTSTSHGFTTGDEIRFAGM 338

Query: 152 MVLD----VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN 207
             L      +R++  L     + +     +             S      K         
Sbjct: 339 SGLTSLNGTTRTITVLTNTTFDSSLTGPGSSTYSSGGTATCEESTVPGCEKIRFTNVDGY 398

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSV----RIGTIAYNIGIVGNQCTPLSNNLNEVK 263
            +++     A   + S            V         + +        TPLS +   +K
Sbjct: 399 ERVNSQSTCATERIGSQAYTDAAPSTAYVGSHYPTAGSSSSTVCPTATITPLSTDKTALK 458

Query: 264 SRLNKLNPYENTNTYPAMHHAYRE-------LYNEKESSHNTIGSTRLKKFVIFITDG-- 314
           +++N L     T     +   +         L+           +  L K VI +TDG  
Sbjct: 459 AQINGLTVGGATAGQIGLAWGWYMVAPNFGYLWPNASQRPAAYKARDLMKVVILMTDGGF 518

Query: 315 ------------------------ENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVS 348
                                    N  A+   +     ++C+ ++     + +Y+V  +
Sbjct: 519 NMTYCNSVVARNIGSGTNIGDDERINCDATNGSSFDQAAELCDSIKASANDITLYTVGFT 578

Query: 349 A--PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                  ++ L  C  S+ + +      EL  SF  I  +I    +
Sbjct: 579 VGNDQTARNFLTNCASSTDKAYFPATGSELKASFQAIAQEISNLRI 624



 Score = 38.3 bits (87), Expect = 2.4,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 47/147 (31%), Gaps = 27/147 (18%)

Query: 16  AIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQG 75
            +D+  +   R QMQ ALDAA L    S  +     D T      + I    +       
Sbjct: 48  LLDVGRLSLQRRQMQDALDAATLMAARSTATSSADLDTTGDAAFLAEIAGMNLGLTASSS 107

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
           ++       +                           I T    L+ +I +   + +   
Sbjct: 108 TFSAGTNNRV---------------------------IGTATATLRPIIANLWQSGNFTV 140

Query: 136 TGIIERSSENLAISICMVLDVSRSMED 162
           T   E    +  + I +VLD++ SM +
Sbjct: 141 TASSEVVRASKNLEIALVLDITGSMGN 167


>gi|92117939|ref|YP_577668.1| hypothetical protein Nham_2418 [Nitrobacter hamburgensis X14]
 gi|91800833|gb|ABE63208.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 483

 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 62/463 (13%), Positives = 137/463 (29%), Gaps = 80/463 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     F+  A+D       R+ MQ+A+D+A L     +  D     P    DQ 
Sbjct: 28  IFAIALLPMLGFVGAAVDYTRANAARSSMQAAMDSAAL----MVAKDANAASPQMTADQV 83

Query: 61  STIFKKQIKK---------------------------HLKQGSYIRENAGDIAQKAQINI 93
           +   +K                                L     ++ +   +    QI+ 
Sbjct: 84  TAAAQKYFNALYHNTDAQGASVSAVYTPYNNGTPATVVLSGSGNVQTDFMKVVGFPQISF 143

Query: 94  ----TKDKNNPLQYI---AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
               T    N    +    +         + + +K      +  L   +T   +     +
Sbjct: 144 KTNSTATWGNTKLRVAMALDVTGSMSSAGKLVQMKIAAKKLIDTLKASATAEGDVYISII 203

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
             ++ + +    +  +       ++ +  ++               NT  S  A      
Sbjct: 204 PFNVMVNV---GANNNTASWLEWEDGSYDNSSSNYGSCSGSGKSKPNTKSSCIAAGKTWT 260

Query: 207 NRKIDVLIESAGNL-------VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS--- 256
            + I        +                 E    +     +A N     +   P++   
Sbjct: 261 PKNISSWKGCVTDRGPVSKPGSGDYDTTKDEPVASTPYTLYLARNYSTCPSSILPMTSAY 320

Query: 257 --------NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST-RLKKF 307
                    + + +K ++N L     TN   AM  A+  L               +    
Sbjct: 321 DSKESDSSTDDSTLKGKINNLVANGATNQAIAMQMAWMMLQPTAPFPAPAKDEKYKYTDA 380

Query: 308 VIFITDGENSGASAYQNT------LNTLQI--CEYMRNAGM---------KIYSVAVSAP 350
           +I ++DG N+    Y N       ++T Q   C  ++N  +         +IY++ V+  
Sbjct: 381 IILLSDGLNTQDRWYGNGSDWSSQVDTRQALLCNNIKNDPISKTDPTRRTRIYTIQVNTD 440

Query: 351 PEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + +  +L+ C      FF  + +  +  +F +I   + +  +
Sbjct: 441 GDPESTVLKNCATDG--FFPTSTASGIASAFAQIGASLSQLRI 481


>gi|312877126|ref|ZP_07737097.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796100|gb|EFR12458.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 900

 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 53/342 (15%), Positives = 102/342 (29%), Gaps = 73/342 (21%)

Query: 52  DPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY 111
           D          + K      +   +  REN  D    A     KD    L  I    +  
Sbjct: 319 DVVKSDQANFGLDKLLGYSFVILCNVSRENFSDNFLNAVEKYVKDLGGGLIVIGGVNSYA 378

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
                N  L+ ++P             ++   +   I + +VLD S SM D         
Sbjct: 379 LGNYSNSVLEKMLPVK---------MELKNKEKEKNIDVVLVLDHSGSMADTEDA----- 424

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
                                                K+++   ++  +V  ++ +    
Sbjct: 425 ----------------------------------GIPKLEIAKSASAKMVEHLESSDG-- 448

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
                 +G IA++                +V   ++ +     T   P +  A + L   
Sbjct: 449 ------VGVIAFDHNYYWAYKFGKLVRKEDVIESISSIEVGGGTAIIPPLSEAVKTL--- 499

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
                    S    K V+ +TDG        Q+        +  +   +KI ++ V    
Sbjct: 500 -------KKSKAKNKLVVLLTDG-----MGEQSGYEIPA--DEAKRNNIKITTIGVGKFV 545

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
               L      +SG+F+ V++  EL++ F K T  I+ + ++
Sbjct: 546 NASVLSWIADYTSGRFYLVSNPSELVDVFLKETKIIKGKYIK 587


>gi|295691296|ref|YP_003594989.1| TadE family protein [Caulobacter segnis ATCC 21756]
 gi|295433199|gb|ADG12371.1| TadE family protein [Caulobacter segnis ATCC 21756]
          Length = 531

 Score = 78.0 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 59/184 (32%), Gaps = 36/184 (19%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE-------LYNEKESSHN 297
                   TPLS++   +K ++N L+   +T         +         L+        
Sbjct: 346 NPCPTATITPLSSDRVTLKGQINALSIGGSTAGQIGFAWGWYMVSPNFGYLWPNATQRPA 405

Query: 298 TIGSTRLKKFVIFITDGE-------------------------NSGASAYQNTLNTLQIC 332
              S  L K V+ +TDG                          N  A+       T ++C
Sbjct: 406 PYNSKDLVKVVVLMTDGAFNTPYCKGVIAKDAGSGSGAVDDHINCVATNGDAFTQTRKLC 465

Query: 333 EYMRNAGMK--IYSVAVSAPPEGQD--LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           + M++  +K  I++V      +     +L+ C   +   +      EL  +F  I  +I 
Sbjct: 466 DAMKDPSLKLTIFTVGFDVGGDANAVNMLKYCATDAQHVYFPATGSELKTAFKSIAQEIS 525

Query: 389 EQSV 392
              +
Sbjct: 526 SLRI 529



 Score = 49.9 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 61/371 (16%), Positives = 113/371 (30%), Gaps = 76/371 (20%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL-SGCASIVSDRTIKDPTTKKDQTST 62
           + I +  L     IDL  I   R+QMQ ALDAA L +  ++ V+D  ++           
Sbjct: 26  LAIPMSILVFAL-IDLGRISLQRHQMQDALDAATLMAARSTAVTDAELESV--------- 75

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
                        +++ E AG     +  N +         I  + A  +    NL    
Sbjct: 76  ----------GDPAFLAEIAGLNLGLSASNASFKAGAGNHIIGTATATVKPIIANL---- 121

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
                  + +L +T  + RSS+N  + + +VLD++ SM    +       +   +  +  
Sbjct: 122 ---WTTDDFNLTATSDVVRSSKN--LEVAVVLDITGSMSGSRITDLKTGASDLVDIVVKD 176

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                                AP   K+ ++  S G  V +   A++         G   
Sbjct: 177 QQ-------------------APFYSKVAIVPYSVGVNVGTYADAVRGAVIARTITGVSK 217

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGS 301
            N  +V +             S ++       NT         Y       +S      +
Sbjct: 218 TNAAVVASAAHGFIVGDKVTISGVSGPTMLNGNT---------YNITAASADSFTINANT 268

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT 361
           +   K+V                    +  C+   N G   ++   ++  +    L  C 
Sbjct: 269 SNAPKYV-----------------SGGVATCDTSTNPGCLNFTFTSASNTKETRTLSTCV 311

Query: 362 DSSGQFFAVND 372
                 +A  D
Sbjct: 312 TERTGTYAYTD 322


>gi|145299821|ref|YP_001142662.1| flp pilus assembly protein FlpL [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866595|gb|ABD57363.1| FlpL [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852593|gb|ABO90914.1| putative flp pilus assembly protein FlpL [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 460

 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 50/142 (35%), Gaps = 23/142 (16%)

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESS--------HNTIGSTRLKKFVIFITDG 314
           +  L+ L    NTNT   +   +R L  + +              G    +K ++  +DG
Sbjct: 325 RQALDTLYAAFNTNTAEGVMWGWRLLSPQWQGRWGQGAAELPRPYGQADNRKIMVLFSDG 384

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           E+ G  A       L +C  M+  G+++Y+VA          + +C              
Sbjct: 385 EHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFEGDAR---FVAQCASDRSH-------- 433

Query: 375 ELLESFDKITDKIQEQSVRIAP 396
               ++   +  I+    R+A 
Sbjct: 434 ----AYKATSGNIRTVLTRLAS 451


>gi|299135165|ref|ZP_07028356.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298590142|gb|EFI50346.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 601

 Score = 77.6 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 69/161 (42%), Gaps = 15/161 (9%)

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL--YNEKESSHNTIGSTRL 304
            +    TP+SN  + +KS++N + P  NTN    +   ++ L   N+   +     +   
Sbjct: 439 CLPATITPMSNQWSTLKSQINAMTPSGNTNQAVGLFWGWQTLNTTNDPFKAPAKDPNWVY 498

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQ----ICEYMRN------AGMKIYSVAVSAPPEGQ 354
           K +++ ++DG N+     Q   +       +C+ +++        + ++S+ V+   +  
Sbjct: 499 KDYIVLLSDGLNTQNRWTQTVSDIDARQELLCKNIKDPAQNGGNQITVFSIQVNISSKDP 558

Query: 355 D--LLRKCTDSSGQFFA-VNDSRELLESFDKITDKIQEQSV 392
              +L+ C      +F  +  S +  ++F+ +   I +  +
Sbjct: 559 TSKVLQDCATPGAGYFQMITQSSQTADAFNNVLATIAKLRI 599



 Score = 45.3 bits (105), Expect = 0.016,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 57/188 (30%), Gaps = 22/188 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+       +  A+D    +  R  +QSALD+A L          +    T    Q 
Sbjct: 27  IFAIVSIPLVALVGAAVDYTRAVSDRTALQSALDSAALM--------ISKDAATMSASQI 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T  ++ +           +N            T   N+         A   +PT   + 
Sbjct: 79  TTRARQYVDSLYTATDAPIQNFTA---------TYTPNSGSGASILLSANGTMPT---YF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++ S    L + ++   +  S    + + +VLD + SM          +        L
Sbjct: 127 MRVLGSNFNTLPVATSSTTKWGSTR--MRVALVLDNTGSMAQNGKMAALQSAATDMITKL 184

Query: 181 LPPPPKKS 188
                   
Sbjct: 185 SAFNTTTG 192


>gi|226314609|ref|YP_002774505.1| hypothetical protein BBR47_50240 [Brevibacillus brevis NBRC 100599]
 gi|226097559|dbj|BAH46001.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 947

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 52/364 (14%), Positives = 116/364 (31%), Gaps = 79/364 (21%)

Query: 30  QSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKA 89
           Q+     V      +V++     P    +    +    IK  L+  + + +      Q A
Sbjct: 281 QATAYTQVAGAPVVLVAEGH---PGAASNLIQALEAGNIKVELRDLALLPKELEGYKQFA 337

Query: 90  QI--------NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS--LRSTGII 139
            I        ++T      ++          I T      G+     T +   L     +
Sbjct: 338 SIVLADVPATSMTDADMERMRTAVRDLGIGLIMTGGKDSFGMGGWFQTPIEEALPVHMDL 397

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
           +   +  ++ + +V+D S SM                                       
Sbjct: 398 KGKEQLPSLGLQLVIDKSGSMS-------------------------------------- 419

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
             + A    K+ +  E+A      I+            IG IA++              L
Sbjct: 420 --SDARGADKMALAREAA------IRATTMMNAQDY--IGVIAFDDTPWDVVAPQSVTKL 469

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
           +E++ +++++     T+ +PA+   Y  +                +K VI +TDG+++  
Sbjct: 470 DEIQQQISRIQADGGTDIFPALQLGYERV----------KAMNTQRKHVILLTDGQSALD 519

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
                  +   + + M    + + +VA+    + + LL    +   G+++  ND+  + +
Sbjct: 520 D------DYEGLLQQMTAENITVSTVALGDDSD-RGLLEMIAELGKGRYYFANDAESIPK 572

Query: 379 SFDK 382
            F K
Sbjct: 573 IFSK 576


>gi|171742038|ref|ZP_02917845.1| hypothetical protein BIFDEN_01142 [Bifidobacterium dentium ATCC
           27678]
 gi|283456833|ref|YP_003361397.1| hypothetical protein BDP_2000 [Bifidobacterium dentium Bd1]
 gi|171277652|gb|EDT45313.1| hypothetical protein BIFDEN_01142 [Bifidobacterium dentium ATCC
           27678]
 gi|283103467|gb|ADB10573.1| Conserved hypothetical protein containing a von Willebrand factor
           type A (vWA) domain [Bifidobacterium dentium Bd1]
          Length = 967

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 67/409 (16%), Positives = 132/409 (32%), Gaps = 67/409 (16%)

Query: 24  YIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAG 83
               Q   + D  V+       +       T  +  T T     +++ ++      ++A 
Sbjct: 111 QSEEQKAGSADEPVIELATPSEAQPATASATPTQKPTGTENPTTVERSVQSD---DDDAD 167

Query: 84  DIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG------ 137
            +A + +    + KNN  + +    A Y    ++       P    ++  +  G      
Sbjct: 168 TVANQNEAKDDETKNNADKTVRLGIASYRGMLKSASSGLSTPEHTKSIEYQGNGAYILKL 227

Query: 138 ------IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
                     +++   I I +VLDVS SM D +                 P        +
Sbjct: 228 NVIGKDASTSTTDTTPIDIALVLDVSGSMNDDF------------GGRGSPSKISALKTA 275

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI-GIVGN 250
            N+   + A          D +  +     N I  A         RI     +  G    
Sbjct: 276 VNSFLDETAKTNDTIEDDNDKVKVALVKYANQIGTAT---GADGCRISNSRQSDTGNCTQ 332

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
               L+ +   +K+ +N L     T    AM  A + L   +  +         KK+VIF
Sbjct: 333 IVQELTTDAGLLKTSVNGLQAAGATYADAAMEVAQQALAGGRAGA---------KKYVIF 383

Query: 311 ITDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVAV----------SAPPEGQDLLR 358
            TDGE +  S +   +    ++  + ++NAG  +YS+ +          S+       + 
Sbjct: 384 FTDGEPNHWSGFDGDVANAAIKKSQELKNAGTTVYSIGIFDGANPSASVSSASNANKFMH 443

Query: 359 KCTD---------------SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             +                S   +++ + + +L + F+ I   I E+ V
Sbjct: 444 GISSNYPNATGYWNLGDRASGDYYYSASSATQLAQIFNDIQKTITEKHV 492


>gi|254504856|ref|ZP_05117007.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
 gi|222440927|gb|EEE47606.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
          Length = 455

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 60/470 (12%), Positives = 154/470 (32%), Gaps = 106/470 (22%)

Query: 1   MTAI-IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           +TA+  + +  + I  ++D+  +   + ++QS LD+A L+  + + +   I+D       
Sbjct: 12  LTALAFVPLMLITIG-SLDVVRMTTAQAKLQSTLDSATLAAAS-LSNTADIEDTV----- 64

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                         Q +          +    ++T D  N       +    E+    L 
Sbjct: 65  ----------DEYIQANLPDTAPWTTLKLTMGDVT-DSLNAKSVEITATVDIEMTILKL- 112

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
                 + +   S+ ++ + +++++N+ +S+  VLD+S SM    +    +      +  
Sbjct: 113 ------AGIDKTSVLASSVAQQAAQNIEVSV--VLDISSSMGGSKITSLREAAKGFIDTM 164

Query: 180 LLPPPPKK-------------------SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
           L     K+                     ++ N++      +P+ AN  ++  +     +
Sbjct: 165 LKEDEDKEYTSLSIIPFGGTVNIGDFYDTYAVNSSTPGVIDSPSSANYYVNKNVPYGKFM 224

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL-----------------SNNLNEVK 263
            ++ ++   E  +    +  I  N        T                   SNN  ++K
Sbjct: 225 FSTEREGCIEYTDDDFDMAAIPANSRPQVPDFTKWVATNPWCPSEDSAMVLNSNNTTDLK 284

Query: 264 SRLNKLNPYENTNTYPAMHHAYR--------ELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + ++ ++  + T          +        +L  +              K  + +TDG 
Sbjct: 285 ALIDDMDLSDGTGMDIGALWGAKVLSGSMRGQLGGDFSDRPADFNDEDTLKVAVIMTDGA 344

Query: 316 ------------------------------NSGASAYQNTLNTLQ-ICEYMRNAGMKIYS 344
                                         N+ ++   + +   + +CEY+ +  +++Y+
Sbjct: 345 ITAQFRPRDYTTTGKIKNKTQQTIVSKGNINTASTKADDAVAYFKRVCEYLNDNNVQVYT 404

Query: 345 VAVSAPPEG--QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +            LL+ C  S   ++ V     + ++F+ I   +    V
Sbjct: 405 IGFQINSGSLPDQLLKYCASSLSNYYFVE-GLNIEDAFNAIASAVNNLRV 453


>gi|312126757|ref|YP_003991631.1| hypothetical protein Calhy_0520 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776776|gb|ADQ06262.1| protein of unknown function DUF1355 [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 909

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 83/261 (31%), Gaps = 64/261 (24%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
           L     ++   +   +++ +V+D S SM +  L   N                       
Sbjct: 391 LPVKMQLKNKEKERNVAVVLVIDHSGSMGESNLGNIN----------------------- 427

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                           K+++   +A  +++ ++ +          +G IA++        
Sbjct: 428 ----------------KLEIAKSAAAKMIDHLESSDS--------VGVIAFDHNFYWASK 463

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
                + NEV   ++ +     T   P +  A   L            S    K ++ +T
Sbjct: 464 FGKLKSKNEVIENISGIQIGGGTAIIPPLTEAVNTL----------RKSKAKDKVIVLLT 513

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           D        Y             +   +KI ++ V +      L      +SG+F+ V D
Sbjct: 514 D-------GYGEEGGYEYPASIAKRNNIKITTIGVGSSINAPILSWMAAYTSGRFYYVKD 566

Query: 373 SRELLESFDKITDKIQEQSVR 393
           +  L++ F K    I+ + ++
Sbjct: 567 ASNLIDVFLKEAKIIKGKYIK 587


>gi|225028486|ref|ZP_03717678.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
 gi|224954191|gb|EEG35400.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
          Length = 538

 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 77/188 (40%), Gaps = 28/188 (14%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D   ++A   V+SI        N +  IG ++Y+        + + +N   +K+ +  L
Sbjct: 242 LDETKKAAAKFVDSI-------LNKNSNIGLVSYSDEAT--SLSGICSNDVFLKNTITSL 292

Query: 270 NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL 329
           +  ENTN    +  AY  L                KK ++ ++DG     +  ++    +
Sbjct: 293 SSAENTNIEDGLSRAYSMLQL----------GQSKKKLIVLMSDGL---PTLGKDGEELI 339

Query: 330 QICEYMRNAGMKIYSVAVSAP-----PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +  E +++ G+ IY++           EGQ L+ K       +  V+ S +L+  F+ + 
Sbjct: 340 KYAEKIKDQGVLIYTLGFFQNTEEYKAEGQYLMEKIASEGCHY-EVSSSEDLVFFFEDVA 398

Query: 385 DKIQEQSV 392
            +I  Q  
Sbjct: 399 GQIGGQKY 406


>gi|89055932|ref|YP_511383.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
 gi|88865481|gb|ABD56358.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
          Length = 612

 Score = 77.3 bits (188), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 14/107 (13%)

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKI 342
           Y +L      SHN         ++ + +DG        Q+  +T  + IC+    AG+ +
Sbjct: 513 YNQLAENP--SHN---------YIGWDSDGVRPDGVVGQSQADTNLMAICDVANAAGIIV 561

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           Y++   AP  GQ ++  C      +F V   RE+ E+F  I   I +
Sbjct: 562 YAIGFEAPDRGQRVMEHCASVDANYFDVE-GREISEAFASIARSINQ 607



 Score = 58.8 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 48/376 (12%), Positives = 102/376 (27%), Gaps = 81/376 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
              ++  +       AID+      R+Q+Q  LD AVL+  +  ++     +   +    
Sbjct: 55  FATMLFILMVGASGIAIDVMRYETQRSQLQYTLDRAVLAAAS--LTQPYDPEGVVRD--- 109

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  I  +                +  + + +  N          A  E+   ++F+
Sbjct: 110 -YFAIAGIDGY----------------RLDVRVEEGLNFR-----RVHAYAELEVRSIFM 147

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           +     A     + S  I         I + MVLD+S SM +     +           +
Sbjct: 148 QMFGVRA-----MTSPAIGAAEERVRRIEVSMVLDISGSMGENNRMTNMRPAAREFVTEV 202

Query: 181 LPPPPKKSF---------------------WSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           L      +                       S  T    ++ +      + D    +   
Sbjct: 203 LSANENVNNELLVSVSIVPYNGRVNGGDLIESVFTYDDLHSESNCTRFAEADFTSTAIDP 262

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN--EVKSRLNKLNPYENTNT 277
            V   + A  ++ N      +  +           L        + + ++ LN    T  
Sbjct: 263 AVPLQRIAHWDRGNEE-EDESFQWAHCQTDQYGAILPWQHTEAALHAHIDSLNTGGWTAI 321

Query: 278 YPAMHHAYREL---YNEKESSHNTIGSTRLK----------------------KFVIFIT 312
              M+ A   L        +     G    +                      K V+ +T
Sbjct: 322 DLGMNWAVGLLDPAAAPALTGLIASGHVHPEFSDRPAPYRDGDRATTIDDETIKVVVLMT 381

Query: 313 DGENSGASAYQNTLNT 328
           DG+N+     ++  ++
Sbjct: 382 DGDNTRQYDLRDIYDS 397


>gi|56696619|ref|YP_166980.1| hypothetical protein SPO1742 [Ruegeria pomeroyi DSS-3]
 gi|56678356|gb|AAV95022.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 558

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
            +   A      T  +C+  ++ G+ +Y+V   AP  G+ +L++C  S   ++   D  E
Sbjct: 481 MTHKEASAKDQRTDHVCDAAKDEGIIVYTVGFEAPYSGRRVLKRCASSDSHYYDA-DGLE 539

Query: 376 LLESFDKITDKIQE 389
           + ++F  I   I++
Sbjct: 540 ISDAFTSIASSIRK 553



 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 46/352 (13%), Positives = 97/352 (27%), Gaps = 66/352 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   +           +DL      R  +Q  +D AVL+                     
Sbjct: 38  MALFLFLALVGAAGIGVDLMRYEQKRAALQYTMDRAVLAAA---------------DLDQ 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +  ++ +L++   +   +         ++T  +    +    + A  E+PT     
Sbjct: 83  QVSPETVVRSYLEKAGLLEYLS---------SVTVQEGLGYR-KVSATATAELPTH---F 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L       +   ST           + I +VLDVS SM       +  N       ++
Sbjct: 130 MKLSGYDSLTIPAASTAEESI----GNVEISLVLDVSGSMNSNSRLYNLKNAAKEFVDHM 185

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES--------AGNLVNSIQKAIQEKK 232
           L      +        +    A A      +V  E           +  +    +     
Sbjct: 186 LSATEPGTVSISIVPYATQVNAGADILSYYNVSTEHNYSHCVNFIDDEFSQPGLSRVTPL 245

Query: 233 NLSVRIGTIAYNIGIV---------GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
             ++     +Y    +           +  P SN+   + + ++ L    NT+       
Sbjct: 246 ERTMHFDPFSYTKDPISTPVCPVRASTEILPFSNDQTVLNNYIDGLTGRGNTSIDIGTKW 305

Query: 284 AY-----------------RELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
                               ++    +   +   S  + K +I ++DGEN+ 
Sbjct: 306 GVVMLDPGTQSVISGLISDNKVPASFQGRPSAYDSGDVLKVLIVMSDGENTN 357


>gi|154486447|ref|ZP_02027854.1| hypothetical protein BIFADO_00261 [Bifidobacterium adolescentis
           L2-32]
 gi|154084310|gb|EDN83355.1| hypothetical protein BIFADO_00261 [Bifidobacterium adolescentis
           L2-32]
          Length = 882

 Score = 76.9 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 49/322 (15%), Positives = 105/322 (32%), Gaps = 57/322 (17%)

Query: 95  KDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVL 154
               N       +  +++   +N        S   N+ ++        +    I   +VL
Sbjct: 143 SVAQNETGSQLGAPEKHKRIKKNDN-----GSYTVNVDVKGAVNSTTVTTTQPIDFTLVL 197

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           DVS SM+D   +           + +                  +    A  N +    +
Sbjct: 198 DVSGSMDDPMSKTDRTRRLDALKEAV----------------KAFLDEAANTNTEAGSEL 241

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
              G +  +  K  +   ++  R G   YN        + L+ ++N +K++++KL     
Sbjct: 242 VHVGLVKFAGDKTDKIGDDMY-RSGGYTYN---YSQIVSNLTADMNGLKNKVSKLKAAGA 297

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQIC 332
           T      + A + + +    +         KK VIF  DG  + +S ++  +    ++  
Sbjct: 298 TRADNGFNRAVKVMGSASART-------DAKKVVIFFADGSPTSSSGFEGKVANKAVEAA 350

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRK------CTDS-----------------SGQFFA 369
           + +++ G  +YS+ + A      L            S                 +G + +
Sbjct: 351 KELKDGGAAVYSIGIFASANPSSLSSNENQFMHAVSSNFPKATKYNQLGEGNIEAGYYKS 410

Query: 370 VNDSRELLESFDKITDKIQEQS 391
             ++ EL   FD+I       S
Sbjct: 411 ATNASELNTIFDEIEKSETTTS 432


>gi|52843052|ref|YP_096851.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630163|gb|AAU28904.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 352

 Score = 76.9 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 94/296 (31%), Gaps = 84/296 (28%)

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHND 170
           I  + L L  ++   L  ++L     +   +       +I MVLD+S SME   +  H  
Sbjct: 61  ISAKTLLLIPVLVWVLLVIALSGPRWVGEPKPVAREGYNIMMVLDLSGSMEITDMLLH-- 118

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 ++ V+  +A   V         
Sbjct: 119 ---------------------------------GRPVSRLLVVKRAAEQFVE-------- 137

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
              +  RIG I +         TPL+ + + V  R++        + T+   A+  A + 
Sbjct: 138 -DRVGDRIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKR 194

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA- 346
           L +               + +I +TDG N+        L  L+  E  +  G+KIY++  
Sbjct: 195 LQDVPSKG----------RVIILLTDGANNSG-----VLAPLKAAELAKQDGIKIYTIGL 239

Query: 347 -----------------VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                            +SA  + + L +    + G++F   D   L   +  I  
Sbjct: 240 GSEADPRALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQ 295


>gi|54295680|ref|YP_128095.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|53755512|emb|CAH17011.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|307611729|emb|CBX01432.1| hypothetical protein LPW_31221 [Legionella pneumophila 130b]
          Length = 344

 Score = 76.9 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 94/296 (31%), Gaps = 84/296 (28%)

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHND 170
           I  + L L  ++   L  ++L     +   +       +I MVLD+S SME   +  H  
Sbjct: 53  ISAKTLLLIPVLVWVLLVIALSGPRWVGEPKPVAREGYNIMMVLDLSGSMEITDMLLH-- 110

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 ++ V+  +A   V         
Sbjct: 111 ---------------------------------GRPVSRLLVVKRAAEQFVE-------- 129

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
              +  RIG I +         TPL+ + + V  R++        + T+   A+  A + 
Sbjct: 130 -DRVGDRIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKR 186

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA- 346
           L +               + +I +TDG N+        L  L+  E  +  G+KIY++  
Sbjct: 187 LQDVPSKG----------RVIILLTDGANNSG-----VLAPLKAAELAKQDGIKIYTIGL 231

Query: 347 -----------------VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                            +SA  + + L +    + G++F   D   L   +  I  
Sbjct: 232 GSEADPRALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQ 287


>gi|91773457|ref|YP_566149.1| von Willebrand factor, type A [Methanococcoides burtonii DSM 6242]
 gi|91712472|gb|ABE52399.1| hypothetical protein with von Willebrand factor type A domain and
           Invasin domain [Methanococcoides burtonii DSM 6242]
          Length = 892

 Score = 76.9 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 40/269 (14%), Positives = 92/269 (34%), Gaps = 45/269 (16%)

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
            + N++   T   E      A +  ++LD S SM+  Y      +  +  ++        
Sbjct: 574 DIVNITTVITVEGELPVSRSAATSMLILDRSGSMDPDYYAGTALDIVLVLDRSGSMKFLG 633

Query: 187 KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
            +                P             NL+++              +G ++++  
Sbjct: 634 NA-------------PEQPLTDAKSAAKIFMENLLSN------------TEVGVVSFSST 668

Query: 247 IVGNQCTPLSNNLNE----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
              ++  P+S N++     + + ++ +     T    AM  A   L N +  +       
Sbjct: 669 STVDR-QPVSLNISGNKDLLHNAIDSMVADGGTAIGDAMADANNLLINGRPDA------- 720

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV--SAPPEGQDLLRKC 360
             KK +I +TDG     +   +  +            ++IYS+ +  S   +   L R  
Sbjct: 721 --KKIMIVLTDG----VATAGSDRDGSDAISTANLNNIRIYSIGLGSSEYIDEPMLKRIA 774

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +++ G ++      EL   ++ I+ +I +
Sbjct: 775 SETGGSYYNAPSGSELQTVYNTISKEISD 803


>gi|86147193|ref|ZP_01065509.1| TadG-like protein [Vibrio sp. MED222]
 gi|85835077|gb|EAQ53219.1| TadG-like protein [Vibrio sp. MED222]
          Length = 435

 Score = 76.9 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 60/453 (13%), Positives = 138/453 (30%), Gaps = 91/453 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I   F       D A  +  + +++ A +AAVL+  A               +Q 
Sbjct: 15  LFAIMIPALFGVFMLGSDGARALQTKARLEEASEAAVLAVSAK-------------DEQD 61

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++ I+ +L     +        +K   +   +     +       +Y +  + L  
Sbjct: 62  HQLAERYIQHYLYD---MDSILDIEVKKLGCDEIPECIAATERGEARYFEYRVAGQTLHK 118

Query: 121 KGLIPSALT-----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                + +      + ++  +    R      I I  ++D S SM D +    +   N  
Sbjct: 119 SWFPGNDVISGFGDSFNVTGSSKARRYQSQ-PIDITFIVDFSESMNDSWSGGRHSKLNDL 177

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
            +          ++                  R I+   +   NLV   Q+ +   +   
Sbjct: 178 KDIIEDVADELGAYNDLYPEHPHRVALTGFNRRTIN--KDKNDNLVVRDQRVVSR-EGEY 234

Query: 236 VRIGTIAYNIGIVGNQCTP-------------------LSNNLNEVKSRLNKLNPYENTN 276
            +  T+ +N  I                           + + +    ++ K      T 
Sbjct: 235 DKDDTVNFNKTIAQQFIVKGEASRVPNSDDDARFYDLYFTTDFSSFTKKVKKFKAGGGTA 294

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN-SGASAYQNTLNTLQICEYM 335
           +   +  A + + +  ++          K+ +I ++DGE+ +  +   N L +  +C  +
Sbjct: 295 SLQGIIRAGQIVTSMSKNQ---------KQLIIILSDGEDWNHYAGQTNKLVSKGMCSNI 345

Query: 336 RN-------------AGMKI---YSVAVSAPPE------------GQDL-----LRKCTD 362
            N               +++    S  +  P                +L     LR C  
Sbjct: 346 LNMVNGGKVSADNTHDDIEVIGGVSQGMMTPDGERMNARMAVIGFDYELNKNVGLRNCV- 404

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                +   +  ++L   +KI   I E+   +A
Sbjct: 405 GRDNVYKAENKEDIL---NKILGLITEEVGHLA 434


>gi|296108502|ref|YP_003620203.1| hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650404|gb|ADG26251.1| Hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 352

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 94/296 (31%), Gaps = 84/296 (28%)

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHND 170
           I  + L L  ++   L  ++L     +   +       +I MVLD+S SME   +  H  
Sbjct: 61  ISAKTLLLIPVLIWVLLVIALSGPRWVGEPKPVAREGYNIMMVLDLSGSMEITDMLLH-- 118

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 ++ V+  +A   V         
Sbjct: 119 ---------------------------------GRPVSRLLVVKRAAEQFVE-------- 137

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
              +  RIG I +         TPL+ + + V  R++        + T+   A+  A + 
Sbjct: 138 -DRVGDRIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKR 194

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA- 346
           L +               + +I +TDG N+        L  L+  E  +  G+KIY++  
Sbjct: 195 LQDVPSKG----------RVIILLTDGANNSG-----VLAPLKAAELAKQDGIKIYTIGL 239

Query: 347 -----------------VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                            +SA  + + L +    + G++F   D   L   +  I  
Sbjct: 240 GSEADPRALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQ 295


>gi|148361167|ref|YP_001252374.1| Von Willebrand factor type A (vWA) domain-containing protein
           [Legionella pneumophila str. Corby]
 gi|148282940|gb|ABQ57028.1| conserved hypothetical protein [Legionella pneumophila str. Corby]
          Length = 344

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 94/296 (31%), Gaps = 84/296 (28%)

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHND 170
           I  + L L  ++   L  ++L     +   +       +I MVLD+S SME   +  H  
Sbjct: 53  ISAKTLLLIPVLIWVLLVIALSGPRWVGEPKPVAREGYNIMMVLDLSGSMEITDMLLH-- 110

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 ++ V+  +A   V         
Sbjct: 111 ---------------------------------GRPVSRLLVVKRAAEQFVE-------- 129

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
              +  RIG I +         TPL+ + + V  R++        + T+   A+  A + 
Sbjct: 130 -DRVGDRIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKR 186

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA- 346
           L +               + +I +TDG N+        L  L+  E  +  G+KIY++  
Sbjct: 187 LQDVPSKG----------RVIILLTDGANNSG-----VLAPLKAAELAKQDGIKIYTIGL 231

Query: 347 -----------------VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                            +SA  + + L +    + G++F   D   L   +  I  
Sbjct: 232 GSEADPRALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQ 287


>gi|303240108|ref|ZP_07326629.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302592377|gb|EFL62104.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 323

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 76/195 (38%), Gaps = 45/195 (23%)

Query: 219 NLVNSIQKAIQEKKNL--SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE--- 273
           N +   +K IQ+  +   S RI  IA+          PL+ + N V+  L  ++      
Sbjct: 102 NRLEVARKTIQDFVDQRPSDRIALIAF--AGTAYTRVPLTLDHNVVRESLQDISFKSVNE 159

Query: 274 -NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T    A+      L            ST   K +I +TDG+N+  S   NT +TL   
Sbjct: 160 EGTAIGMAISVGLNRL----------KKSTSPSKIMILLTDGDNNAGSIDPNTASTL--- 206

Query: 333 EYMRNAGMKIYSVAVSAPPE---------------------GQDLLRKCT-DSSGQFFAV 370
              +++G+KIY++ V +                         +DLL+K    ++GQ++  
Sbjct: 207 --AKDSGIKIYTIGVGSDKTIIPGTNEFGQTVYQEYESGLLNEDLLKKIAETTNGQYYRA 264

Query: 371 NDSRELLESFDKITD 385
            DS  L + F  I  
Sbjct: 265 KDSNALSQVFANINK 279


>gi|218461471|ref|ZP_03501562.1| von Willebrand factor type A [Rhizobium etli Kim 5]
          Length = 459

 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 66/167 (39%), Gaps = 25/167 (14%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-----KESSHNTIGSTRLK 305
             TPL+ +   +KS +  L    +T     +   +  L  +      + S     S  + 
Sbjct: 293 PVTPLTGDFAYLKSVVKNLTSEGSTRLDAGVVAGWYTLSPKWQGVWGDQSSPAPVSDSVH 352

Query: 306 KFVIFITDGENSGASAYQNTLNTL------------------QICEYMRNAGMKIYSVAV 347
           K ++F+TDGE +      +  + +                    C  M+ +G++IY+++ 
Sbjct: 353 KVMVFMTDGEMNTKYDPNDKFDWICSQTQSSACNAFATAARQTACTAMKKSGIEIYTLSY 412

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           SA  +  + +R C  ++  FF       +   ++ I   I+  ++R+
Sbjct: 413 SADADVVN-IRNCATNTAHFFTA-SPATIKTVYETIAAAIRGDTLRL 457


>gi|329928736|ref|ZP_08282585.1| IPT/TIG domain protein [Paenibacillus sp. HGF5]
 gi|328937517|gb|EGG33935.1| IPT/TIG domain protein [Paenibacillus sp. HGF5]
          Length = 964

 Score = 76.5 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 74/187 (39%), Gaps = 29/187 (15%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
           + +I+    +A   ++ +            ++G + Y+  +      PL+ +    K  +
Sbjct: 84  DNRINAAKNAAKGFIDLMDMTK-------HQVGIVGYSS-VAETSSLPLTTDTAAAKQFI 135

Query: 267 NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
           + +     T T  A+  A   L + +  +         +  ++ +TDGE +      ++ 
Sbjct: 136 DPIVASGGTETGYAIDQAITLLSSHRPEA---------QPVIVIMTDGEAN------SSQ 180

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEG------QDLLRKCTDSSGQFFAVNDSRELLESF 380
             L+  +  ++AG+  Y++A+  P +        +LL++   ++     V  S  L E +
Sbjct: 181 AALERAQAAKDAGIVFYTIALLGPNDNPDTSAPNELLKQMATTNSHHHFVLGSTGLAEIY 240

Query: 381 DKITDKI 387
             I  +I
Sbjct: 241 AAIVAEI 247


>gi|311234271|gb|ADP87125.1| Protein of unknown function DUF2134, membrane [Desulfovibrio
           vulgaris RCH1]
          Length = 440

 Score = 76.5 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 92/288 (31%), Gaps = 44/288 (15%)

Query: 148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN 207
           + +  V+D S SM+   +Q+ N   +      +               + K    PA  +
Sbjct: 155 LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFRGK-VHLPAGVD 213

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCTPLSNNLNEVKS 264
              D    + G L  S       K +     G+   +  N      +   L+ +   + +
Sbjct: 214 GLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQGLTEDRETILT 273

Query: 265 RLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE------ 315
            ++K N       T     +      L  E   +     +  ++K +I +TDG+      
Sbjct: 274 AISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEG-SSAKDIRKVIIVLTDGDTEDGKC 332

Query: 316 ------NSGASAYQNT-----LNTLQICEY--------------MRNAGMKIYSVAVSAP 350
                 N   +AY        L+    CE                + AG++++++     
Sbjct: 333 GGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKAKEAGIEVFAIRFGDS 392

Query: 351 PE-GQDLLRKCTDSS----GQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 L++    S       ++    + ++ + F KI  ++  + +R
Sbjct: 393 DSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 440


>gi|146295744|ref|YP_001179515.1| von Willebrand factor, type A [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|145409320|gb|ABP66324.1| von Willebrand factor, type A [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 909

 Score = 76.5 bits (186), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 83/261 (31%), Gaps = 64/261 (24%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
           L     ++   +   +++ +V+D S SM    L+  N                       
Sbjct: 391 LPVKMQLKNKEKERNVAVVLVIDHSGSMGGSNLRNIN----------------------- 427

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                           K+++   +A  +++ ++ +          +G IA++        
Sbjct: 428 ----------------KLEIAKSAAAKMIDHLESSDS--------VGVIAFDHNFYWASK 463

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
                + NEV   ++ +     T   P +  A   L            S    K ++ +T
Sbjct: 464 FGKLKSKNEVIENISTIQVGGGTAIIPPLTEAVNLL----------KKSKAKDKVIVLLT 513

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           D        Y             +   +KI ++ V +      L      +SG+F+ V D
Sbjct: 514 D-------GYGEEGGYEYPASIAKRNNIKITTIGVGSSINAPILSWMAAYTSGRFYYVKD 566

Query: 373 SRELLESFDKITDKIQEQSVR 393
           +  L++ F K    I+ + ++
Sbjct: 567 ASNLIDVFLKEAKIIKGKYIK 587


>gi|126649837|ref|ZP_01722073.1| hypothetical protein BB14905_16605 [Bacillus sp. B14905]
 gi|126593556|gb|EAZ87501.1| hypothetical protein BB14905_16605 [Bacillus sp. B14905]
          Length = 865

 Score = 76.1 bits (185), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 55/352 (15%), Positives = 112/352 (31%), Gaps = 80/352 (22%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENA-GDIAQKAQINITKDKNNP 100
           A+ +  ++I       +        ++  +L+  + I +N  G +  +A++++ +     
Sbjct: 309 AAALGQQSIAYDIKSPESLPN----ELSSYLQYNAIIFDNVPGHLVGEAKMSVIEQAVKN 364

Query: 101 LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
                          EN F  G          L     I+   +  ++ + +VLD S SM
Sbjct: 365 FGVGFAMVG-----GENSFGLGGYFKTPIETLLPVEMEIKGKEQLPSLGLAIVLDRSGSM 419

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                                                           K+++  E+A   
Sbjct: 420 SG---------------------------------------------SKLELAKEAAARS 434

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
           V  ++            +G IA++        T   NN  E    +  + P   T  Y +
Sbjct: 435 VEMLRDEDT--------LGFIAFDDRPWEIIETGPLNNKEEAVDTILSVTPGGGTEIYGS 486

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +  AY  L + K            +K +I +TDG++          N   + E  ++ G+
Sbjct: 487 LAKAYENLADIKLQ----------RKHIILLTDGQSQPG-------NYEDLIEQGKDNGI 529

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + +VA+    +   L       SG+F+ V D + +     + T  I    +
Sbjct: 530 TLSTVAIGQDADANLLEALSEMGSGRFYNVIDEQTIPSILSRETAMISRTYI 581


>gi|291547618|emb|CBL20726.1| fibro-slime domain [Ruminococcus sp. SR1/5]
          Length = 1928

 Score = 76.1 bits (185), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 59/400 (14%), Positives = 109/400 (27%), Gaps = 96/400 (24%)

Query: 77   YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS---- 132
               E       K   N+T    N      +         E +    ++ S    +     
Sbjct: 1005 ASNEKWTVTVTKENNNVTTTLKNSSGTAVKDNKILNETPEEIINSSMVTSKTAKVKDWDQ 1064

Query: 133  ---------LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ--------------KHN 169
                       ++      ++     I +VLDVS SM +                     
Sbjct: 1065 RTYDITINATSTSTSSIIETKTSVADIMLVLDVSGSMGEDITSYSYTFVANNTSEARDDK 1124

Query: 170  DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP---------------------APANR 208
               N     Y+      K  W  ++    +   P                     +    
Sbjct: 1125 KLLNRNVTYYIEVDGSYKEMWYYSSYNKGWRVGPRGSSDDAAKDKYNNCKIYTRTSTTET 1184

Query: 209  KIDVLIESAGNLVNSIQKAIQEKK-NLSVRIGTIAYNIGIVGNQCTPLSNN--------- 258
            ++D L  +    ++   K     K  ++V   T  YN    GN  T +S           
Sbjct: 1185 RLDALKNAVNQFIDDTAKKSPNSKIGITVFSSTDDYN-RPYGNHGTSVSLGEVGTADSAK 1243

Query: 259  LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE--- 315
            + E+K+ +  L     T+    +  A  +L    +++          K+V+  TDG+   
Sbjct: 1244 VTELKNFVKDLKANGGTDPAVGLEDAKNKLDAMVDTN---------PKYVVLFTDGKPTG 1294

Query: 316  --NSGASAYQNTLNT---------LQICEYMRNAGMKIYSVAVSAPPEG---QDLLR--- 358
              N   S  Q    T             +  +N    +Y++  +   EG   +  L    
Sbjct: 1295 GGNKWNSNAQKNAETQAGELKTGLRNNVDNAKNP-YTVYTIGFALNDEGDRAKTFLSGGT 1353

Query: 359  -------KCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                       SS      +D+  L + F  I+  I +  
Sbjct: 1354 YDGKKDPGIASSSDCAKTADDAASLTQIFQSISSTINKNV 1393


>gi|86134839|ref|ZP_01053421.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
 gi|85821702|gb|EAQ42849.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
          Length = 336

 Score = 76.1 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 51/277 (18%), Positives = 93/277 (33%), Gaps = 93/277 (33%)

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
           R+  + +R+  N  I I M +DVS SM    L+ +                         
Sbjct: 80  RNVSVSKRTKTNRGIDIVMAIDVSASMLARDLKPN------------------------- 114

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                          +++ L + A + V+      +   +   RIG + Y         T
Sbjct: 115 ---------------RLEALKKVAVDFVD------RRPND---RIGIVVYAGESFTQ--T 148

Query: 254 PLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           P++++   VK  +N+L        T     +      L            S    K +I 
Sbjct: 149 PITSDKTIVKRTINRLQWGQLEGGTAIGMGLGSRVNRL----------KDSKAKSKVIIL 198

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------APPEG------ 353
           +TDG N+  +    T   L      +  G+K+Y++ +             P  G      
Sbjct: 199 LTDGVNNAGNIDPTTATEL-----AKELGIKVYTIGIGTNGMADFPWSKDPRTGMLNFRK 253

Query: 354 ------QDLLRKCT-DSSGQFFAVNDSRELLESFDKI 383
                 +DLL+    ++ G++F   D+  L E +D+I
Sbjct: 254 QQVQIDEDLLKNIAEETQGKYFRATDNTSLKEIYDEI 290


>gi|46580532|ref|YP_011340.1| von Willebrand factor type A domain-containing protein
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|46449951|gb|AAS96600.1| von Willebrand factor type A domain protein [Desulfovibrio vulgaris
           str. Hildenborough]
          Length = 420

 Score = 76.1 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 92/288 (31%), Gaps = 44/288 (15%)

Query: 148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN 207
           + +  V+D S SM+   +Q+ N   +      +               + K    PA  +
Sbjct: 135 LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFRGK-VHLPAGVD 193

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCTPLSNNLNEVKS 264
              D    + G L  S       K +     G+   +  N      +   L+ +   + +
Sbjct: 194 GLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQGLTEDRETILT 253

Query: 265 RLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE------ 315
            ++K N       T     +      L  E   +     +  ++K +I +TDG+      
Sbjct: 254 AISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEG-SSAKDIRKVIIVLTDGDTEDGKC 312

Query: 316 ------NSGASAYQNT-----LNTLQICEY--------------MRNAGMKIYSVAVSAP 350
                 N   +AY        L+    CE                + AG++++++     
Sbjct: 313 GGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKAKEAGIEVFAIRFGDS 372

Query: 351 PE-GQDLLRKCTDSS----GQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 L++    S       ++    + ++ + F KI  ++  + +R
Sbjct: 373 DSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 420


>gi|118443684|ref|YP_877685.1| hypothetical protein NT01CX_1604 [Clostridium novyi NT]
 gi|118134140|gb|ABK61184.1| hypothetical protein NT01CX_1604 [Clostridium novyi NT]
          Length = 1252

 Score = 76.1 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 48/301 (15%), Positives = 110/301 (36%), Gaps = 64/301 (21%)

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP- 201
           S++    I +V+D S SM+ L   +  D +N    K       K   +  NTT  + +  
Sbjct: 88  SKDKKKEIVLVMDTSTSMKCLVEPESYDIDNCVPTKEGHIVYIKDKSYLVNTTFLRGSRH 147

Query: 202 -------------------APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                                  +  + + L  +  + +  ++K   +K    + IG ++
Sbjct: 148 KLFYITMGTTNYYIQGNKCYRQSSYNEKNRLKHAQESAIKFVKKFENDKN---ISIGLVS 204

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKESSHNTIG 300
           ++   +  +   L+++L+EVKS +N L       TN    +  A + L           G
Sbjct: 205 FDTRAIEQK--ELTSSLSEVKSSINNLKVAYNGATNIEAGLKSAQKIL---------KKG 253

Query: 301 STRLKKFVIFITDG----------------------ENSGASAYQNTLN------TLQIC 332
           +    K+VI ++DG                      +N+  +   N         ++   
Sbjct: 254 NEDADKYVILMSDGFPTAFDYAGEKFEENFNEHEVQDNTFINFGYNDYRGYAMKHSINQA 313

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           + ++  G+  + +  S     + L +    + G++    ++  L  +++KI  K++   +
Sbjct: 314 DSLKKVGINSFIIGFSDGANSEKLNKIAKAAGGEYEEARNTDALNGAYNKIETKVKAPLI 373

Query: 393 R 393
           +
Sbjct: 374 K 374



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 63/178 (35%), Gaps = 20/178 (11%)

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           ME L      ++    S+  L       +        +K          +ID + + A +
Sbjct: 676 MELLQHIFFGEDPIEISSVQLASGNFTINGKKYYVKDNKVYEFNEQDRSRIDSVKKVAND 735

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGI-----VGNQCTPLSNNLNEVKSRLNKLNPYEN 274
            V+  +       + +  I  + Y+          N+    S +   +K R+N L     
Sbjct: 736 FVDKFK------DDENTEIAIVRYSSKADVVLDNSNKVFLSSKDNETIKKRINSLKADVA 789

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
           TN    +  +Y  L    + S         +K++I +TDG  +  + Y NT+ TL  C
Sbjct: 790 TNIGDGIRKSYSILDKCDKDS---------EKYMILMTDGVPTAYTCYANTIKTLNNC 838


>gi|218672731|ref|ZP_03522400.1| hypothetical protein RetlG_14377 [Rhizobium etli GR56]
          Length = 323

 Score = 75.7 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 66/167 (39%), Gaps = 25/167 (14%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE-----KESSHNTIGSTRLK 305
             TPL+ +   +KS +  L    +T     +   +  L  +      + +     S  + 
Sbjct: 157 PVTPLTGDFAYLKSVVKNLTSEGSTRLDAGVVAGWYTLSPKWQGVWGDETSPAEVSDSVH 216

Query: 306 KFVIFITDGENSGASAYQNTLNTL------------------QICEYMRNAGMKIYSVAV 347
           K ++F+TDGE +      +  + +                    C  M+ +G++IY+++ 
Sbjct: 217 KVMVFMTDGEMNTKYDPNDKFDWICSQTQSSACNAFATAAMQTACTAMKKSGIEIYTLSY 276

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           SA  +  + +R C  ++  FF       +   ++ I   I+  ++R+
Sbjct: 277 SADADVVN-IRNCATNTAHFFTA-SPATIKTVYETIAAAIRGDTLRL 321


>gi|329928982|ref|ZP_08282792.1| von Willebrand factor type A domain protein [Paenibacillus sp.
           HGF5]
 gi|328937234|gb|EGG33661.1| von Willebrand factor type A domain protein [Paenibacillus sp.
           HGF5]
          Length = 899

 Score = 75.7 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 87/267 (32%), Gaps = 69/267 (25%)

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
                 +L  +  +E   E  ++ + +V+D S SM+                        
Sbjct: 385 KTPIEKALPVSMELEGKREIPSLGLILVIDRSGSMDGN---------------------- 422

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
                                  KI++  ESA   V  ++            +G +A++ 
Sbjct: 423 -----------------------KIELAKESAMRTVELMRAKDT--------VGVVAFDD 451

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                       +  EV S +  +     TN YPA+  A  E+                +
Sbjct: 452 QPWWVVPPQKLGDKEEVLSSIQSIPSAGGTNIYPAVSSALEEML----------KIDAQR 501

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG 365
           + +I +TDG+++  S YQ+  +T      M    + + SVAV    +   L      + G
Sbjct: 502 RHIILMTDGQSAMNSGYQDLTDT------MVENKITMSSVAVGMDADTNLLQSLADAAKG 555

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSV 392
           +++ V D   L   F +    + +  +
Sbjct: 556 RYYFVEDETTLPAVFSREAVMLAKSYI 582


>gi|261408991|ref|YP_003245232.1| von Willebrand factor type A [Paenibacillus sp. Y412MC10]
 gi|261285454|gb|ACX67425.1| von Willebrand factor type A [Paenibacillus sp. Y412MC10]
          Length = 1007

 Score = 75.3 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 87/267 (32%), Gaps = 69/267 (25%)

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
                 +L  +  +E   E  ++ + +V+D S SM+                        
Sbjct: 385 KTPIEKALPVSMELEGKREIPSLGLILVIDRSGSMDGN---------------------- 422

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
                                  KI++  ESA   V  ++            +G +A++ 
Sbjct: 423 -----------------------KIELAKESAMRTVELMRAKDT--------VGVVAFDD 451

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                       +  EV S +  +     TN YPA+  A  E+                +
Sbjct: 452 QPWWVVPPQKLGDKEEVLSSIQSIPSAGGTNIYPAVSSALEEML----------KIDAQR 501

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG 365
           + +I +TDG+++  S YQ+  +T      M    + + SVAV    +   L      + G
Sbjct: 502 RHIILMTDGQSAMNSGYQDLTDT------MVENKITMSSVAVGMDADTNLLQSLADAAKG 555

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSV 392
           +++ V D   L   F +    + +  +
Sbjct: 556 RYYFVEDETTLPAVFSREAVMLAKSYI 582


>gi|169826904|ref|YP_001697062.1| hypothetical protein Bsph_1324 [Lysinibacillus sphaericus C3-41]
 gi|168991392|gb|ACA38932.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41]
          Length = 825

 Score = 75.3 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 54/352 (15%), Positives = 112/352 (31%), Gaps = 80/352 (22%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENA-GDIAQKAQINITKDKNNP 100
           A+ +  ++I       +        ++  +L+  + I +N  G +  +A++++ +     
Sbjct: 269 AAALGQQSIGYDVKSPESLPN----ELSSYLQYNAIIFDNVPGHLVGEAKMSVIEQAVKN 324

Query: 101 LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
                          EN F  G          L     I+   +  ++ + +VLD S SM
Sbjct: 325 FGVGFAMVG-----GENSFGLGGYFKTPIETLLPVEMEIKGKEQLPSLGLVIVLDRSGSM 379

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                                                           K+++  E+A   
Sbjct: 380 SG---------------------------------------------SKLELAKEAAARS 394

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
           V  ++            +G IA++        T   NN  E    +  + P   T  Y +
Sbjct: 395 VEMLRDEDT--------LGFIAFDDRPWEIIETGPLNNKEEAVDTILSVTPGGGTEIYGS 446

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +  AY  L + K            +K +I +TDG++   +          + E  ++ G+
Sbjct: 447 LAKAYENLADMKLQ----------RKHIILLTDGQSQPGNYDD-------LIEQGKDNGI 489

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + +VA+    +   L       SG+F+ V D + +     + T  I    +
Sbjct: 490 TLSTVAIGQDADANLLEALSEMGSGRFYNVIDEQTIPSILSRETAMISRTYI 541


>gi|260778153|ref|ZP_05887046.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606166|gb|EEX32451.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 397

 Score = 75.3 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 71/403 (17%), Positives = 134/403 (33%), Gaps = 56/403 (13%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A++I +  L     +    +      MQ A+DAA L+   +  SD ++     +  Q + 
Sbjct: 15  ALLIPLVVLSAATIMIGFQVQLSSRAMQ-AVDAASLACAFADYSDPSVNQAYLEYYQPNV 73

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
              K +K  +   S    N G                           Y++      LK 
Sbjct: 74  ---KLVKSEIYSASGCELNMG---------------------------YQLTGLFSSLKF 103

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK----HNDNNNMTSNK 178
              S            + +S+      + +VLD+S SM                 +  + 
Sbjct: 104 AQASYSAQSGSVEQAHVNQSASVTPTEMTLVLDISSSMAGSIDTLKSILTRAIERIEQDN 163

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRK----IDVLIES------AGNLVNSIQKAI 228
             +      S      +    A      + K    ID L +           V ++ +  
Sbjct: 164 VQIDGRRAISISIVPFSDGVSARNADWLDDKGVFCIDGLTKESGGSVLVNETVQNLDRIH 223

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
            E K +S R                PL++N++EVK+ +N L     T +Y  +    R+L
Sbjct: 224 SE-KAVSHRAPDEFLADCSASATLVPLTDNMSEVKTAINALTTTGGTRSYQGVIWGARQL 282

Query: 289 YNE-KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY-MRNAGMKIYSVA 346
               ++       S   K+ +I +TDG +SG     + L    +C+       +++  + 
Sbjct: 283 IPRWRQEWGYNPYSLAPKQKLILMTDGVDSG--YVLDDLIDAGLCDRLANEFAIELNFIG 340

Query: 347 VSAPPEGQDLLRKCTDSS------GQFFAVNDSRELLESFDKI 383
            +         + C +++      GQ F+  ++ +L E F KI
Sbjct: 341 FNVQDSRLAQFQSCINAANTDGIKGQVFSATNTEKLDEYFSKI 383


>gi|83312851|ref|YP_423115.1| Flp pilus assembly protein TadG [Magnetospirillum magneticum AMB-1]
 gi|82947692|dbj|BAE52556.1| Flp pilus assembly protein TadG [Magnetospirillum magneticum AMB-1]
          Length = 464

 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 67/462 (14%), Positives = 131/462 (28%), Gaps = 89/462 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQ------------SALDAAVLSGCASIVSDR 48
           + AI +      I   +D+A    ++++M             S+   A LS  A    D 
Sbjct: 20  ILAIGLLPIITTIGLGVDVARAYAVKSRMSAALDAAALAVGSSSGTDAQLSAVAQKFFDA 79

Query: 49  TIKDPTT---------------KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINI 93
                                      + +    +K        +  ++    Q A + +
Sbjct: 80  NYPTGALGAHPSVAVKVTGDVISASAVAEVDTVFMKVVGLNDVPVHADSTVNRQIAGLEL 139

Query: 94  TKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMV 153
               +N       +  Q      N     L  +A  +  L+   +   ++ N+  S+   
Sbjct: 140 AMVLDNTGSMTTNNNIQAVRDAANQLTDILFGTATVHPYLKIALVPYSAAVNVG-SVAPS 198

Query: 154 LDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
           L  +   +                +         S  +   T+ K+ PA        D  
Sbjct: 199 LITTG--DTYAPNDLLGWKGCVVERAGANGVGDTSAATAPWTRYKWLPAVDNNY---DAT 253

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-- 271
             S           +    N +   G    N+G      TPL+N    +   +N +    
Sbjct: 254 KSS---------TVLANPSNGNASTGP---NLGCPTA-ITPLTNVKATLTPAINAMEAWS 300

Query: 272 YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGEN--------SGASAY 322
              T +   M    R L  E   +     G+ +  K VI +TDG+N        +G +  
Sbjct: 301 RGGTLSDVGMAWGLRVLSPEPPFTEGLPWGTPKWSKAVILMTDGDNQFYKLTSTTGGNKV 360

Query: 323 QNTLNTLQ------------------------------ICEYMRNAGMKIYSVAV--SAP 350
            + +N+                                +C  M+   + +Y+V       
Sbjct: 361 NSAVNSDYGAYGRLDELGRIGTTNATTAKTTINTRLTSVCNAMKAKNIIVYTVTFTSGIN 420

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              +D+ + C   + ++F      EL  +F  I   +    V
Sbjct: 421 QATKDIYKACATDASKYFDSPSQDELKSAFRAIATSLSNLRV 462


>gi|54298847|ref|YP_125216.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
 gi|53752632|emb|CAH14067.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
          Length = 344

 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 93/296 (31%), Gaps = 84/296 (28%)

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIE--RSSENLAISICMVLDVSRSMEDLYLQKHND 170
           I  + L L  ++   L  ++L     +   +       +I MVLD+S SME   +  H  
Sbjct: 53  ISAKTLLLIPVLVWVLLVIALSGPRWVGEPKPVAREGYNIMMVLDLSGSMEITDMLLH-- 110

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 ++ V+  +A   V         
Sbjct: 111 ---------------------------------GRPVSRLLVVKRAAEQFVE-------- 129

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
              +  RIG I +         TPL+ + + V  R++        + T+   A+  A + 
Sbjct: 130 -DRVGDRIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKR 186

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA- 346
           L +               + +I +TDG N+        L  L+  E  +  G+KIY++  
Sbjct: 187 LQDVPSKG----------RVIILLTDGANNSG-----VLAPLKAAELAKQDGIKIYTIGL 231

Query: 347 -----------------VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                            +SA  + + L      + G++F   D   L   +  I  
Sbjct: 232 GSEADPRALTGDFFAPTLSAELDEKTLEEMAKMTGGRYFRATDPESLQSIYQTINQ 287


>gi|218190303|gb|EEC72730.1| hypothetical protein OsI_06342 [Oryza sativa Indica Group]
          Length = 585

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 80/232 (34%), Gaps = 55/232 (23%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
           ++ I +  VLDVS SM D  +   +   N                               
Sbjct: 43  HVPIDVVAVLDVSGSMGDPAMASSDFEKNKPP---------------------------- 74

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLN 260
               ++DVL E+   ++  +            R+  +A+N   V    T L     N   
Sbjct: 75  ---SRLDVLKEAMKFIIRKLDDGD--------RLSIVAFNDRPVKEYSTGLLNISGNGRR 123

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
             + +++ L     T   PA+  A R L      S N++G      F++ +TDG+++   
Sbjct: 124 IAEKKVDWLEARGGTALMPALEEAIRVLDCRPGDSRNSVG------FILLLTDGDDTSGF 177

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
            +   +    +          +++  + A    + LL    +S G +  V+D
Sbjct: 178 RWSRDVINGAV------GKYPVHTFGLGAAHSSEALLHIAQESRGTYSFVDD 223


>gi|313159758|gb|EFR59115.1| von Willebrand factor type A domain protein [Alistipes sp. HGB5]
          Length = 330

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 53/331 (16%), Positives = 96/331 (29%), Gaps = 97/331 (29%)

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL-A 147
           A I I+  +       A    +Y +       +    + L     R   +   S  N   
Sbjct: 31  ASIQISSVEG---VVRAPKTVRYWLRHLPFAQRLAALALLIVALARPQDVERLSRTNTEG 87

Query: 148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN 207
           I I + +DVS SM                                       A    P  
Sbjct: 88  IDIMLAIDVSGSM--------------------------------------LARDFRP-- 107

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +I    E AG+ +               RIG +A+         +PL+ +   +++ L 
Sbjct: 108 DRITAAKEVAGSFIA---------DRYGDRIGLVAFAGEAFTQ--SPLTTDQGTLQTLLA 156

Query: 268 KLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
           ++      + T     +  A   L            S    K +I +TDG N+       
Sbjct: 157 RIRSGLIEDGTAIGNGLATAINRL----------RESEAKSKVIILLTDGVNNRGEIAPQ 206

Query: 325 TLNTLQICEYMRNAGMKIYSVAV----SAP--------------------PEGQDLLRKC 360
           T   +      +  G+++Y++ V     AP                     + + L    
Sbjct: 207 TAAEI-----AKAQGIRVYTIGVGTEGMAPYPAVDIYGTPTGGTVMAKVEIDEKTLRSIA 261

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             + GQ+F   D  +L   +D+I    + + 
Sbjct: 262 EQTGGQYFRATDKAKLKAIYDQINQLEKSKV 292


>gi|225377140|ref|ZP_03754361.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
 gi|225211045|gb|EEG93399.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
          Length = 1406

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 60/313 (19%), Positives = 99/313 (31%), Gaps = 62/313 (19%)

Query: 129 TNLSLRSTGIIERSSEN-LAISICMVLDVSRSMED-LYLQKHNDNNNMTSNKYLLPPPPK 186
            +L   S    + + E    +   MV D+S SM + +  Q    +    S         K
Sbjct: 696 IDLDASSLATSQSTVEKIQTVDAMMVFDLSGSMNEIMSGQNQLKDIGEFSRVKNQMDINK 755

Query: 187 KSFWSKN--------------------TTKSKYAPAPAPA-------------------- 206
             +W+K                      + + YA  P                       
Sbjct: 756 VYYWNKYEKSGWWPWTYDKSVGMGTAAVSGNVYAKYPVKYIDGQWKKYVDGSYQSISDSD 815

Query: 207 -----NRKIDVLIESAGNLVNSIQKAIQE--KKNLSVRIGTIAYNIGIVGNQCTPLSN-N 258
                  KI  L ++A   V  I     +      +       +N    G     LS  N
Sbjct: 816 VMAVWTSKISALKDAASGFVTGISDTSPDSLVGIATFYGIGNGWNSSTEGKLNHGLSKVN 875

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
            NE+   +N L     T+    + HAY EL   ++ +         KK+VI  +DGE   
Sbjct: 876 KNEMLKSVNALFADGGTSPQKGLEHAYSELQKAEDGN---------KKYVILFSDGE--- 923

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            S   + + T      ++ AG  + +V +    E    L +   S+G  F  + + EL +
Sbjct: 924 PSDSNDKMETEASAVKLKEAGYTVITVGLGLNNETATWLGEKVASAGCAFTADTAEELNK 983

Query: 379 SFDKITDKIQEQS 391
            F  I   I +  
Sbjct: 984 IFQNIQSTITQSR 996


>gi|218708116|ref|YP_002415737.1| hypothetical protein VS_0028 [Vibrio splendidus LGP32]
 gi|218321135|emb|CAV17085.1| Conserved hypothetical protein, putative exported, TadG [Vibrio
           splendidus LGP32]
          Length = 435

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 59/453 (13%), Positives = 135/453 (29%), Gaps = 91/453 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I   F       D A  +  + +++ A +AAVL+  A               +Q 
Sbjct: 15  LFAIMIPALFGVFMLGSDGARALQTKARLEEASEAAVLAVSAK-------------DEQD 61

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++ I+ +L     +        +K   +   +     +       +Y +  + L  
Sbjct: 62  HQLAERYIQHYLYD---MDSILDIEVKKLGCDEMPECIAATERGEARYFEYRVAGQTLHK 118

Query: 121 KGLIPSALT-----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                + +      + ++  +    R      I I  ++D S SM D +    +   N  
Sbjct: 119 SWFPGNDVISGFGDSFNVTGSSKARRYQSQ-PIDITFIVDFSESMNDSWSGGRHSKLNDL 177

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
            +          ++                  R I+   +   NLV   Q+ +   +   
Sbjct: 178 KDIIEDVADELGAYNDLYPEHPHRVALTGFNRRTIN--KDKNDNLVVRDQRVVSR-EGEY 234

Query: 236 VRIGTIAYNIGIVGNQCTP-------------------LSNNLNEVKSRLNKLNPYENTN 276
            +  T+ +N  I                           + + +    ++ K      T 
Sbjct: 235 DKDDTVNFNKTIAQQFIVKGEASRVPNGDDDARFYDLYFTTDFSSFTKKVKKFKAGGGTA 294

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN-SGASAYQNTLNTLQICEYM 335
           +   +  A + + +  ++          K+ +I ++DGE+ +  +   N L +  +C  +
Sbjct: 295 SLQGIIRAGQIVTSMSKNQ---------KQLIIILSDGEDWNHYAGQTNKLVSKGMCSNI 345

Query: 336 RN--AGMKIYS-------------------------------VAVSAPPEGQDLLRKCTD 362
            N   G K+ +                               +           LR C  
Sbjct: 346 LNMVNGGKVSADNTHDDVEVIGGVSQGMMTPDGERMNARMAVIGFDYELNKNVGLRNCV- 404

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                +   +  ++L   +KI   I E+   +A
Sbjct: 405 GRDNVYKAENKEDIL---NKILGLITEEVGHLA 434


>gi|296446920|ref|ZP_06888856.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296255595|gb|EFH02686.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 486

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 68/478 (14%), Positives = 143/478 (29%), Gaps = 101/478 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+      +    A+D A    ++ Q+ +  D+A L+     +  +T     T     
Sbjct: 24  IFALAAIPLLIAAGGAVDFAIASRVQTQLYAICDSATLAATTPAMMQQTTATAKTVA--- 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                      + Q + +  N+ ++      + +              AQ          
Sbjct: 81  ----TSMFAAQVAQINRLTYNSANLTVTVNDDTSASPVKTRTVTVSYLAQV---GNAFGS 133

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +P+++  +   ST    R+     I   +VLD S SME         +    +    
Sbjct: 134 FYHVPTSIFTVKASSTASTARN-----IDFYLVLDNSPSMELPATTAGLASMTAATGCVF 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRK-------IDVLIESAGNLVNSIQKAIQEKKN 233
                  S          Y    +    K       ID + E+A  L  S  +A+     
Sbjct: 189 ACHENTYSDPENTVQYPGYGTIDSYTYAKNAGIALRIDNVREAAKRL-ASTSQAMMSANG 247

Query: 234 LSVRIGTIAYNIGIVGNQC--TPLSNNLNEVKSRLNKLN----------PYENTNTYPAM 281
            + R+   A+N      Q   +  S N++ + + +N +           P   + TYP  
Sbjct: 248 ATYRLAAYAFNYDTTQLQALTSTTSANVSAISTSINAMTPPLMEKNNYLPTGASYTYPTS 307

Query: 282 HHAYRELYNEKESSHNTIG-----------------------------STRLKKFVIFIT 312
              +  +    + +                                    + ++ V+ +T
Sbjct: 308 ASTWTTVTLGSDPTKTNYNVRDAMTDIEMTLTKVNAAMPNPGNGTTASGDKPQEVVMLVT 367

Query: 313 DGE-----------NSGASAYQNTLNT---------LQICEYMRNAGMKIYSVAVS-APP 351
           DG             + AS+Y N+  T           +C  ++N G++I  + +   P 
Sbjct: 368 DGMVDGSFYTNTSCTNYASSYSNSYGTFYRCLRPLDTTLCTTIKNRGIRIAVLNLIYYPT 427

Query: 352 EGQDL---------------LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            G                  L+ C  +   +F V+   ++ E+   +  K+   +  +
Sbjct: 428 PGYGFYDGAVAPFISTVSPALKSCAST-DLYFEVDTGSDISEAMTYLFQKVVTTASYL 484


>gi|306824220|ref|ZP_07457590.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801684|ref|ZP_07695804.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
 gi|304552423|gb|EFM40340.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221626|gb|EFO77918.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
          Length = 967

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 65/431 (15%), Positives = 135/431 (31%), Gaps = 111/431 (25%)

Query: 24  YIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAG 83
               Q   + D  V+       +       T  +  T T     +++ ++      ++A 
Sbjct: 111 QSEEQKAGSADEPVMELATPSEAQPATTSATPTQKPTGTENPTTVERSVQSD---DDDAD 167

Query: 84  DIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP------------SALTNL 131
            +A + +    + K+N  + +    A Y    ++       P            +    L
Sbjct: 168 TVANQNEAKDDETKDNADKTVHLGIASYRGMLKSASAGLSTPEHTKSIEYQGNGAYTLKL 227

Query: 132 SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
            +        +++   I I +VLDVS SM D +  + +                      
Sbjct: 228 DVTGKDASTSTTDTTPIDIALVLDVSGSMNDDFGGRGSP--------------------- 266

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA--IQEKKNLSVRIGTIAY------ 243
                            KI  L  +  + ++   K     E  N  V++  + Y      
Sbjct: 267 ----------------SKISALKTAVNSFLDETAKTNDTIEDDNNKVKVALVKYANQIGT 310

Query: 244 ---------------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                          + G        L+ +   +K+ +N L     T    AM  A + L
Sbjct: 311 ATGADGCRISNSRQSDTGNCTQIVQELTTDAGLLKTSVNGLQAAGATYADAAMEVAQQAL 370

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVA 346
              +  +         KK+VIF TDGE +  S + + +    ++  + ++NAG  +YS+ 
Sbjct: 371 AGGRAGA---------KKYVIFFTDGEPNHWSGFDDDVANAAIKKSQELKNAGTTVYSIG 421

Query: 347 V----------SAPPEGQDLLRKCTD---------------SSGQFFAVNDSRELLESFD 381
           +          S+       +   +                S   +++ + + +L + F+
Sbjct: 422 IFDGANPSASVSSASNANKFMHGISSNYPNATGYRSLGDRASGDYYYSASSATQLAQIFN 481

Query: 382 KITDKIQEQSV 392
            I   I E+ V
Sbjct: 482 DIQKTITEKHV 492


>gi|239620965|ref|ZP_04663996.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239516066|gb|EEQ55933.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 816

 Score = 74.9 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 68/403 (16%), Positives = 124/403 (30%), Gaps = 66/403 (16%)

Query: 29  MQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQK 88
           M+   +     G A+    + +            +           G+     +    +K
Sbjct: 1   MKRIAEWFAAVGAAAGRKGKRLVAIVAAVAMLGGVAGVSATAMADDGNASTTQSQTTDEK 60

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPT-ENLFLKGLIPSALTNLSLRSTGIIERSS--EN 145
           A  +     +               P  E         +    L++             N
Sbjct: 61  AAASAPAPLSTEGTNGVPDDPTLSAPAREKTVTANEDGTYTVALNVTGAKSAGTGEIVTN 120

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             + I +VLDVS SM +      N    +                S  T  +K+  A A 
Sbjct: 121 QPLDIVLVLDVSGSMAEKIASGWNQPTKID---------------SLKTAVNKFINATAA 165

Query: 206 ANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
            N KI D    +   LV           N   R G  +YN        + L+ +++ + S
Sbjct: 166 ENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWSSYN---YTQIVSNLTYDVSGLTS 222

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
            +N L+    T+   A + A   L  +  ++         KK VIF TDGE +  S +  
Sbjct: 223 TVNGLSASGATSADYAFNRAQAALTYQPRANA--------KKVVIFFTDGEPNHGSGFDP 274

Query: 325 TLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQDLLRKC------------------ 360
           T+    +   + +++AG  IYS+ V +         +L +                    
Sbjct: 275 TVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSNLNKYMHGISSNYPDATATSSEHL 334

Query: 361 ------------TDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                        ++S  + A  D+ +L   F+ I  +I + +
Sbjct: 335 WGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQEITKTA 377


>gi|296124353|ref|YP_003632131.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
 gi|296016693|gb|ADG69932.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
          Length = 390

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 58/380 (15%), Positives = 114/380 (30%), Gaps = 35/380 (9%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLSGCASI--VSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
           + +D+A++  +R ++++A DA+  +G  ++    D             +     +     
Sbjct: 33  FTVDVAYMQLVRTELRAATDASAKAGMEALRRTQDTEAAIDAAIATAAANKVGGRSLTLT 92

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS 132
                      ++      N  +     ++  +            LF   +  +      
Sbjct: 93  ADQIEFGLAFRNVDNSVSFNAGQLPYTAVRVNSAMTESSAAGAVPLFFGSIFGTG----Q 148

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
              T     +S    + IC  +D S SM              T         P     S+
Sbjct: 149 FEPTRSAVSASTE--VEICFAIDRSHSMCFDLTGVDWSYPPGTPRNPDPVAFPPHPTLSR 206

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
             + S+            +     A  +V    K  Q         G +           
Sbjct: 207 WASLSRAMQTFVSITASQEPKPRVA--MVTWASKITQSN-----YEGKLTKTNSPEVFVD 259

Query: 253 TPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRL--KKF 307
            PL+ NL ++   +   +       TN    +  A + L        N   STR    + 
Sbjct: 260 VPLTTNLADLNQAIKGRSEKVMLGATNMAAGIDEARKIL--------NATKSTRPYAHRI 311

Query: 308 VIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQF 367
           +I +TDG       +    N L   +   N G+ I+SV++  P  G    +  + + G  
Sbjct: 312 IILMTDG------LWNQGRNPLLAAQDAANEGIVIHSVSLL-PRSGDITPQVSSTTGGVN 364

Query: 368 FAVNDSRELLESFDKITDKI 387
           +   +S  L  +F  I   +
Sbjct: 365 YPATNSAALEAAFADIARTL 384


>gi|84386788|ref|ZP_00989813.1| hypothetical protein V12B01_19181 [Vibrio splendidus 12B01]
 gi|84378316|gb|EAP95174.1| hypothetical protein V12B01_19181 [Vibrio splendidus 12B01]
          Length = 404

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 45/293 (15%), Positives = 93/293 (31%), Gaps = 28/293 (9%)

Query: 114 PTENLFLKGLIPSALTNLSLRSTG-IIERSSENLAIS--ICMVLDVSRSMEDLYLQKHND 170
               L       S  T ++    G      S+  +I   + +VLDVS SM        + 
Sbjct: 104 SLSPLLPNFQYESYATKVTATGGGYKSVVESKQSSIPTELVLVLDVSGSMGSNIQSLKSI 163

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNT----------TKSKYAPAPAPANRKIDVLIESAGNL 220
            +N  +                 +           +  +    A     ID L    GN 
Sbjct: 164 LSNALNTIQSQSNNANDLDSVSISIVPFDSGVAAQRPPWLSKEAAGIYCIDGLNYRNGNF 223

Query: 221 VNSIQKAIQEKKNLSVRIGTIAY-------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
             ++     +          + +       +     +   PL++  + V++ +N L    
Sbjct: 224 SAAL---TVDNLATLHSQQPVKFAKPNGWLSDCNQSSPMLPLTSVFSRVRNSINSLTANG 280

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRL--KKFVIFITDGENSGASAYQNTLNTLQI 331
            T ++  +    R+L    + +     ST    ++ ++  TDG + G +  Q  L     
Sbjct: 281 GTRSFHGLLWGVRQLIPSWQQAWGINVSTVPETRRKLVLFTDGADEGDTFDQ--LVNAGF 338

Query: 332 CEYMRNA-GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           C    N  G+++  +             +C  +  + F+  ++ +L E F  I
Sbjct: 339 CTTAINQYGIEMNFIGYGVSSSRIAQFERCAGNPSRVFSATNTTQLNEYFSDI 391


>gi|303248312|ref|ZP_07334574.1| von Willebrand factor type A [Desulfovibrio fructosovorans JJ]
 gi|302490337|gb|EFL50249.1| von Willebrand factor type A [Desulfovibrio fructosovorans JJ]
          Length = 452

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 57/466 (12%), Positives = 134/466 (28%), Gaps = 117/466 (25%)

Query: 9   CFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQI 68
               +  A+DL  +    N++Q+A+DAA L+G   +  D  + +    +  T+ +     
Sbjct: 10  LMAAVGVAVDLGRVYVAHNKLQNAVDAAALAGSLQLPDDPDVDNGKVSQAVTTNLAA--- 66

Query: 69  KKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSAL 128
                  +     A DI+                    ++A  ++    +          
Sbjct: 67  -------NDPEAKATDISSGGATR---------SVCVTAEADVDMTLSKV---------- 100

Query: 129 TNLSLRSTGIIERSSEN-LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
             + L +T +   +      I + MVLD + SM    +    +      +  L+ P    
Sbjct: 101 --VGLDATTVTAEACAGYNDIELVMVLDATGSMRGTPIANVKEAAANLVD--LIMPDSGA 156

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLI--ESAGNLVNSIQKAIQEKKNL----------- 234
           +  SK              N  +      +  G    +    + + K             
Sbjct: 157 NTRSKIGLVPFQGKVRIDGNDPVTAERDPDGVGAGCRNADGTLNDGKLKTEYSDTRSRNS 216

Query: 235 ----SVRIGTIAYNIGIVG--NQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAY 285
                   G   Y        +    LS++   +   +  +N       T     +   +
Sbjct: 217 IFYGYTISGVSTYYDRTCSGMSPIRALSSDKEAILDNIGAINAGAVTSGTLISEGIKWGH 276

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSG--------------------------- 318
           + L  +   +       +++K +I +TDG+                              
Sbjct: 277 KVLSPKAPYTEGNT-DKKVRKIMIVLTDGDTEDGRCGGRYASASRTVNAYWTNAYFGQGL 335

Query: 319 -ASAYQNTLNTLQI----------C--------------EYMRNAG---MKIYSVAVSAP 350
             ++  +  +TL            C              +  +N     ++I+++     
Sbjct: 336 RPNSASSPYDTLSTASATLAQIPDCTDGGKLNQYVLDEADDAKNDADYPVEIFAIRFGDS 395

Query: 351 PEGQ-DLLRKCTDS----SGQFFAVNDSRELLESFDKITDKIQEQS 391
                 L+++   S       ++   DS ++ + F KI  ++ ++ 
Sbjct: 396 DATDISLMKRIASSKSGTDDHYYDAPDSSDIKDMFKKIGQQLGQRL 441


>gi|86137906|ref|ZP_01056482.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
 gi|85825498|gb|EAQ45697.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
          Length = 543

 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           G  S          T  +CE  +  G+ +Y++   AP  G  +LR C  S   +F V D 
Sbjct: 464 GIYSSHGNSTKNARTRSVCEAAKAKGIVVYTIGFEAPSNGVAVLRDCASSDAHYFDV-DG 522

Query: 374 RELLESFDKITDKIQE 389
            E+ ++F  I   I++
Sbjct: 523 LEIKDAFASIATSIRQ 538



 Score = 69.5 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 51/371 (13%), Positives = 94/371 (25%), Gaps = 80/371 (21%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           T              +DL  +   R  +Q  LD AVL+     +          +     
Sbjct: 38  TVAFFLAMLAVGGIGVDLMRMERDRTVLQYTLDRAVLAAAD--LDQTQPPAVVVQDYLNK 95

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               +  ++ + +     +                                         
Sbjct: 96  AGLGEYYQEPIVESGLGYKRVQATIDAT----------------------------FEAH 127

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------DLYL 165
            L  S   +L + +T   E S + L IS  +VLDVS SM                 D  +
Sbjct: 128 LLRFSNGNDLPVFATSKAEESIDGLEIS--LVLDVSGSMNSNSRLSNLKVAAKDFIDTMV 185

Query: 166 QKHNDNN-NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI 224
               D   +++   Y            + TT  +   +        +    S   L    
Sbjct: 186 ANTTDGKMSISVVPYATQVSLPDDLIDQYTTVGENPYSNCINFEAAEYNSASLSTLDTLE 245

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCT----------PLSNNLNEVKSRLNKLNPYEN 274
           +         S R     Y+   +               PL  +   +K+ +  L+   N
Sbjct: 246 RSMHFTPWGYSNRDMRTYYSSPRLVRSPVCDERASREVLPLQKDATTLKNFIQNLSAGGN 305

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLK--------------------KFVIFITDG 314
           T+    M      L +       +  ST +                     K ++ +TDG
Sbjct: 306 TSIDVGMKWG-TALLDPSARPAISAISTGIGASVPGDFSDRPAEYSDSDTIKIIVLMTDG 364

Query: 315 ENSGASAYQNT 325
           +N+      + 
Sbjct: 365 QNTSQYYVDDD 375


>gi|290769676|gb|ADD61455.1| putative protein [uncultured organism]
          Length = 816

 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 68/403 (16%), Positives = 124/403 (30%), Gaps = 66/403 (16%)

Query: 29  MQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQK 88
           M+   +     G A+    + +            +           G+     +    +K
Sbjct: 1   MKRIAEWFAAVGAAAGRKGKRLVAIVAAVAMLGGVAGVSATAMADDGNASTTQSQTTDEK 60

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPT-ENLFLKGLIPSALTNLSLRSTGIIERSS--EN 145
           A  +     +               P  E         +    L++             N
Sbjct: 61  AAASAPAPLSTEGTNGVPDDPTLSAPAREKTVTANEDGTYTVALNVTGAKSAGTGEIVTN 120

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             + I +VLDVS SM +      N    +                S  T  +K+  A A 
Sbjct: 121 QPLDIVLVLDVSGSMAEKIASGWNQPTKID---------------SLKTAVNKFINATAA 165

Query: 206 ANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
            N KI D    +   LV           N   R G  +YN        + L+ +++ + S
Sbjct: 166 ENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWSSYN---YTQIVSNLTYDVSGLTS 222

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
            +N L+    T+   A + A   L  +  ++         KK VIF TDGE +  S +  
Sbjct: 223 TVNGLSASGATSADYAFNRAQAALTYQPRANA--------KKVVIFFTDGEPNHGSGFDP 274

Query: 325 TLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQDLLRKC------------------ 360
           T+    +   + +++AG  IYS+ V +         +L +                    
Sbjct: 275 TVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSNLNKYMHGISSNYPDATATSSEHL 334

Query: 361 ------------TDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                        ++S  + A  D+ +L   F+ I  +I + +
Sbjct: 335 WGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQEITKTA 377


>gi|306823858|ref|ZP_07457232.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309802423|ref|ZP_07696530.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
 gi|304552856|gb|EFM40769.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221023|gb|EFO77328.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
          Length = 1136

 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 90/310 (29%), Gaps = 92/310 (29%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
            +   N+ +         +    +   +VLDVS SM +                      
Sbjct: 578 NTYTVNVDVTGAASSSTITTTQPVDFTLVLDVSGSMRENMGSV----------------- 620

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI--QEKKNLSVRIGTIA 242
                                   K+  L  +  N ++   K     +  +  VR+G + 
Sbjct: 621 -----------------------TKLQALQSAVNNFLDEAAKINKGAQSGSEPVRVGLVK 657

Query: 243 Y-----------------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
           +                 N          L+ + + +K+ +NKL     T       HA+
Sbjct: 658 FAGNATKKIGNKTYQDKWNTYNYSQIVKKLTADTDGLKNEVNKLTAGGATRADYGFQHAF 717

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL--NTLQICEYMRNAGMKIY 343
             +   +         T  KK VIF TDG+ +    +   +  + ++  + ++++G  +Y
Sbjct: 718 TVMSEAR---------TEAKKVVIFFTDGKPTSEKTFDGKVANDAVEYAKQLKDSGAIVY 768

Query: 344 SVAV-------SAPPEGQDLLRKCT---------------DSSGQFFAVNDSRELLESFD 381
           S+ V       S        +   +                ++G +    D+  L   F+
Sbjct: 769 SIGVFDGANPASTATSENKFMHAVSSNYPNAANYEDLSEGSNAGYYKTATDASGLNSIFE 828

Query: 382 KITDKIQEQS 391
           +I        
Sbjct: 829 EIRKSETTTY 838


>gi|78484419|ref|YP_390344.1| von Willebrand factor, type A [Thiomicrospira crunogena XCL-2]
 gi|78362705|gb|ABB40670.1| Type A von Willebrand factor-like [Thiomicrospira crunogena XCL-2]
          Length = 349

 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 53/314 (16%), Positives = 101/314 (32%), Gaps = 96/314 (30%)

Query: 102 QYIAESKAQYEIPTENLFLKGLIP-------SALTNLSLRSTGIIERSSENLAISICMVL 154
           Q++  ++   +IP   +FL  L+          L     +++G            + + +
Sbjct: 60  QFVQANRRSIKIPLTGIFLWSLVVLAAMRPVWFLNTTPFQASGK----------DLMLAV 109

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           D+S SME   +                                   P       ++  + 
Sbjct: 110 DLSGSMEKTDM-----------------------------------PLRGVEVDRLTAVK 134

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---P 271
               N +         +K    R+G + +         +PL+ +LN V++ LN+      
Sbjct: 135 SVVKNFI---------QKRQGDRMGLVVFGSQAFLQ--SPLTYDLNTVETLLNETEIGMA 183

Query: 272 YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI 331
             NT    A+  A + L+   E           K  +I +TDG N+        +  L  
Sbjct: 184 GNNTAIGDAIGIALKHLHQNSEK----------KAVLILLTDGSNTAG-----AVQPLDA 228

Query: 332 CEYMRNAGMKIYSVAVSA------------PPEGQD---LLRKCTDSSGQFFAVNDSREL 376
            +  +  G+KIY++ +              P    D   L +    + G+FF   D+ +L
Sbjct: 229 AKQAQEMGLKIYTIGIGQNQATGLDAFIFGPNRNMDTTTLQKIAELTQGRFFMAKDTNQL 288

Query: 377 LESFDKITDKIQEQ 390
            E +  I      Q
Sbjct: 289 NEIYQLIDQLEASQ 302


>gi|242091866|ref|XP_002436423.1| hypothetical protein SORBIDRAFT_10g002210 [Sorghum bicolor]
 gi|241914646|gb|EER87790.1| hypothetical protein SORBIDRAFT_10g002210 [Sorghum bicolor]
          Length = 636

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 76/224 (33%), Gaps = 55/224 (24%)

Query: 104 IAESKAQYEIPTENLFLKGLIPSALTN----LSLRSTGIIERSSENLAISICMVLDVSRS 159
            A +++  ++ T  +F +  +  A  +    L + +     R    + I +  VLDVS S
Sbjct: 33  TAAAESTVKVSTTPIFPQIPLGQARKDFQVLLRVEAPTAAVRPEARVPIDVVAVLDVSGS 92

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           M D                                      P   P   ++D+L  +A  
Sbjct: 93  MNDPAAV---------------------------------PPERRPTTSRLDLLKTAAKF 119

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLNEVKSRLNKLNPYENT 275
           +V  ++           R+  +A+N   V    + L    ++   +    +++L     T
Sbjct: 120 MVAKLEDGD--------RLSIVAFNDRPVKELSSGLLYMSADGRRKAMKSVDQLEARGGT 171

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
              PA   A + L        N +G      F++ +TDGE++  
Sbjct: 172 ALVPAFEEAVKVLDGRVGDGRNRLG------FIVLLTDGEDTSG 209


>gi|33321021|gb|AAQ06268.1| unknown [Sorghum bicolor]
          Length = 610

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 76/224 (33%), Gaps = 55/224 (24%)

Query: 104 IAESKAQYEIPTENLFLKGLIPSALTN----LSLRSTGIIERSSENLAISICMVLDVSRS 159
            A +++  ++ T  +F +  +  A  +    L + +     R    + I +  VLDVS S
Sbjct: 25  TAAAESTVKVSTTPIFPQIPLGQARKDFQVLLRVEAPTAAVRPEARVPIDVVAVLDVSGS 84

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
           M D                                      P   P   ++D+L  +A  
Sbjct: 85  MNDPAAV---------------------------------PPERRPTTSRLDLLKTAAKF 111

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLNEVKSRLNKLNPYENT 275
           +V  ++           R+  +A+N   V    + L    ++   +    +++L     T
Sbjct: 112 MVAKLEDGD--------RLSIVAFNDRPVKELSSGLLYMSADGRRKAMKSVDQLEARGGT 163

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
              PA   A + L        N +G      F++ +TDGE++  
Sbjct: 164 ALVPAFEEAVKVLDGRVGDGRNRLG------FIVLLTDGEDTSG 201


>gi|148258759|ref|YP_001243344.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
 gi|146410932|gb|ABQ39438.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
          Length = 449

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 68/437 (15%), Positives = 138/437 (31%), Gaps = 65/437 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            AI+       +   +D +    +R ++QSA+DAA + G  S  S   I       D   
Sbjct: 23  FAIVCVPLITAVGCGVDYSRANQLRAKLQSAVDAASV-GAVSRTSPAFIAAGAMTADGII 81

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           T      +                +   ++            +  +   +      +   
Sbjct: 82  TAGNDDARNIFNGNMNGTTGYTLNSVTPEVK-------KTGSVLTATVSFSASV-PMMFM 133

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            ++      L   S      +S    I   ++LD S SM               ++    
Sbjct: 134 NIVGIKTMTLQGMS---KATASMPKYIDFYLLLDNSPSMGVAATPDDVTKMVNATSDAKY 190

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAP---ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                 +F   +   S      A       +IDVL  +   L+++  +          R+
Sbjct: 191 GSNRYCAFACHDYNDSNNFYNLAKSIGVTTRIDVLRSATQQLMDTATQTQTYPNQ--FRM 248

Query: 239 GTIAY---NIGIVGNQCTPLSNNLNEVKSR---LNKLNPYENTNTYPAMH----HAYREL 288
               +   +  I       LS NL+  KS    ++ +  Y N + Y A       A    
Sbjct: 249 AIYDFGAASKTIGLRALFALSANLSSAKSAAGNIDLMGVYGNNDAYTADKDTPFTAVFPA 308

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDG---ENS--------GASAYQNTLNTLQICEYMRN 337
            N + S+     +    K++ F++DG   E++          +  Q+ +N   +C  ++N
Sbjct: 309 VNNEISTPGDGTTGSPLKYLFFVSDGVADESNAACLKPKASGNRCQSPINP-ALCTTLKN 367

Query: 338 AGMKI---YSVAVSAPPEGQDL----------------------LRKCTDSSGQFFAVND 372
            G+KI   Y+  +  P     +                      ++ C  S G +F V+ 
Sbjct: 368 RGIKIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQACA-SPGFYFEVSP 426

Query: 373 SRELLESFDKITDKIQE 389
           ++ + ++ + +  K   
Sbjct: 427 TQGIADAMNALFKKAVA 443


>gi|309792347|ref|ZP_07686816.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
 gi|308225613|gb|EFO79372.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
          Length = 845

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 76/223 (34%), Gaps = 29/223 (13%)

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
            +    I   +VLD S SM   +     D     S            F     + + Y  
Sbjct: 397 PTSQKPIQYVVVLDASGSMSANF-----DGQCNNSGGVKQCANGPSGFPDVQVSNTGYDY 451

Query: 202 A-PAPANRKIDVLIESAGNLVNSIQKAIQEKK----NLSVRIGTIAYNIGIVGNQCTPLS 256
                + R+I V  ++   LV ++              S ++  + +N G+  +Q    +
Sbjct: 452 WWTTESQRRIYVAKKALERLV-TLSNMPGNPGYTNTRPSDQMAVVWFNDGVSSSQTQAFT 510

Query: 257 NNLNEVKSRLNKLN-------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
           NN   +K+ +  LN           TN    ++ A     N  ++      +   K+ V+
Sbjct: 511 NNPTTLKNYITTLNNVNGNYRSAGGTNGAGGLYRASLLYQNAPKTVSFNGTNVEYKRVVL 570

Query: 310 FITDGENS-----------GASAYQNTLNTLQICEYMRNAGMK 341
           F+TDG ++           G  +  +T      C  M++  ++
Sbjct: 571 FVTDGVSNYFLNTSASDLKGPLSSYDTFKKNSTCYNMKSKVIE 613


>gi|254440702|ref|ZP_05054195.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
 gi|198250780|gb|EDY75095.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
          Length = 590

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
           +  +       IC   R  G+ IY+VA  AP  GQ  L+ C  SS  +F V D  ++  +
Sbjct: 517 NGSEANTRLSNICAAARAQGIVIYTVAFEAPSGGQTALQDCASSSSHYFDV-DGTDISGA 575

Query: 380 FDKITDKIQE 389
           F  I   I+ 
Sbjct: 576 FSAIASDIRN 585



 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 56/364 (15%), Positives = 98/364 (26%), Gaps = 74/364 (20%)

Query: 1   MTAIIISVCFL-FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + ++++ V  L F   A+DL      R ++Q +LD A L+          +       D 
Sbjct: 32  IFSLMMMVMILWFGGMAVDLMRYETTRAKLQGSLDRATLAAA-------DLDQVMAPADV 84

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                      ++ +   +    GD      IN      N                  LF
Sbjct: 85  VRD--------YMDKAGMLHFLQGDPIVDQGINYRIVTANAS------------APMPLF 124

Query: 120 LKGL-----IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME------------- 161
              L      P      SL  +G          + I +VLDVS SM              
Sbjct: 125 FYDLPKVFSSPFTPGMSSLTVSGSSTAEERVSDVEISLVLDVSSSMNSNNRMTNLRPAAR 184

Query: 162 DLYLQKHNDNNNMTSN-------KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           +       +N N            Y     P             +  +  P     +   
Sbjct: 185 EFVTTVLANNTNAPQGLITISMIPYSAVVNPGTDIAPHLNINRTHEYSTCPMFDDTEFTT 244

Query: 215 ESA--GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
            +   G   + +        N         +      N   P + N  ++ + +N L+ Y
Sbjct: 245 TALNLGASYDHVSHFSYGGSNDMPINPNYTWCFAGDLNAIKPHTTNEADLHTAINNLHAY 304

Query: 273 ENTNTYPAMHHAY-----------RELYNEKESSHNTIGSTRLK--------KFVIFITD 313
            NT     +                 L     +    I + R +        K ++ +TD
Sbjct: 305 GNTAIDMGVKWGVALLDSSTQSLISSLAGASGTGVPAIANGRPELHTQADVLKVLVLMTD 364

Query: 314 GENS 317
           G+N+
Sbjct: 365 GQNT 368


>gi|149180101|ref|ZP_01858606.1| hypothetical protein BSG1_03760 [Bacillus sp. SG-1]
 gi|148852293|gb|EDL66438.1| hypothetical protein BSG1_03760 [Bacillus sp. SG-1]
          Length = 931

 Score = 74.2 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 77/237 (32%), Gaps = 69/237 (29%)

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
            ++ + +VLD S SM                                             
Sbjct: 406 PSLGMVIVLDRSGSMAGY------------------------------------------ 423

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
              KI +  E+A      +++           +G IA++        T    +  +V  +
Sbjct: 424 ---KIQLAKEAAIRSAELLREKDT--------LGFIAFDDRPWQIIDTEPIKDKEKVIEK 472

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           +N L     TN +P++  AY +L                +K +I +TDG++        +
Sbjct: 473 INGLTSGGGTNIFPSLELAYEQLT----------PLELQRKHIILLTDGQS------ATS 516

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
            + L   +  +   + + +VA+    +   L     +  G+F+ VNDS  +     +
Sbjct: 517 PDYLTTIQEGKENNITLSTVAIGEGSDSVLLEELSDEGGGRFYDVNDSSTIPSILSR 573


>gi|332558842|ref|ZP_08413164.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
 gi|332276554|gb|EGJ21869.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
          Length = 566

 Score = 74.2 bits (180), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 314 GENSGASAYQNTLN-------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
           G +   S++ +TL+       T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G 
Sbjct: 480 GVSGRYSSWVSTLDPTVKNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGH 539

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           ++      ++   F  I   I +
Sbjct: 540 YY-ATVGPQIRTVFHSIASHITQ 561



 Score = 63.4 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 48/361 (13%), Positives = 97/361 (26%), Gaps = 81/361 (22%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ +  +    A+D+    + R ++Q  LD AVL+  +   S                  
Sbjct: 31  MLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAASLTQS---------------RSP 75

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            + ++ ++ +          +     +N+             + A Y +PT       L+
Sbjct: 76  AEVVRDYVAKAGLEDYLDEPVVNANTLNVRS---------VTATAAYSMPT---VFMKLL 123

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM----------EDLYLQKHND---- 170
                     ST     S+    + I +VLD+S SM           D       D    
Sbjct: 124 DIDRLEAPAVSTAEERVSN----VEISLVLDMSNSMVTDGTNPRDRLDNLKVAARDFIDI 179

Query: 171 --------------NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
                          +                  +      +   +        D    +
Sbjct: 180 VMAGANSGLDGAPVISVSIVPYTGQVNAGADLLATYPNVSHRQPYSSCVEFAASDFTTTA 239

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN-----QCTPLSNNLNEVKSRLNKLNP 271
             N          E  + S       Y              TP S++   +K+ +++L+ 
Sbjct: 240 LANGAPLTGSGNSELFSSSSSTQAPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDRLSG 299

Query: 272 YENTNTYPAMHHAYR-----------ELYNEKESSHNTIG------STRLKKFVIFITDG 314
             +T     M                 L  + + +    G      S  + K V+ +TDG
Sbjct: 300 EGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTDG 359

Query: 315 E 315
           +
Sbjct: 360 Q 360


>gi|77463970|ref|YP_353474.1| hypothetical protein RSP_0399 [Rhodobacter sphaeroides 2.4.1]
 gi|77388388|gb|ABA79573.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 566

 Score = 74.2 bits (180), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 314 GENSGASAYQNTLN-------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
           G +   S++ +TL+       T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G 
Sbjct: 480 GVSGRYSSWVSTLDPTVKNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGH 539

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           ++      ++   F  I   I +
Sbjct: 540 YY-ATVGPQIRTVFHSIASHITQ 561



 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 48/361 (13%), Positives = 96/361 (26%), Gaps = 81/361 (22%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ +  +    A+D+    + R ++Q  LD AVL+  +   S                  
Sbjct: 31  MLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAASLTQS---------------RSP 75

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            + ++ ++ +          +     +N+             + A Y +PT       L+
Sbjct: 76  AEVVRDYVTKAGLADYLDEPVVNANTLNVRS---------VTATAAYSMPT---VFMKLL 123

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM----------EDLYLQKHND---- 170
                     ST     S+    + I +VLD+S SM           D       D    
Sbjct: 124 DIDRLEAPAVSTAEERVSN----VEISLVLDMSNSMVTDGTNPRDRLDNLKVAARDFIDI 179

Query: 171 --------------NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
                          +                  +      +   +        D    +
Sbjct: 180 VMAGANSGLDGAPVISVSIVPYTGQVNAGADLLSTYPNVSHRQPYSSCVEFAASDFTTTA 239

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN-----QCTPLSNNLNEVKSRLNKLNP 271
             N          E  + S       Y              TP S++   +K  +++L+ 
Sbjct: 240 LANGAPLTGSGNSELFSSSSSTQAPTYYWCPEETAAGNPTVTPFSHDPEALKLAIDRLSG 299

Query: 272 YENTNTYPAMHHAYR-----------ELYNEKESSHNTIG------STRLKKFVIFITDG 314
             +T     M                 L  + + +    G      S  + K V+ +TDG
Sbjct: 300 EGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTDG 359

Query: 315 E 315
           +
Sbjct: 360 Q 360


>gi|120602151|ref|YP_966551.1| von Willebrand factor type A [Desulfovibrio vulgaris DP4]
 gi|120562380|gb|ABM28124.1| von Willebrand factor, type A [Desulfovibrio vulgaris DP4]
          Length = 420

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 93/288 (32%), Gaps = 44/288 (15%)

Query: 148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN 207
           + +  V+D S SM+   +Q+ N   +      +               + K    PA  +
Sbjct: 135 LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFRGK-VHLPAGVD 193

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCTPLSNNLNEVKS 264
              D    + G L  S       K +     G+   +  N      +   L+ +   + +
Sbjct: 194 GLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQGLTEDRETILT 253

Query: 265 RLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE------ 315
            ++K N       T     +      L  E   +     +  ++K +I +TDG+      
Sbjct: 254 AISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEG-SSAKDIRKVIIVLTDGDTEDGKC 312

Query: 316 ------NSGASAYQNT-----LNTLQICEY--------------MRNAGMKIYSVAVSAP 350
                 N   +AY        L+    CE               ++ AG++++++     
Sbjct: 313 GGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKVKEAGIEVFAIRFGDS 372

Query: 351 PE-GQDLLRKCTDSS----GQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 L++    S       ++    + ++ + F KI  ++  + +R
Sbjct: 373 DSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 420


>gi|126462813|ref|YP_001043927.1| hypothetical protein Rsph17029_2052 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104477|gb|ABN77155.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 566

 Score = 73.8 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 314 GENSGASAYQNTLN-------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
           G +   S++ +TL+       T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G 
Sbjct: 480 GVSGRYSSWVSTLDPTVKNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGH 539

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           ++      ++   F  I   I +
Sbjct: 540 YY-ATVGPQIRTVFHSIASHITQ 561



 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 48/364 (13%), Positives = 105/364 (28%), Gaps = 87/364 (23%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ +  +    A+D+    + R ++Q  LD AVL+  +   S                  
Sbjct: 31  MLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAASLTQS---------------RSP 75

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            + ++ ++ +          +     +N+             + A Y +PT       L+
Sbjct: 76  AEVVRDYVAKAGLEDYLDEPVVNANTLNVRS---------VTATAAYSMPT---VFMKLL 123

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                     ST     S+    + I +VLD+S SM        +  +N+          
Sbjct: 124 DIDRLEAPAVSTAEERVSN----VEISLVLDMSNSMVTDGTNPRDRLDNLKVAARDFIDI 179

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
                 S        + +  P   +++     A  L      + ++  +  V      + 
Sbjct: 180 VMAGANSGLDGAPVISVSIVPYTGQVNA---GADLLATYPNVSHRQPYSSCVEFAASDFT 236

Query: 245 IGIVGN------------------------------------QCTPLSNNLNEVKSRLNK 268
              + N                                      TP S++   +K+ +++
Sbjct: 237 TTALANGATLTGSGNSELFSSSSSTQTPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDR 296

Query: 269 LNPYENTNTYPAMHHAYR-----------ELYNEKESSHNTIG------STRLKKFVIFI 311
           L+   +T     M                 L  + + +    G      S  + K V+ +
Sbjct: 297 LSGEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLM 356

Query: 312 TDGE 315
           TDG+
Sbjct: 357 TDGQ 360


>gi|16126967|ref|NP_421531.1| hypothetical protein CC_2734 [Caulobacter crescentus CB15]
 gi|221235756|ref|YP_002518193.1| hypothetical protein CCNA_02820 [Caulobacter crescentus NA1000]
 gi|13424325|gb|AAK24699.1| hypothetical protein CC_2734 [Caulobacter crescentus CB15]
 gi|220964929|gb|ACL96285.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 629

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 38/276 (13%), Positives = 72/276 (26%), Gaps = 42/276 (15%)

Query: 159 SMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
           S+ DL     +                     S      + A        ++  L     
Sbjct: 352 SITDLTSNTFDTGVPGLGTAAFTSGGTATCEQSTTPGCRRLAYVSNWGTNEVRALSTCVS 411

Query: 219 NLVNSIQKAIQEKKNLSV-----RIGTIAYN-IGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
               +            V          +Y+       + TPLS++   +K+++N  +  
Sbjct: 412 ERTGADAYTDAAPSTAFVGTNYPSTSADSYSPNPCPSAKITPLSSDKTALKAQINNYSVG 471

Query: 273 ENTNTYPAMHHAYRELYNE-------KESSHNTIGSTRLKKFVIFITDGE---------- 315
            +T     +   +  +                   S  L K VI +TDG           
Sbjct: 472 GSTAGQIGLAWGWYMVAPNFGYIWPSASQRPAAYKSKDLMKVVIMMTDGAFNTPYCNGVI 531

Query: 316 ---------------NSGASAYQNTLNTLQICEYMR--NAGMKIYSVAVSAPPE--GQDL 356
                          N  A+          +C  ++     + +Y+V  +   +   +  
Sbjct: 532 AANAGIGSGSDEDHINCNATNGDPFAQARALCTVIKNSANDITLYTVGFAVGSDYTAKTF 591

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           L  C   S + F      EL  SF  I  +I    +
Sbjct: 592 LTDCASDSSKAFFPATGSELKASFTAIAREISSLRI 627



 Score = 38.7 bits (88), Expect = 1.6,   Method: Composition-based stats.
 Identities = 54/291 (18%), Positives = 92/291 (31%), Gaps = 61/291 (20%)

Query: 16  AIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQG 75
            +D++ +   R QMQ ALDAA L    S  +     D T      + I    +       
Sbjct: 48  VLDVSRLSLQRRQMQDALDAATLMAARSAATASADLDTTGDAAFLAEIAGMNLGLTASSS 107

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
           ++                        + I  + A  +    NL           + ++ +
Sbjct: 108 TFS------------------VGTGNRVIGTATATLKPIIANL-------WQAGDFTVTA 142

Query: 136 TGIIERSSENLAISICMVLDVSRSM------------EDLYLQKHNDNNNMTSNKYLLPP 183
           T  + RSS+N  + + +VLD++ SM             DL      D      +K  L P
Sbjct: 143 TSEVVRSSKN--LEVALVLDITGSMSGTRIADLKVAASDLVDIVIRDTQTPFYSKVALVP 200

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE---KKNLSVRIGT 240
                        ++    P P     +V   + G  +  + KA+       N  +  G 
Sbjct: 201 YAAGVNVDTYADMAR---GPIPVRNISNVAWLATGTSIRGVTKALPALLWSDNHGLVTGD 257

Query: 241 IAYNIGIVGNQCTPLS--NN--------------LNEVKSRLNKLNPYENT 275
             +  GI G   T ++  N               LN + +RL   +P   T
Sbjct: 258 RVFISGISGGVLTSMASLNGAIYTVTRLDSNVVYLNGIDTRLKSNSPSGGT 308


>gi|167752252|ref|ZP_02424379.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
 gi|167660493|gb|EDS04623.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
          Length = 328

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 50/314 (15%), Positives = 100/314 (31%), Gaps = 93/314 (29%)

Query: 108 KAQYEIPTENLFLKGL-IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ 166
             +Y +      L+   +   +  L+   +     +S    I I + +D+S SM    LQ
Sbjct: 47  TVRYYLRHLPFALRCAAVALLIVALARPQSVDEGSTSNTEGIDIVLAIDISTSMLAQDLQ 106

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                                                     +I    + AGN +     
Sbjct: 107 P----------------------------------------DRIQAAKQVAGNFI----- 121

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHH 283
                     RIG +A+         +PL+ +   +++ L +L      + T     +  
Sbjct: 122 ----TDRPGDRIGLVAFAGEAFTQ--SPLTTDQGTLQTLLGRLRSGVVEDGTAIGNGLAT 175

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           A   L      S          K +I +TDGEN+        +  L   E  R+ G+++Y
Sbjct: 176 AINRLRESNAKS----------KVIILLTDGENNRG-----EIAPLTAAEIARDQGIRVY 220

Query: 344 SVAVS----------------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFD 381
           ++ V                          + + L      + G++F   D+ +L   +D
Sbjct: 221 TIGVGTRGTAPYPTVDFFGNPTVVQAKVQIDEKILGEIADLTGGRYFRATDNAKLQSIYD 280

Query: 382 KITDKIQEQSVRIA 395
           +I +++++  V I+
Sbjct: 281 EI-NQLEKSKVEIS 293


>gi|322689979|ref|YP_004209713.1| cell surface protein [Bifidobacterium longum subsp. infantis 157F]
 gi|320461315|dbj|BAJ71935.1| putative cell surface protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 794

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 60/306 (19%), Positives = 105/306 (34%), Gaps = 65/306 (21%)

Query: 125 PSALTNLSLRSTGIIERSS--ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +    L++             N  + I +VLDVS SM +      N    +        
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVTNQPLDIVLVLDVSGSMAEKIASGWNQPTKID------- 128

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                   S  T  +K+  A A  N KI D    +   LV           N   R G  
Sbjct: 129 --------SLKTAVNKFINATAAENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWS 180

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
           +YN        + L+ +++ + S +N L+    T+   A + A   L  +  ++      
Sbjct: 181 SYN---YTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRANA----- 232

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQD 355
              KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V +         +
Sbjct: 233 ---KKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSN 289

Query: 356 LLRKC------------------------------TDSSGQFFAVNDSRELLESFDKITD 385
           L +                                 ++S  + A  D+ +L   F+ I  
Sbjct: 290 LNKYMHGISSNYPDATATSSEHLWGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQ 349

Query: 386 KIQEQS 391
           +I + +
Sbjct: 350 EITKTA 355


>gi|221639828|ref|YP_002526090.1| hypothetical protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
 gi|221160609|gb|ACM01589.1| Hypothetical Protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
          Length = 566

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 314 GENSGASAYQNTLN-------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
           G +   S++ +TL+       T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G 
Sbjct: 480 GVSGRYSSWVSTLDPTVKNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGH 539

Query: 367 FFAVNDSRELLESFDKITDKIQE 389
           ++      ++   F  I   I +
Sbjct: 540 YY-ATVGPQIRTVFHSIASHITQ 561



 Score = 61.1 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 48/364 (13%), Positives = 105/364 (28%), Gaps = 87/364 (23%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ +  +    A+D+    + R ++Q  LD AVL+  +   S                  
Sbjct: 31  MLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAASLTQS---------------RSP 75

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            + ++ ++ +          +     +N+             + A Y +PT       L+
Sbjct: 76  AEVVEDYVTKAGLEDYLDEPVVNANTLNVRS---------VTATAAYSMPT---VFMKLL 123

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                     ST     S+    + I +VLD+S SM        +  +N+          
Sbjct: 124 DIDRLEAPAVSTAEERVSN----VEISLVLDMSNSMVTDGTNPRDRLDNLKVAARDFIDI 179

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
                 S        + +  P   +++     A  L      + ++  +  V      + 
Sbjct: 180 VMAGANSGLDGAPVISISIVPYTGQVNA---GADLLATYPNVSHRQPYSSCVEFAASDFT 236

Query: 245 IGIVGN------------------------------------QCTPLSNNLNEVKSRLNK 268
              + N                                      TP S++   +K+ +++
Sbjct: 237 TTALANGATLTGSGNSELFSSSSSTQTPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDR 296

Query: 269 LNPYENTNTYPAMHHAYR-----------ELYNEKESSHNTIG------STRLKKFVIFI 311
           L+   +T     M                 L  + + +    G      S  + K V+ +
Sbjct: 297 LSGEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLM 356

Query: 312 TDGE 315
           TDG+
Sbjct: 357 TDGQ 360


>gi|193214188|ref|YP_001995387.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
 gi|193087665|gb|ACF12940.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
          Length = 340

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 88/274 (32%), Gaps = 92/274 (33%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I + +D+S SM                                       A    P 
Sbjct: 97  GIDIVLAIDLSGSM--------------------------------------LAEDFEPK 118

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
           NR I+     A + ++           LS RIG + ++         PL+ +   + + +
Sbjct: 119 NR-IEAAKSVATDFIHQ---------RLSDRIGLVVFSGKSFTQ--CPLTLDYRLLTNFI 166

Query: 267 NKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           ++L       + T    A+  A   L            ST   K +I +TDG+N+     
Sbjct: 167 SELKAGTIEEDGTAIGTAIATATNRL----------RESTAKSKVIILLTDGQNNAG--- 213

Query: 323 QNTLNTLQICEYMRNAGMKIYSVA----------------------VSAPPEGQDLLRKC 360
              +  +   E     G+KIY+V                       +    +   L R  
Sbjct: 214 --EIEPVTAAELAAALGIKIYTVGAGTRGYARYPIPDPLFGKRYVQMKVDVDDSTLTRIA 271

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             S G++F   D   L +++ +I D++++  V +
Sbjct: 272 RISGGRYFRATDLESLKKTYHEI-DELEKTKVEV 304


>gi|103487755|ref|YP_617316.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
 gi|98977832|gb|ABF53983.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
          Length = 666

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 53/159 (33%), Gaps = 31/159 (19%)

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEK---ESSHNTIGSTRLKKFVIFITDGEN--- 316
            + +  L P   T     M    R L       + +        + + ++F+TDG     
Sbjct: 512 NTYVQSLQPLGGTYHDAGMVWGARLLSPTGLFADENATAPNDRPISRHIVFMTDGAMAPN 571

Query: 317 --------------------SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                                     ++     Q+C   R  G+ I+ V+        D 
Sbjct: 572 MGNLTFQGYEFLMHRVGGTSDSDLRDRHNNRFTQLCRAARQRGITIWVVSFGV--GSNDS 629

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           L  C  S GQ F  +++ EL E F  I  +I +  +R+A
Sbjct: 630 LNNCASS-GQAFEADNAAELNEQFQAIARQISK--LRLA 665



 Score = 56.8 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 96/314 (30%), Gaps = 34/314 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A II V   F+  A+D+      + ++Q A DA VL+G  ++          +  +   
Sbjct: 29  AAAIIPVI-GFVGSAVDIGRAYMTQLRLQQACDAGVLAGRRAM-------GGASYDEAAQ 80

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               K    +  +  Y        ++    +             E +A   +PTE +F+ 
Sbjct: 81  AEANKMFNFNFPEAKYGATGILFSSRALNASD-----------VEGQASAVLPTELMFM- 128

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                    LS   T  +E S+    + + +VLDV+ SM         +      +  + 
Sbjct: 129 --FGKEEFRLSADCTAKLEISN----VDVMLVLDVTGSMAQTNAGDSVNRITALKDATMD 182

Query: 182 PPPPKKSFWSKNTTKS-KYAPAPAPANRKIDVLIESAGNLVN--SIQKAIQEKKNLSVRI 238
                 +    +        P  + AN    +L ++   L +  ++       + +    
Sbjct: 183 FFDTLTNADVGDGRLRFGVVPYSSTANVGQILLAKNPAWLADTVTLPSRTPIFREVYTET 242

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLN-----KLNPYENTNTYPAMHHAYRELYNEKE 293
           GT   +           +   +      N      L P  NT   P+    Y +     +
Sbjct: 243 GTETSDDYTDSPTTYSSNWTNDGTVPASNSAACAALTPPANTTPSPSGSPDYNQTGQYVD 302

Query: 294 SSHNTIGSTRLKKF 307
                     ++ +
Sbjct: 303 GDTRVTTYDTVQTY 316


>gi|312133821|ref|YP_004001160.1| von willebrand factor (vwf) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773110|gb|ADQ02598.1| Von Willebrand factor (VWF) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
          Length = 794

 Score = 73.8 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 60/306 (19%), Positives = 105/306 (34%), Gaps = 65/306 (21%)

Query: 125 PSALTNLSLRSTGIIERSS--ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +    L++             N  + I +VLDVS SM +      N    +        
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVTNQPLDIVLVLDVSGSMAEKIASGWNQPTKID------- 128

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                   S  T  +K+  A A  N KI D    +   LV           N   R G  
Sbjct: 129 --------SLKTAVNKFINATAAENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWS 180

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
           +YN        + L+ +++ + S +N L+    T+   A + A   L  +  ++      
Sbjct: 181 SYN---YTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRANA----- 232

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQD 355
              KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V +         +
Sbjct: 233 ---KKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSN 289

Query: 356 LLRKC------------------------------TDSSGQFFAVNDSRELLESFDKITD 385
           L +                                 ++S  + A  D+ +L   F+ I  
Sbjct: 290 LNKYMHGISSNYPDATATSSEHLWGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQ 349

Query: 386 KIQEQS 391
           +I + +
Sbjct: 350 EITKTA 355


>gi|117618125|ref|YP_856000.1| hypothetical protein AHA_1462 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559532|gb|ABK36480.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 460

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 51/142 (35%), Gaps = 23/142 (16%)

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESS--------HNTIGSTRLKKFVIFITDG 314
           +  L+ L+   NTNT   +   +R L  + +              G    +K ++  +DG
Sbjct: 325 RQALDTLHAAFNTNTAEGVMWGWRLLSPQWQGRWQQGAAELPRPYGQADNRKILVLFSDG 384

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           E+ G  A       L +C  M+  G+++Y+VA          + +C              
Sbjct: 385 EHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFEGDAR---FVAQCASERS--------- 432

Query: 375 ELLESFDKITDKIQEQSVRIAP 396
               ++   +  I+    R+A 
Sbjct: 433 ---LAYKATSGNIRTVLTRLAS 451


>gi|23466092|ref|NP_696695.1| hypothetical protein BL1539 [Bifidobacterium longum NCC2705]
 gi|322691915|ref|YP_004221485.1| cell surface protein [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|23326823|gb|AAN25331.1| hypothetical protein with gram positive cell wall anchoring domain
           [Bifidobacterium longum NCC2705]
 gi|320456771|dbj|BAJ67393.1| putative cell surface protein [Bifidobacterium longum subsp. longum
           JCM 1217]
          Length = 794

 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 60/306 (19%), Positives = 105/306 (34%), Gaps = 65/306 (21%)

Query: 125 PSALTNLSLRSTGIIERSS--ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +    L++             N  + I +VLDVS SM +      N    +        
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVTNQPLDIVLVLDVSGSMAEKIASGWNQPTKID------- 128

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                   S  T  +K+  A A  N KI D    +   LV           N   R G  
Sbjct: 129 --------SLKTAVNKFINATAAENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWS 180

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
           +YN        + L+ +++ + S +N L+    T+   A + A   L  +  ++      
Sbjct: 181 SYN---YTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRANA----- 232

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQD 355
              KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V +         +
Sbjct: 233 ---KKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSN 289

Query: 356 LLRKC------------------------------TDSSGQFFAVNDSRELLESFDKITD 385
           L +                                 ++S  + A  D+ +L   F+ I  
Sbjct: 290 LNKYMHGISSNYPDATATSSEHLWGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQ 349

Query: 386 KIQEQS 391
           +I + +
Sbjct: 350 EITKTA 355


>gi|149909538|ref|ZP_01898192.1| TadG-like protein [Moritella sp. PE36]
 gi|149807443|gb|EDM67394.1| TadG-like protein [Moritella sp. PE36]
          Length = 405

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 64/407 (15%), Positives = 140/407 (34%), Gaps = 39/407 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F   T A D A  +  + +++ A +AAVL+  A    +      +    + 
Sbjct: 14  LFAMMIPAFFGIFTLASDGARALQSKARLEDAAEAAVLAIAAHNADNSGSSSGSAINKKI 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           ++ +  Q  + ++  S I+    +    A+      +N   +Y      QYEI  +   L
Sbjct: 74  ASDWIGQYMQDMQAISDIKITKLNCNDIAECK-EGLENGESRY-----FQYEILAKTNHL 127

Query: 121 KGLIPSALT-----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                +  T     +  +  +    +     ++ +  V D S SM + +    N      
Sbjct: 128 SWFPGNNSTAGFGESFDVVGSATARKFQSE-SVDVMFVSDFSGSMNNKWSGGSNSRRYKD 186

Query: 176 SNKYLLPPPPKKSFWS--KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
             K +     +   ++    TT ++          +         +  +  + A +    
Sbjct: 187 LIKIIGDVIKELDKFNNAHTTTTNRVGFTGFNTYTRKTADNSCYQDQYD--RSAGRTVNK 244

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
           +    G  + + G        +++N NE K+ +    P   T +Y  +    + +    E
Sbjct: 245 IFEVKGCKSRSSGGAKFHDIAMTDNYNEFKNTIKYFKPGGGTASYQGIIRGAQMMDAAPE 304

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM------------RNAGMK 341
                    R ++ +I ++DG +S  S   N L    +C  +            +    K
Sbjct: 305 P--------RPRRIMIILSDGIDSKRSRA-NKLVEEGMCSKILLKLGNANTSDGKAIKTK 355

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDKI 387
           +  V     P     L KC       +  N+  + L +  + I+++I
Sbjct: 356 MAVVGFDYNPASNPSLAKCV-GEHNVYGANNPEDVLNKILELISEEI 401


>gi|46190503|ref|ZP_00121395.2| COG2304: Uncharacterized protein containing a von Willebrand factor
           type A (vWA) domain [Bifidobacterium longum DJO10A]
 gi|189440499|ref|YP_001955580.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
 gi|189428934|gb|ACD99082.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
          Length = 794

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 60/306 (19%), Positives = 105/306 (34%), Gaps = 65/306 (21%)

Query: 125 PSALTNLSLRSTGIIERSS--ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +    L++             N  + I +VLDVS SM +      N    +        
Sbjct: 76  GTYTVALNVTGAKSAGTGEIVTNQPLDIVLVLDVSGSMAEKIASGWNQPTKID------- 128

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKI-DVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                   S  T  +K+  A A  N KI D    +   LV           N   R G  
Sbjct: 129 --------SLKTAVNKFINATAAENAKITDQSQRNRIALVKFAGTEKTSVGNDFYREGWS 180

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
           +YN        + L+ +++ + S +N L+    T+   A + A   L  +  ++      
Sbjct: 181 SYN---YTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRANA----- 232

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQD 355
              KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V +         +
Sbjct: 233 ---KKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSN 289

Query: 356 LLRKC------------------------------TDSSGQFFAVNDSRELLESFDKITD 385
           L +                                 ++S  + A  D+ +L   F+ I  
Sbjct: 290 LNKYMHGISSNYPDATATSSEHLWGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQ 349

Query: 386 KIQEQS 391
           +I + +
Sbjct: 350 EITKTA 355


>gi|154488145|ref|ZP_02029262.1| hypothetical protein BIFADO_01716 [Bifidobacterium adolescentis
           L2-32]
 gi|154083618|gb|EDN82663.1| hypothetical protein BIFADO_01716 [Bifidobacterium adolescentis
           L2-32]
          Length = 835

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 49/301 (16%), Positives = 95/301 (31%), Gaps = 80/301 (26%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                NL++      E       I + +VLD S SM                        
Sbjct: 263 GKYTLNLNVVGKDTRESHETTEKIEVVLVLDTSGSMN----------------------- 299

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS--VRIGTIA 242
                                  +++  L E+A + +++ +      ++ +  VRI    
Sbjct: 300 --------YCMDGSQRGCNKSNPKRLTALKEAATSFIDATETTNDTIQDENSKVRIAIAQ 351

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
           +  G      + L+++   +KS +++L+    T     M  A   L   +  +       
Sbjct: 352 F--GQTSGVVSSLTSDTAALKSSVSRLSANGATPADKGMAAAQTALLRARPGA------- 402

Query: 303 RLKKFVIFITDG----ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV----------- 347
             KK VIF  DG    +N+ ++   N   T  +   M++AG  IYS+ +           
Sbjct: 403 --KKVVIFFADGVPTTQNTFSTRVANDAVTTAL--AMKSAGTLIYSIGIFEGANPEQQSF 458

Query: 348 --SAPPEGQDLLRKCT-----------------DSSGQFFAVNDSRELLESFDKITDKIQ 388
                 +    +   +                  + G + A N + +L + FD I  +I 
Sbjct: 459 GNRENDQANQFMHAVSSNYPNATAYNKTNWGTGSNLGYYKATNSADDLTKIFDDIQKEIT 518

Query: 389 E 389
            
Sbjct: 519 T 519


>gi|166033217|ref|ZP_02236046.1| hypothetical protein DORFOR_02942 [Dorea formicigenerans ATCC
           27755]
 gi|166027574|gb|EDR46331.1| hypothetical protein DORFOR_02942 [Dorea formicigenerans ATCC
           27755]
          Length = 1465

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 97/295 (32%), Gaps = 20/295 (6%)

Query: 56  KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
           + +      +     ++   ++   NA D + K    I     +         ++ +   
Sbjct: 31  QVNAAENAARTTTTDNVTINNWHDANALDDSTKNVGRI-WTDKSVSAGDVTLTSREKESG 89

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                KG     L  LS  S+         + + I +VLDVS SM+D      N      
Sbjct: 90  TATIKKGADSDFLVGLSALSSTAKITGQTTVPLDIVLVLDVSGSMDDPMGSGDNTKRIDA 149

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
               +       + +   + K     A      +I V+  +         K  +   +  
Sbjct: 150 LKAAV-------NSFIDGSAKVNDQRADVNKQNRIAVVKFAG-------NKTDKIGNDQY 195

Query: 236 VRIGTIAYNIGIVGNQCTPLSNN-LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
            +     YN   V +     ++   +E ++ +N L P   T    AM      +   K  
Sbjct: 196 SQN-RYWYNYTQVVSGYKAYTSGNKSEWETTVNALKPAGCTAADYAMDLTKTLVDQSKTD 254

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR--NAGMKIYSVAV 347
           ++N      +K+ VIF TDGE +  S + + +    I    +       IY++ +
Sbjct: 255 ANNNADRKNVKRVVIFFTDGEPNHQSGFDDDVANDAI-TSAKTIKTDADIYTIGI 308


>gi|317483048|ref|ZP_07942050.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915549|gb|EFV36969.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 813

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 55/304 (18%), Positives = 104/304 (34%), Gaps = 68/304 (22%)

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL--QKHNDNNNMTSNKYLLPP 183
               N++   +        N  + I +VLDVS SM D      K  D      N ++   
Sbjct: 101 KVALNVTGAKSAGTGAIVTNQPLDIVLVLDVSGSMADNLSGGPKKIDALKTAVNGFIDAT 160

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
             + +  +  + +++ A        K  V                    N   R G  +Y
Sbjct: 161 ADENAKITDQSQRNRIALVKFAGTEKTSV-------------------GNDFYREGWSSY 201

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
           N        + L+ +++ + S +N L+    T+   A + A   L  +  ++        
Sbjct: 202 N---YTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQPRANA------- 251

Query: 304 LKKFVIFITDGENSGASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPE----GQDLL 357
            KK VIF TDGE +  S +  T+    +   + +++AG  IYS+ V +         +L 
Sbjct: 252 -KKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGVVSGANPGDTSSNLN 310

Query: 358 RKC------------------------------TDSSGQFFAVNDSRELLESFDKITDKI 387
           +                                 ++S  + A  D+ +L   F+ I  +I
Sbjct: 311 KYMHGISSNYPDATATSSEHLWGKSWNANLGDRAETSSYYKAATDAGQLNNIFESIYQEI 370

Query: 388 QEQS 391
            + +
Sbjct: 371 TKTA 374


>gi|283852082|ref|ZP_06369356.1| von Willebrand factor type A [Desulfovibrio sp. FW1012B]
 gi|283572472|gb|EFC20458.1| von Willebrand factor type A [Desulfovibrio sp. FW1012B]
          Length = 442

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 64/462 (13%), Positives = 139/462 (30%), Gaps = 111/462 (24%)

Query: 10  FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK 69
                 A+DL+ +    NQ+Q+A+DAA L+G   +  D  + +   K   T+ +      
Sbjct: 1   MAAAGVAVDLSRVYVAHNQLQNAVDAAALAGSLQLPDDPDVTNGKVKAAVTANLA----- 55

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALT 129
                      +A DI   +                ++KA  ++    +         + 
Sbjct: 56  -------LNDPDATDIQVTSG-------GATRSVCVDAKANVDMTLTKVI-------GIG 94

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND-------------NNNMTS 176
           + ++ +      +     I + +VLD + SM+   +    D              ++  S
Sbjct: 95  DTTVTAEACAGYN----DIELVLVLDSTGSMKGSPIDSAKDAARDLVNLIMPASTSSTRS 150

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
              L+P   K      +   ++  P       +      + G L     +          
Sbjct: 151 KIGLVPFQGKVRIDGSDPVTAERNPDGVGPGCRNADGTLNTGKLKVEYSRTATSTNIFYG 210

Query: 237 RI--GTIAYNIGIVG--NQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELY 289
               G   +        +    LS++ N + + +  +N       T     +    + L 
Sbjct: 211 YTLSGVSTFTDKTCSGMSPIRALSSDKNTILNNIEAINAGAVTSGTLISEGIKWGRKVLS 270

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGE-----------------NSGA------------- 319
            E      +    +++K +I +TDG+                 N+               
Sbjct: 271 PEAPYVEGST-DKKVRKIMIVLTDGDTEDGRCGGNFASASKTVNTYWTNAYFGQGLKPDT 329

Query: 320 --------SAYQNTLNTLQIC--------------EYMRNA---GMKIYSVAVSAPPE-G 353
                   S    TL  +  C              +  +N     ++I+SV   A     
Sbjct: 330 ATSPYATLSTATATLAQIPDCKDGGKLNQFVLDEADAAKNDLNYPVEIFSVRFGASDATD 389

Query: 354 QDLLRKCTDS----SGQFFAVNDSRELLESFDKITDKIQEQS 391
           + L++K   S    +  ++    S  + + F KI  ++ ++ 
Sbjct: 390 KSLMQKIASSKPGTTDHYYDAPSSTGIQDMFKKIGQQLGQRL 431


>gi|88801581|ref|ZP_01117109.1| batA protein [Polaribacter irgensii 23-P]
 gi|88782239|gb|EAR13416.1| batA protein [Polaribacter irgensii 23-P]
          Length = 334

 Score = 73.4 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 94/277 (33%), Gaps = 93/277 (33%)

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
           R+  + +++  N  I I M +DVS SM    L+ +                         
Sbjct: 78  RNVAVSKKTKTNSGIDIIMAIDVSASMLARDLKPN------------------------- 112

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                          +++ L + A + V+      +   +   RIG + Y         T
Sbjct: 113 ---------------RLEALKKVAIDFVD------RRPND---RIGIVVYAGESFTQ--T 146

Query: 254 PLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           P++++ N VK  +++L        T     +      L            ST   K +I 
Sbjct: 147 PITSDKNIVKRTISELQWGQLDGGTAIGMGLGSGVNRL----------KESTAKSKVIIL 196

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------APPEGQ----- 354
           +TDG N+  +    T   L      R   +K+Y++ +             P  G+     
Sbjct: 197 LTDGVNNAGNIDPRTATEL-----ARELEIKVYTIGIGTNGMADFPWSKDPRTGKLNFRK 251

Query: 355 -------DLLRKCTD-SSGQFFAVNDSRELLESFDKI 383
                   LL++    + G++F   D++ L E +D+I
Sbjct: 252 QQVEIDEKLLQEIATATDGKYFRATDNQSLKEIYDEI 288


>gi|152990340|ref|YP_001356062.1| von Willebrand factor type A domain-containing protein
           [Nitratiruptor sp. SB155-2]
 gi|151422201|dbj|BAF69705.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 289

 Score = 73.0 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 82/264 (31%), Gaps = 70/264 (26%)

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
              +  +     + + LD S SME+    +                              
Sbjct: 67  SSIKLDDRKGRDLVLALDASGSMEESLYDEK----------------------------- 97

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                      K +V+   A N      K   +       IG + +          PL+ 
Sbjct: 98  ----------SKFEVVKSMAQNFF---HKRFDDN------IGIVIFGSFAYI--AAPLTY 136

Query: 258 NLNEVKSRLNKL---NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
           +   +   +N L       NT     +    + L  +             +K +I ITDG
Sbjct: 137 DTKALDFLINYLEPSIAGNNTAIGEGLWQGIKALQADTAK----------QKVLILITDG 186

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
            ++  S     ++  Q  E  +  G+KIY++ +    +   L +   +S G+FF      
Sbjct: 187 HHNSGS-----ISPRQAVEKAKKLGIKIYTIGLGDADK-HLLEQIAKESGGKFFYAKSEE 240

Query: 375 ELLESFDKITDKIQEQSVRIAPNR 398
           +L   F ++ +K++   +R     
Sbjct: 241 DLQSIFSEL-NKLEPSPIRSGSYE 263


>gi|323488845|ref|ZP_08094085.1| hypothetical protein GPDM_05856 [Planococcus donghaensis MPA1U2]
 gi|323397543|gb|EGA90349.1| hypothetical protein GPDM_05856 [Planococcus donghaensis MPA1U2]
          Length = 857

 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 86/250 (34%), Gaps = 69/250 (27%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
           L     ++   E  ++ + +V+D S SM  L                             
Sbjct: 391 LPVEMEVKGKHELPSLGLMIVMDRSGSMMGL----------------------------- 421

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                           K+++  E+A   V  ++            +G IA++        
Sbjct: 422 ----------------KMELAKEAAARSVELLRSDDT--------LGVIAFDDQPWEILP 457

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
           T   ++  +   ++  + P   T  Y ++  AY EL + +            +K +I +T
Sbjct: 458 TGKVDDPKKAADKILSITPGGGTEIYRSLEQAYTELEDLELQ----------RKHIILLT 507

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           DG++S ++      +   + E  ++  + + +V++    +   L +     SG+F+ V D
Sbjct: 508 DGQSSTSN------DYDALIENGKDHNITLSTVSIGQDADRNLLEQLAGTGSGRFYDVTD 561

Query: 373 SRELLESFDK 382
           +  +     +
Sbjct: 562 ATTIPAILSR 571


>gi|86747937|ref|YP_484433.1| hypothetical protein RPB_0811 [Rhodopseudomonas palustris HaA2]
 gi|86570965|gb|ABD05522.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 435

 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 74/443 (16%), Positives = 142/443 (32%), Gaps = 82/443 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID A    IR ++QSA DAAVL   ++   +RT        +Q 
Sbjct: 28  IFAIALLPILGFIGAAIDYATANRIRTKLQSAQDAAVLLAVSNSEINRTTAQAKADAEQF 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                                 G     A I I   +N+  +    + A +       FL
Sbjct: 88  FN-----------------ATIGAYGLTATIKIEVTENDGKR---SATADFTSTVTTNFL 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             LI      +  RST  + R          ++LD S SM               ++   
Sbjct: 128 -NLIGYPTLAIGNRSTSTVSRPIYQ---DFYLLLDNSPSMGVAATTADIATMVGNTSDKC 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  S  +     +K          +IDV+ ++   L ++             R+  
Sbjct: 184 AFACHDLSDSNNYYNLAKKLGVKM----RIDVVRQAVQQLTSTATLMTAVNNQ--FRMAV 237

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI- 299
                       T ++ +L+   S +         +        Y        +S     
Sbjct: 238 YTLGGSCASLGLTTIA-SLSSAMSSVQ--TAAGAIDLMSIPKQNYNNDQCTDFNSALAAM 294

Query: 300 ----------GSTRLKKFVIFITDGE---NSGASAYQNTLN--------TLQICEYMRNA 338
                      + + +K++ F++DG    N+ +   Q T++        T+  C+ M++ 
Sbjct: 295 NTTIPSSGTGTAAQPQKWLFFVSDGVADFNNPSGCTQPTVSGGRCQEPLTVTQCKAMKDR 354

Query: 339 GMKI---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDS 373
           G++I   Y+  ++ P                            ++ C  S   +F V+ +
Sbjct: 355 GIQIAVLYTTYLALPTNQWYNDHIAPFNAGPYGPSVNSQIAAKMKSCA-SPDFYFEVSPT 413

Query: 374 RELLESFDKITDKIQEQSVRIAP 396
           + + E+ D +  K   ++ R++ 
Sbjct: 414 QGISEAMDALFKKAVAKA-RLSS 435


>gi|325678004|ref|ZP_08157643.1| von Willebrand factor type A domain protein [Ruminococcus albus 8]
 gi|324110284|gb|EGC04461.1| von Willebrand factor type A domain protein [Ruminococcus albus 8]
          Length = 812

 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 53/347 (15%), Positives = 118/347 (34%), Gaps = 45/347 (12%)

Query: 46  SDRTIKDPTTKKDQTSTIFKKQ-IKKHLKQGSYIRENAGDIAQKAQINITKD-KNNPLQY 103
            D  + +     + T  + K   ++  + +        G + +   I  T D +   L Y
Sbjct: 107 EDCAVTEVIVSMEATGNLQKTTTVESIMNKDMLCTGVVGLVGEPFSIETTSDYEKATLTY 166

Query: 104 IAESKAQYEIPTENLFLKGLIPSA--LTNLSLRSTGIIERSSENLA-ISICMVLDVSRSM 160
           + +     +   +NL              L           S N    S  M++D     
Sbjct: 167 VIDKNKLGDTEFDNLMFLWYDEKKDEFVELDTILDEENSTVSINTPHFSKYMLVDK---- 222

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                ++  D     S  +     P  +    + + S     P    RK+     +  N 
Sbjct: 223 -----KEWFDAWKRASLYFQDEYEPLAAAICYDCSGSMSGNDP-KGYRKL-----AIDNF 271

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
           ++S+         L+ +   I++         +  S+N  E+K  +N       TN   +
Sbjct: 272 IDSMT--------LTDKTALISFEDE--AKLVSEFSDNKEELKGLVNPYF-GGGTNVRAS 320

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE-NSGASAYQNTLNTLQICEYMRNAG 339
           +  A  +L                 + +I ++DG+ N   +   NT++ L   +   +  
Sbjct: 321 VEMAIEQL---------NTVQHWYTRHIILLSDGDVNININLANNTVDDLI--KKAVDNN 369

Query: 340 MKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
           +KI+++ + +  + Q L + C + + GQ+F    + +L   +  ++ 
Sbjct: 370 IKIHTIGLGSGADNQKL-KDCAEYTGGQYFTAETAEKLDAIYKDLSK 415


>gi|90418447|ref|ZP_01226359.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338119|gb|EAS51770.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 636

 Score = 73.0 bits (177), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 60/223 (26%), Gaps = 73/223 (32%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
           N        TPL+  L  V   ++ +     TN    +   +R L      +        
Sbjct: 415 NSTCATTPITPLTKTLKTVTDAIDVMGAQGATNIPHGLAWGWRLLTARPPFTEGRSHDEP 474

Query: 304 LK-KFVIFITDGENS-------------------------------GASAYQNTLNTLQI 331
              K ++ +TDG N+                               G+S+ +        
Sbjct: 475 DNLKVLVLMTDGNNTYNLNSGGRPLEIRDYNRSTYGSYGYGAAYSHGSSSRKPGRIYDGT 534

Query: 332 CEYMRN-------------------------------AGMKIYSVAVSAPPEG--QDLLR 358
               ++                                G+ I+++A         + L+ 
Sbjct: 535 TGNAKDYSVDSYVAAMDQNVAKVCENVKADGRKPGGTDGILIFTIAFDLRDGEPVKKLME 594

Query: 359 KCTD------SSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            C        S   ++      EL  +F  IT++I    +RIA
Sbjct: 595 DCASNGLIDASEKLYYDAQSQEELAAAFQSITEQISS--LRIA 635



 Score = 41.0 bits (94), Expect = 0.35,   Method: Composition-based stats.
 Identities = 52/355 (14%), Positives = 106/355 (29%), Gaps = 70/355 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + + V  L    A+DL+ I      +Q A D        + ++       T   D  
Sbjct: 37  VFGLTLPVLALCFATAVDLSGIYGANRSLQQAAD-------VAALAAGREYGRTQDADYL 89

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S++ +     +    +             +  +T         I +  A+ ++PT   F 
Sbjct: 90  SSVSEAFFFHNAGDETRGTTQFSYDGVFREDGLT---------ILKVTARRQLPT--FFG 138

Query: 121 KGLI---PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
             L+      L           E   +N +I + +VLD S SM+D               
Sbjct: 139 DALMWVTGGKLDWRQFPLYAKSEIVVQNRSIELALVLDNSGSMQD--------------- 183

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS-V 236
                                  P    +  KID++ ++A +L      + +       V
Sbjct: 184 ----------------------RPRSGGSKSKIDIIKDAAEDLAKQFLSSDKGSTEEFPV 221

Query: 237 RIGTIAYNIGI-VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
           +   + ++  + VG Q         + +S ++  N         A    +  + +     
Sbjct: 222 QFAVVPFSSSVNVGPQYKNADWMDTQGRSPIHHENLDWGGWLSGATSGGWEWIRDRGWVY 281

Query: 296 HNTIGSTRLKK----FVIFITDGENS------GASAYQNTLNTLQICEYMRNAGM 340
                   + +    +   IT GE          + Y++   T + C   R  G+
Sbjct: 282 TAPSSGAPMARYNGSYWTRITTGEPLTRFYVYDNARYKSQFGTWRGCVEARPNGL 336


>gi|87308177|ref|ZP_01090319.1| hypothetical protein DSM3645_21307 [Blastopirellula marina DSM
           3645]
 gi|87289259|gb|EAQ81151.1| hypothetical protein DSM3645_21307 [Blastopirellula marina DSM
           3645]
          Length = 1032

 Score = 72.6 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 65/158 (41%), Gaps = 17/158 (10%)

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           G I ++            +N     +++ KL+    TN  P +   +R+L N        
Sbjct: 495 GVIGFDSQAQRIVPIRKVDNPGMFVAQVRKLSASGGTNMTPGVALGFRDLQNVDAG---- 550

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                  K +I ++DG+    +  Q       I   M+  GM + +VAV +  + + +  
Sbjct: 551 ------VKHMIVLSDGQTEPGNVAQ-------IASDMKKMGMTVSAVAVGSDADQKLMAT 597

Query: 359 KCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
              +  G+F+AVN+ + +   F +   ++ +  V+ AP
Sbjct: 598 VARNGGGKFYAVNNPKAIPRIFMREARRVAQPLVKEAP 635


>gi|125535226|gb|EAY81774.1| hypothetical protein OsI_36948 [Oryza sativa Indica Group]
          Length = 633

 Score = 72.6 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 91/288 (31%), Gaps = 70/288 (24%)

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAI 148
           A + ++     P     ++   +++              L ++       ++    ++ I
Sbjct: 28  APVKVSTTPIFPTIPRGQTNKDFQV--------------LLHVEAPPAANLK---GHVPI 70

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            +  VLDVS SM D        +                                     
Sbjct: 71  DVVAVLDVSGSMNDPVAAAAAASPESNLQA-----------------------------S 101

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLNEVKS 264
           ++DVL  S   ++  +            R+  +A+N G V    + L     +  +    
Sbjct: 102 RLDVLKASMKFIIRKLDDGD--------RLSIVAFNDGPVKEYSSGLLDVSGDGRSIAGK 153

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
           ++++L     T   PA+  A + L           GS     F++ +TDG+++    +  
Sbjct: 154 KIDRLQARGGTALMPALEEAVKIL------DERQGGSRNHVGFILLLTDGDDTTGFRWTR 207

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
                 +      A   +++  + A  + + LL     S G +  V+D
Sbjct: 208 DAIHGAV------AKYPVHTFGLGASHDPEALLHIAQGSRGTYSFVDD 249


>gi|209809179|ref|YP_002264717.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
 gi|208010741|emb|CAQ81132.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
          Length = 422

 Score = 72.6 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 62/428 (14%), Positives = 141/428 (32%), Gaps = 64/428 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F   T A D A  +  + +++ A + A L+  A    ++      +     
Sbjct: 14  LFAMMIPALFGIFTLASDGARAIQTKARIEDAAEVATLAVSAHNDPNQDYGGGGSPSSAN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDI-------AQKAQINITKDKNNPLQYIAESKAQYEI 113
             I    I  ++     I E              KA + + + +    +    +  +   
Sbjct: 74  QQIVTDYINAYISDVDSINEIKVYKRNCEEIPECKAGLAVGEPRYFEHEVGVTTSQKSWF 133

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL-------- 165
           P  +  +         + S     +  +     A+ +    D S SM D +         
Sbjct: 134 PGNDAIVGM-----GDSFSTSGHSLARKYQSE-AVDVMFAADFSGSMGDRWTGGNKKYED 187

Query: 166 ------------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS-KYAPAPAPANRKIDV 212
                       QK ND  +  ++  +      +  +S+ +  S  +       ++    
Sbjct: 188 LIDIIDSISKELQKFNDLEHNDNDNTMGITAYNEYTYSQYSGSSGGWWGDDCYLSQAESD 247

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
                 ++  +I     EK          +YN G   +   PL++N + V   +++  P 
Sbjct: 248 GFWGGVSISKTIDGLWNEKSKDHCNN---SYNSGRFND--IPLTSNFDVVNQDVSRFWPE 302

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG---ENSGASAYQN----- 324
             T++Y A+    + L             T  ++ +I ++DG   +N+  S+  N     
Sbjct: 303 GGTSSYQALIRGAQLLTY----------GTNSRRLLIVLSDGMDTDNNLTSSLVNAGMCR 352

Query: 325 ----TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLES 379
                L + +  +  R    ++  +     P     L+ C   +   +   +S + L   
Sbjct: 353 DIQQGLESDKTLDN-RPIRAQMAVIGFDYEPSENQALKDCV-GAENVYKAENSDDILNTI 410

Query: 380 FDKITDKI 387
            + I+++I
Sbjct: 411 LELISEEI 418


>gi|163742980|ref|ZP_02150363.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
 gi|161383663|gb|EDQ08049.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
          Length = 560

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL 377
             +       T  +C   +N G+ +Y++   AP  G  +L+ C  S    F V    E+ 
Sbjct: 485 YWNTSTKDARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVR-GLEIR 543

Query: 378 ESFDKITDKIQE 389
           ++F  I   I++
Sbjct: 544 DAFASIATSIRQ 555



 Score = 66.1 bits (159), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 95/368 (25%), Gaps = 78/368 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   ++S         +DL  +   R  +Q  LD AVL+     +          +   +
Sbjct: 42  MVGFLLS-MLAVGGIGVDLMRMERDRTILQYTLDRAVLAAAD--LDQPLPPAAVVQDYLS 98

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K     + +     +                                      F 
Sbjct: 99  KAGLNKYYTPPVAETGLGFKKVQSTIDTT-----------------------------FE 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------DLY 164
             ++  +     +              + I +VLDVS SM                 D  
Sbjct: 130 THMLKFSSGQ-DMPLYATSRAEESIDGLEISLVLDVSGSMGSNSRLANLKVAAKDFVDTM 188

Query: 165 LQKHNDNN-NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
           +    DN  +++   Y            +  T  ++A +             +       
Sbjct: 189 IANTIDNKMSISIIPYATQVSLPTELMDQYNTTDEHAYSNCVNFVGSHFQTTALST-TEE 247

Query: 224 IQKAI-------QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
           + + +        + +  +  +G+          +  P   + N +K  ++ L+   NT+
Sbjct: 248 LDRTMHFSVWSGSDYRASANPLGSPTCEDR-ADREILPFQKDANTLKGFIDGLSAKGNTS 306

Query: 277 TYPAMHH-----------AYRELYNEK----ESSHNTI----GSTRLKKFVIFITDGENS 317
               M             A   L +       ++ N            K ++ +TDG+N+
Sbjct: 307 IDVGMKWGTALLDPSARPAISALASGGGAMVPATFNNRPAAFNDHETVKVIVLMTDGKNT 366

Query: 318 GASAYQNT 325
                ++ 
Sbjct: 367 NQYYVESD 374


>gi|163738634|ref|ZP_02146048.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
 gi|161387962|gb|EDQ12317.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
          Length = 558

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL 377
             +       T  +C   +N G+ +Y++   AP  G  +L+ C  S    F V    E+ 
Sbjct: 483 YWNTSTKDARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVR-GLEIR 541

Query: 378 ESFDKITDKIQE 389
           ++F  I   I++
Sbjct: 542 DAFASIATSIRQ 553



 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/366 (12%), Positives = 91/366 (24%), Gaps = 74/366 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   ++S         +DL  +   R  +Q  LD AVL+     +          +   +
Sbjct: 40  MVGFLLS-MLAVGGIGVDLMRMERDRTILQYTLDRAVLAAAD--LDQPLPPAAVVQDYLS 96

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K     + +     +                                      F 
Sbjct: 97  KAGLNKYYTPPVAETGLGFKKVQSTIDTT-----------------------------FE 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------DLY 164
             ++  +     +              + I +VLDVS SM                 D  
Sbjct: 128 THMLKFSSGQ-DMPLYATSRAEESIDGLEISLVLDVSGSMGSNSRLANLKVAAKDFVDTM 186

Query: 165 LQKHNDNN-NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
           +    DN  +++   Y            +  T  ++A +             +       
Sbjct: 187 IANTIDNKMSISIIPYATQVSLPTELMDQYNTTDEHAYSNCVNFVGSHFQTTALSTTQEL 246

Query: 224 IQKAIQEKKNLSV-RIGTIAYNIGIVGN----QCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            +       + S  R      +     +    +  P   + N +K  ++ L    NT+  
Sbjct: 247 DRTMHFSVWSGSDYRASANPLDSPTCEDSANREILPFQKDANTLKGFIDGLQAEGNTSID 306

Query: 279 PAMHH-----------AYRELYNEK----ESSHNTI----GSTRLKKFVIFITDGENSGA 319
             M             A   L +       ++ N            K ++ +TDG+N+  
Sbjct: 307 VGMKWGTALLDPSARPAISALASGGGAMVPATFNNRPAAFNDHETVKVIVLMTDGKNTNQ 366

Query: 320 SAYQNT 325
              ++ 
Sbjct: 367 YYVESD 372


>gi|91975399|ref|YP_568058.1| hypothetical protein RPD_0919 [Rhodopseudomonas palustris BisB5]
 gi|91681855|gb|ABE38157.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 435

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 68/446 (15%), Positives = 148/446 (33%), Gaps = 88/446 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  A+D  +   +R +++SA DAAVL   ++   ++T+ D      Q 
Sbjct: 28  IFAIALLPILGFIGAAVDYTNASRVRAKLESAQDAAVLLAVSNSAINKTVADAQADAVQF 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                                       A I+++  +N+  +    S +      +  FL
Sbjct: 88  FN-----------------ATLDGYGLSATIDLSVSENDGKRSAVSSFSS---SVKTHFL 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +I      +  RST  +      + +   ++LD S SM               ++   
Sbjct: 128 D-MIGYPTLAIGNRSTSTVSLP---VYVDFYLLLDNSPSMGVAATTSDIATMVANTSDQC 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  S  +     +K          +IDV+ ++   L  +             R+G 
Sbjct: 184 AFACHDLSTSNNYYNLAK----KLGVTMRIDVVRQAVQRLTTTATAMSAVTNQ--FRMGV 237

Query: 241 IAYNIGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAYR----------- 286
             +         T ++N   +++ V++ +         +     +  Y            
Sbjct: 238 YTFGSSCTAIGLTTVANLSSSMSSVQTSV------GTIDLMTIPYQGYNNDQCTDFDGSL 291

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDG--ENSGASAYQNTLN---------TLQICEYM 335
              N    S  +  ST+ +K++ F++DG  + +  S                T+  C  +
Sbjct: 292 TAINSAIPSPGSGISTQPQKWLFFVSDGVADANYPSTCTKPTVSGGRCQEPLTVAQCTAI 351

Query: 336 RNAGMKI---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAV 370
           ++ G++I   Y+  ++ P                            ++ C  S G +F V
Sbjct: 352 KSRGIQIAVLYTTYLALPTNSWYNTYIAPFNPGPYGPSTNSQIAANMQSCA-SPGFYFEV 410

Query: 371 NDSRELLESFDKITDKIQEQSVRIAP 396
           + ++ + E+ D +  K   ++ R++ 
Sbjct: 411 SPTQGIAEAMDALFKKAVAKA-RLSS 435


>gi|59711129|ref|YP_203905.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59479230|gb|AAW85017.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 465

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 49/377 (12%), Positives = 109/377 (28%), Gaps = 56/377 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I V F   T A D A  +  + +++ A +AAVL+  A             + + +
Sbjct: 16  LFVMCIPVLFGVFTLASDGARALQSKARLEDAAEAAVLAVSA----------YGEEDEVS 65

Query: 61  STIFKKQIKKHLKQ-GSYIRENAGDIAQKAQINITKDKNNP--LQYIAESKAQYEIPTEN 117
           +   K  +  ++    + +      +        T D N+   ++Y    + +++     
Sbjct: 66  TQTGKDYVAHYMHDMSNLVDIEVEKLECSELPECTADDNDRPFVEYQVSGRTKHKSWFPG 125

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
             +         +  +       +   +  + I  +LD S SM   +             
Sbjct: 126 NDVTVGFG---ESFDVTGMSKARKFQSSQPMDITFILDFSGSMNYDWEGHAPSYMEEEVP 182

Query: 178 KYLLPPPPKKSFWS---------------KNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
           K      P                      N+T             +  V   S G  V 
Sbjct: 183 KVPGRYSPPSRLSDLKDVVQMVTDELQVYNNSTTGPKHRVAMTGYNRRTVNESSNGKFVI 242

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT--------------------PLSNNLNEV 262
             Q+  +   +     G   Y    +  Q                        +++    
Sbjct: 243 RDQRITKYNSDGYD-AGDKFYPKKTINKQFMVKGAAARVPNGDEKAEFTDIMYTSDFASF 301

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN-SGASA 321
             ++     +  T +   +  A + +     +          K+ +I ++DGE+ +    
Sbjct: 302 NHKIKSFEAFGGTASLQGIIRASQIVSYHITNDGEEAN---PKQLIIILSDGEDFNHYLG 358

Query: 322 YQNTLNTLQICEYMRNA 338
              TL    +C+ +RNA
Sbjct: 359 QTETLVDYGMCDNLRNA 375


>gi|332982109|ref|YP_004463550.1| von Willebrand factor type A [Mahella australiensis 50-1 BON]
 gi|332699787|gb|AEE96728.1| von Willebrand factor type A [Mahella australiensis 50-1 BON]
          Length = 948

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 42/267 (15%), Positives = 91/267 (34%), Gaps = 66/267 (24%)

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
            +  L G + + L  + L     + + ++  ++ + +V+D S SM D             
Sbjct: 374 NSYMLGGYMGTQLEKM-LPVDMDLSKKADIPSLGLVLVIDKSGSMTDGQ----------- 421

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                            K+++  E+A     +++         +
Sbjct: 422 -----------------------------YGITKLEMAKEAAIRSTEALR--------PT 444

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
             +G I ++           +++L E++  +  + P   TN YPA+  AY+ L       
Sbjct: 445 DSVGVICFDDAASWVVGMRQADDLAEIQDSIGTIRPGGGTNMYPALDLAYKALEEADTKL 504

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
                     K +I +TDG+++             I   M   G+ + SVAV    +   
Sbjct: 505 ----------KHIIVLTDGQSATGDFDG-------IAHRMAEDGITLSSVAVGMDADKNL 547

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDK 382
           L R     +G+++  ++   + +   K
Sbjct: 548 LSRLAEIGNGRYYYTDEFSNIPKILTK 574


>gi|126738776|ref|ZP_01754472.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
 gi|126719957|gb|EBA16664.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
          Length = 530

 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
            Y ++ + Y+ +Y +   S++         +        +   ++ +NT  T  +C   +
Sbjct: 423 AYTSLKYLYKYIYADWMGSYSARSEWYYGVY--------DYHGNSTKNTR-TSNVCSAAK 473

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
             G+ +Y++   AP  G  +L+ C  S   +F V D  E+ ++F+ I   I++
Sbjct: 474 AQGIIVYTIGFEAPSNGVAVLQDCASSDSHYFDV-DGLEIRDAFESIATSIRK 525



 Score = 63.4 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 53/363 (14%), Positives = 93/363 (25%), Gaps = 71/363 (19%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           T              +DL  +   R  +Q  LD AVL+          +           
Sbjct: 38  TIAFFLAMLAVGGVGVDLMRLERDRTVLQYTLDRAVLAAA-------DLDQTQEPAVVVQ 90

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               K       +   +    G    KA I+ T D +                     L+
Sbjct: 91  DYLNKAGLGEYYEAPEVETGLGYKKVKATIDATFDAH--------------------LLQ 130

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME----------------DLYL 165
               S      L              + I +VLDVS SM                 D  +
Sbjct: 131 FAGGS-----DLPVYASSTAEESIDGLEISLVLDVSGSMNSNSRLSNLKVAARDFIDTMV 185

Query: 166 QKHNDNN-NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI 224
           +   D   +++   Y          + + TT      A        D    +        
Sbjct: 186 ENTTDGRMSISIVPYATQVSVSDELFDEYTTSGTNNFANCINFETSDYSTTALSTTSERE 245

Query: 225 QKAIQEK-KNLSVRIGTIAYNIGIVGNQCT----PLSNNLNEVKSRLNKLNPYENTNTYP 279
           +          + R      +  I  ++ +    PL  +   +KS +  L  + NT+   
Sbjct: 246 RTMHFSPWYTSNTRASGSPIDYEICDDRSSREILPLQKDATTLKSFITNLTAWGNTSIDI 305

Query: 280 AMHHAYREL--YNEKESSHNTIGSTRLK---------------KFVIFITDGENSGASAY 322
            M      L        S    G++                  K ++ +TDG+N+     
Sbjct: 306 GMKWGVALLDPSARPAISSLASGASVPSEFSVRPVDYSDPDTLKIIVLMTDGQNTSQYYV 365

Query: 323 QNT 325
           ++ 
Sbjct: 366 EDD 368


>gi|291514853|emb|CBK64063.1| Mg-chelatase subunit ChlD [Alistipes shahii WAL 8301]
          Length = 328

 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/264 (16%), Positives = 83/264 (31%), Gaps = 91/264 (34%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I + +DVS SM                                         A    
Sbjct: 87  GIDIMLAIDVSGSML----------------------------------------ARDFK 106

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +I    E AG+ +               RIG +A+         +PL+ + + +++ L
Sbjct: 107 PDRITAAKEVAGSFIA---------DRYGDRIGLVAFAGEAFTQ--SPLTTDQSTLQTLL 155

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            ++      + T     +  A   L            S    K +I +TDG N+     Q
Sbjct: 156 ARIRSGLIEDGTAIGNGLATAINRL----------RESDAKSKVIILLTDGVNN-----Q 200

Query: 324 NTLNTLQICEYMRNAGMKIYSVAV----SAPPEG-----------------QDLLRKCTD 362
             +  +   E  +  G+++Y++ V     AP                    + +L+  +D
Sbjct: 201 GQIAPMTAAEIAKAQGIRVYTIGVGTEGMAPYPAIDMFGNLTFVNQKVEIDEKVLKAISD 260

Query: 363 -SSGQFFAVNDSRELLESFDKITD 385
            + G++F   D  +L   +D+I  
Sbjct: 261 MTGGRYFRATDKEKLKAVYDEINQ 284


>gi|20089145|ref|NP_615220.1| hypothetical protein MA0247 [Methanosarcina acetivorans C2A]
 gi|19914014|gb|AAM03700.1| hypothetical protein (multi-domain) [Methanosarcina acetivorans
           C2A]
          Length = 589

 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 51/329 (15%), Positives = 110/329 (33%), Gaps = 76/329 (23%)

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
           + K+IK++L +  +     G       + I        Q IAE           + + G 
Sbjct: 3   WNKKIKENLLRSIFFASVLGV------VAIVLTGAVSAQAIAEPAVSKTASPALINIAGS 56

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
             +  T +++  TG    S+  + + +   +D S SM      + ND + +         
Sbjct: 57  GVNEETTVTIEVTGAGSTSTSAVPMDVVFAIDSSGSM------QSNDPSGLR-------- 102

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
                                           +A + V+ +  +           G +++
Sbjct: 103 ------------------------------KTAAKSFVDKMDSSRDT-------AGVVSW 125

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
           +  I  +   PL+N+   VK+ ++ ++   +TN    +  A   L            +  
Sbjct: 126 DDSI--DFSLPLTNDFPLVKTNIDSVDSSGSTNLNVGLEEAIDILDANPR-------TEN 176

Query: 304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDS 363
             + +IF+TDG+ +   +               + G  IYS+ +        L    T +
Sbjct: 177 SVEVIIFLTDGQGTYLHSTAQ---------EAADKGYVIYSIGLGG-VNPTPLQDMATTT 226

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G +++  D+  L   FD I  ++   ++
Sbjct: 227 GGAYYSSPDATSLQAIFDDIFSEVTTSTI 255


>gi|197335948|ref|YP_002155278.1| hypothetical protein VFMJ11_0524 [Vibrio fischeri MJ11]
 gi|197317438|gb|ACH66885.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 463

 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 51/375 (13%), Positives = 115/375 (30%), Gaps = 52/375 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I V F   T A D A  +  + +++ A +AAVL+  A             + + +
Sbjct: 14  LFVMCIPVLFGVFTLASDGARALQSKARLEDAAEAAVLAVSA----------YGEEDEVS 63

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQI-NITKDKNNPLQYIAESKAQYEIPTENLF 119
           +   K  +  +L   S + +   +  + +++   T D N+      +   + +  +    
Sbjct: 64  TQTGKDYVAHYLHDMSSLVDIKVEKLECSELPECTADDNDRPFVEYQVSGRTKHISWFPG 123

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM----EDLYLQKHNDNNNMT 175
               +     +  +  +    +   +  + I  +LD S SM    E        +     
Sbjct: 124 NDVTVGFG-ESFDVTGSSKARKFQSSQPMDITFILDFSGSMNYDWEGHAPSYMEEEIPKV 182

Query: 176 SNKYLLPPPPKKSFWS-----------KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI 224
             +Y  P       +             N+T             +  V   S G  V   
Sbjct: 183 PGRYSPPSRLSDLKYVVQMVTDELQVYNNSTAGPKHRVAMTGYNRRTVNESSNGKFVIRD 242

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCT--------------------PLSNNLNEVKS 264
           Q+  +   +     G   Y    +  Q                        +++      
Sbjct: 243 QRITKYNSDGYD-AGDTFYPKKTINKQFMVKGAAARVPNGDEKAEFTDIMYTSDFASFNH 301

Query: 265 RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN-SGASAYQ 323
           ++     +  T +   +  A + +     +          K+ +I ++DGE+ +      
Sbjct: 302 KIKSFEAFGGTASLQGIIRASQIVSYHITNDGEEAN---PKQLIIILSDGEDFNHYLGQT 358

Query: 324 NTLNTLQICEYMRNA 338
            TL    +C+ +RNA
Sbjct: 359 ETLVDYGMCDNLRNA 373


>gi|284163331|ref|YP_003401610.1| von Willebrand factor A [Haloterrigena turkmenica DSM 5511]
 gi|284012986|gb|ADB58937.1| von Willebrand factor type A [Haloterrigena turkmenica DSM 5511]
          Length = 1446

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 60/149 (40%), Gaps = 18/149 (12%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           R G + Y  G   +Q  PL+ + + V S L +L+    TNT   +      L        
Sbjct: 570 RAGRVGYASGANLDQ--PLTTDHDAVNSSLERLSASGGTNTRAGLRVGLNHL-------- 619

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
              G       +I ++DG        ++  + L + E    AG++I +V +       +L
Sbjct: 620 EEEGWENRSAVMILLSDG--------KSGSDPLPVAEDAAEAGVEISTVGLGNNINENEL 671

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITD 385
                 + G F+ V    +L ++F+++ +
Sbjct: 672 REIAAITGGDFYHVEREEDLPDTFERVAE 700


>gi|307825379|ref|ZP_07655598.1| von Willebrand factor type A [Methylobacter tundripaludum SV96]
 gi|307733554|gb|EFO04412.1| von Willebrand factor type A [Methylobacter tundripaludum SV96]
          Length = 326

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 82/256 (32%), Gaps = 82/256 (32%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SME+     +  +                                     
Sbjct: 90  DLMLAVDLSGSMEEQDFVINKRSV-----------------------------------D 114

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++      A + +N         + +  R+G I +         TPL+ +   V + LN+
Sbjct: 115 RLTAAKMVAADFIN---------RRVGDRVGLILFGTQAYLQ--TPLTFDRKTVMTLLNE 163

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  +NT    A+  A + L                 + ++ +TDG N+        
Sbjct: 164 AVIGLAGDNTAIGDAIGLAVKRL----------KSEQVNSRVLVLMTDGANTAG-----E 208

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ L+  E      +KIY++ + A                    + + L++    + GQ+
Sbjct: 209 VSPLKAAELAAANHLKIYTIGIGADEMIVRSFFGNRKINPSVDLDEKTLIKIAESTGGQY 268

Query: 368 FAVNDSRELLESFDKI 383
           +   ++ EL   + ++
Sbjct: 269 YRARNTDELNNIYMRL 284


>gi|304407684|ref|ZP_07389335.1| von Willebrand factor type A [Paenibacillus curdlanolyticus YK9]
 gi|304343167|gb|EFM09010.1| von Willebrand factor type A [Paenibacillus curdlanolyticus YK9]
          Length = 966

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 72/196 (36%), Gaps = 24/196 (12%)

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
             AP+      K+    E+A   V+ +            R+  + ++   +     P + 
Sbjct: 81  SMAPSYNNGEDKMLNAKEAAKGFVDLMDLTK-------HRVAIVDFSSSNMIGNL-PFTT 132

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           N  E K+ ++ +N   +T T  A+  A   L N +  +         +  ++ +TDG+ +
Sbjct: 133 NPTEAKNYIDTINANGSTATGDAIDSAIALLANHRPEA---------QPVIVIMTDGDAT 183

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG------QDLLRKCTDSSGQFFAVN 371
             S         +     ++ G+  Y++A+    +         LL++   +S     V 
Sbjct: 184 QPSTDPYGYAKQKAL-LAKDNGIIFYTIALLKSTDDPVTSGPNILLKEMATTSDHHHFVL 242

Query: 372 DSRELLESFDKITDKI 387
            S  L + +  I  +I
Sbjct: 243 GSTGLSQIYAAIVKEI 258


>gi|326335930|ref|ZP_08202107.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691894|gb|EGD33856.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 332

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 48/327 (14%), Positives = 98/327 (29%), Gaps = 100/327 (30%)

Query: 100 PLQYIAESKAQYEIPTEN-LFLKGLIPSALTNLSLR---STGIIERSSENLAISICMVLD 155
                  S   ++I     LF+  L+  +   ++L    S+  I ++     I I + +D
Sbjct: 39  SSSQALTSIHTWKIRLRPILFILRLLALSCLIIALARPQSSSEITKTKTTEGIDIILAID 98

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
           +S SM                                         A      +I+ L  
Sbjct: 99  MSSSML----------------------------------------AKDLKPNRIEALKR 118

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY--- 272
            A   +             S RIG + Y+         P + + + V   L  +      
Sbjct: 119 VASQFIEE---------RKSDRIGIVVYSGESYTK--VPATTDKSIVLQSLKDIKQGEIE 167

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
           + T     +  A   L            S    K +I +TDG N+        ++ L   
Sbjct: 168 DGTAIGMGLGTAINRL----------KDSKTKSKVIILMTDGVNNTG-----VIDPLSAA 212

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDL----------LRK---------------CTDSSGQF 367
           E  +  G+++Y++ +     G+ L          L+                   + G++
Sbjct: 213 ELAKEYGIRVYTIGIG--TNGKALSPVAYNPDGSLQYDMVPVEIDEKLLGEIAQSTGGKY 270

Query: 368 FAVNDSRELLESFDKITDKIQEQSVRI 394
           F   D+++L + + +I    + +   +
Sbjct: 271 FRATDNKKLAQIYTEIDKLEKSKIEEL 297


>gi|163761157|ref|ZP_02168234.1| hypothetical protein HPDFL43_13595 [Hoeflea phototrophica DFL-43]
 gi|162281708|gb|EDQ32002.1| hypothetical protein HPDFL43_13595 [Hoeflea phototrophica DFL-43]
          Length = 444

 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 55/431 (12%), Positives = 125/431 (29%), Gaps = 61/431 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDR-TIKDPTTKKDQ 59
           +  +++         A+D ++ + ++   Q  +DA VL     I+ +  T+ +      +
Sbjct: 20  LAGLVMVALVWVAGLAVDFSNALRVKTTAQDIVDATVLRATRDIIEEGKTLAEAELSARK 79

Query: 60  TSTIFKKQIKK-HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE-N 117
                        L+  ++      D   K  ++           + ++  + EIP   +
Sbjct: 80  YFDAELAFSSGVGLEVSTFTLTQGVDGIVKLGVS-----GKTSTSLLKAVGREEIPVSVD 134

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDV------SRSMEDLYLQKHNDN 171
                   S    ++   T  +   +     +  +   +      S SM   ++   +  
Sbjct: 135 AAAHVGGGSVEIAIAFDVTNSMGFGTTWGEATSVIASALNALKANSGSMALTFIPFTDRV 194

Query: 172 N----NMTSNKYLLPPPPKKSFWSKNT----TKSKYAPAPAPANRKIDVLIESAGNLVNS 223
           N                 KK  W        TK K                   G+    
Sbjct: 195 NVGMGRANLLNPGDQTAVKKGGWGGCVDVRATKKKNKGETEYFMPDSAPEK---GDRFTK 251

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
                              Y +          ++N+++V S+L KL              
Sbjct: 252 FDNGTPAAHK-------SGYKLACNPQSIIGPTSNVSDVTSQLGKLTKGGTGRFDLGFAW 304

Query: 284 AYRELY--------------NEKESSHNTIGSTRLKKFVIFITDGENS------------ 317
            +  L               N    +     ST  +K  +  TDG  +            
Sbjct: 305 LWYALSPNWKGFWSGGAPADNGVNLADYPTASTNTRKIAVLATDGLTNAYVYEYGKTNLA 364

Query: 318 --GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSR 374
                +  +  N + IC+ M    ++++ + V+   + +   R+C   + G ++ V   +
Sbjct: 365 GWNTGSKDHFENVVAICKSMAAQKIEVHVMHVNGNDKAEPYFRECASATGGGYYKVASKQ 424

Query: 375 ELLESFDKITD 385
            L+++   IT+
Sbjct: 425 TLVDALTGITN 435


>gi|331006778|ref|ZP_08330044.1| BatA [gamma proteobacterium IMCC1989]
 gi|330419396|gb|EGG93796.1| BatA [gamma proteobacterium IMCC1989]
          Length = 364

 Score = 71.1 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 84/256 (32%), Gaps = 75/256 (29%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM+   +Q +N                                       
Sbjct: 95  DLLLAVDISGSMQQEDMQINNRPA-----------------------------------T 119

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  + +   + ++              RIG I +         TPL+ +   V   L +
Sbjct: 120 RLAAVKKVVSDFIDQ---------RQGDRIGLILFGTQAYLQ--TPLTFDTQSVNQFLQE 168

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  ++T    A+  + + L N+  +S     ++   K +I +TDGEN+        
Sbjct: 169 AQLGFAGKDTAIGDAIGLSVKRLKNQSSASSAKPSNS---KVIILLTDGENTAG-----E 220

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           +  LQ  +     G KIY+V + A                    + + L      + G +
Sbjct: 221 VEPLQAAKLAEKIGAKIYTVGIGADEMIVRGFFGNRRVNPSASLDEETLTAIANTTGGLY 280

Query: 368 FAVNDSRELLESFDKI 383
           F   +++EL   + ++
Sbjct: 281 FRARNTQELNNIYSEL 296


>gi|219850594|ref|YP_002465027.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
 gi|219544853|gb|ACL26591.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
          Length = 958

 Score = 71.1 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 53/389 (13%), Positives = 115/389 (29%), Gaps = 77/389 (19%)

Query: 25  IRNQMQSALDAAVLSGCASIVSDRTIK--------DPTTKKDQTSTIFKKQIKKHLKQGS 76
            R Q+++A D  V +  A+ +              +    +   + +    I   +    
Sbjct: 269 YRVQVEAAQDGRVQNNEAAALIRVQGPPRVLLVARNAADARPLATALTAADIVAEIIAPE 328

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIA-ESKAQY---------EIPTENLFLKGLIPS 126
               +  D++    + +       L     ++   Y          I  E  F  G    
Sbjct: 329 AAPRSLADLSAYDALVLVNTPARALPVGLMQAIPGYVRDLGRGLLMIGGEESFGVGGYGR 388

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
                +L     +        ++I  V+D S SM+                       P 
Sbjct: 389 TAVEEALPVYMDVRNRELRPDLAIVFVIDKSGSMD-----------------ACHCANPD 431

Query: 187 KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
           +             P  + + RKID+  ++          A+   ++    +G + ++  
Sbjct: 432 RG-----------GPITSSSERKIDIAKDAVAQ-----ATALLSPQDT---VGVVTFDGA 472

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
                       + +V   ++ + P   TN    +  A   L                 K
Sbjct: 473 AFPTFVATRGATVEQVMDAVSGVEPRGPTNIRAGLLRAEEMLQQVDARI----------K 522

Query: 307 FVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
            +I +TDG       + +  + L I   +R  G+ + +V  +       L +   +  G+
Sbjct: 523 HMILLTDG-------WGSGGDQLDIAARLREQGITL-TVVAAGSGSATYLQQLAAEGGGR 574

Query: 367 FFAVNDSRELLESF-----DKITDKIQEQ 390
           ++   D  ++ + F       I + I EQ
Sbjct: 575 YYPAADMADVPQIFVQETITAIGNYIVEQ 603


>gi|146337717|ref|YP_001202765.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
 gi|146190523|emb|CAL74522.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
          Length = 418

 Score = 70.7 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 54/350 (15%), Positives = 106/350 (30%), Gaps = 35/350 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI       F+   ID +    +R ++Q A+D AVL+G A+              D  
Sbjct: 22  LFAIACVPVLAFVGAGIDYSMANKLRTKLQMAIDEAVLAGVAA---------GKAALDSG 72

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T             SY   N   I     IN T      +                 F+
Sbjct: 73  ATQAAAIAMAQAASSSYFTGNTAKIDATPTINFT-----TMGRTLSGTGSATSVMNTSFM 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           + L+      L+  S      ++    +++ +++D+S SM     Q         +   L
Sbjct: 128 R-LVGFPTMTLNASSAS---SATMQPYLNVYLLVDISSSMLLPATQAGITQMRNGTGCAL 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     S +               +  V+ +   NL+  +  +   K    V++G 
Sbjct: 184 ACHETTNGTDSYSYALKNNVLL------RYQVVNQGVQNLLTYLNSSAVYKN--YVKVGL 235

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
            +++  +        S +          L   +     P          +   ++ +   
Sbjct: 236 WSFDNQLTQLSSLTSSFSSVAANFPAPGLAYNDAAAATP-FDSLIGSFVSSVGTAGDGST 294

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTL--------QICEYMRNAGMKI 342
           S   +K VI  TDG N    A+ +  +            C   ++ G+ +
Sbjct: 295 SATPQKLVIIATDGVNDPTRAWTSQTSLRSQVRVFNTAFCNTFKSNGVTV 344


>gi|27367909|ref|NP_763436.1| aerotolerance operon protein BatA [Vibrio vulnificus CMCP6]
 gi|27359482|gb|AAO08426.1| BatA (Bacteroides aerotolerance operon) [Vibrio vulnificus CMCP6]
          Length = 323

 Score = 70.7 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/258 (15%), Positives = 82/258 (31%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM+   + +  D                                      
Sbjct: 87  DLMLVVDLSGSMQQADILQDGD-----------------------------------YID 111

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +       +               R+G + +         TPL+ +   V ++LN+
Sbjct: 112 RLSAVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVANQLNQ 160

Query: 269 LNPY--EN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +  A +   +          S   ++ VI ++DG N+       T
Sbjct: 161 TIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG-----T 205

Query: 326 LNTLQICEYMRNAGMKIYSVAV------------------SAPPEGQDLLRKCTDSSGQF 367
           L+ ++     +  G+KIY++ +                  SA  + + L +  T + GQ+
Sbjct: 206 LDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKVATMTGGQY 265

Query: 368 FAVNDSRELLESFDKITD 385
           F   D++EL   +  I  
Sbjct: 266 FRARDAQELQTIYQAINQ 283


>gi|84688081|ref|ZP_01015939.1| hypothetical protein 1099457000215_RB2654_05415 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84663909|gb|EAQ10415.1| hypothetical protein RB2654_05415 [Rhodobacterales bacterium
           HTCC2654]
          Length = 595

 Score = 70.7 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
           F+ D  +   +  +   N  +IC   +NAGM ++++         D++R C  +   +F 
Sbjct: 513 FLADAHD-YFNYSEKNDNLDEICTAAKNAGMVVFTIGFEVSGSQHDIMRSCASAPAYYFD 571

Query: 370 VNDSRELLESFDKITDKIQE 389
           V D  ++  +F  I  +I +
Sbjct: 572 V-DGLDISAAFAAIAREISK 590



 Score = 47.2 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 34/108 (31%), Gaps = 22/108 (20%)

Query: 243 YNIGI-----VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH-------------- 283
           YN           +  P+  +   ++  ++ L    NT+    M                
Sbjct: 310 YNDYSGSTNDYWREIYPMGFSAEALRDEIDDLGASGNTSIDLGMKWGAALLDPAAQPAIS 369

Query: 284 ---AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
              A  E+    +          ++K ++ +TDGEN+     +   ++
Sbjct: 370 DLVAANEVNEAFDGRPFEYTQRGIEKVIVLMTDGENTSQDYLRRGYHS 417



 Score = 36.8 bits (83), Expect = 6.1,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 48/153 (31%), Gaps = 21/153 (13%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           +  +  L    A+D       R  +Q  LD A+L+  +               D    + 
Sbjct: 36  VFMLMCLAGGIAVDTMRYETHRVHVQGTLDRAILAAAS----------LDQDLDPEEVVL 85

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
               K  L     I ++  D+ +        D         E+     +PT  L      
Sbjct: 86  DYFTKAGLGH--VISQDDIDVFENQTNGEVADDVAVTTRRVEASVSALMPTTFL------ 137

Query: 125 PSALTNLSLRSTGIIERSSENLAIS-ICMVLDV 156
              L ++          + E L++S I +VLDV
Sbjct: 138 --RLAHMYDLGLYTEGGAEEALSLSEISLVLDV 168


>gi|31789431|gb|AAP58546.1| hypothetical protein [uncultured Acidobacteria bacterium]
          Length = 327

 Score = 70.7 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 86/248 (34%), Gaps = 62/248 (25%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            + I ++LD+S SM++      +     T                            A  
Sbjct: 84  GLDIVLLLDLSSSMQEEMGSGQSLKTGTT----------------------------AAG 115

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             ++D + ++    V               RIG + ++        +PL+ +   +   L
Sbjct: 116 RTRMDAVKDAVRTFVR---------GRRDDRIGLVVFSDNAYV--ISPLTFDHQYLLDYL 164

Query: 267 -----NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
                  L     T     +  A   L   +++  +  G       V+  TDGE++    
Sbjct: 165 GFVDGEILLGEGQTAIGDGLALASAVL--ARQAGRDARGHQ----VVVLFTDGESN---- 214

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-----GQDLLRK-CTDSSGQFFAVNDSRE 375
                + +++    ++AG++++ + V    E     G  LLR+    + G++FA +  R+
Sbjct: 215 --RGRDPIEVVGEAKSAGIRVHVIGVDLDAEVKTRPGVQLLRRGVVAAGGRYFAADSERD 272

Query: 376 LLESFDKI 383
           LL +   I
Sbjct: 273 LLTASRTI 280


>gi|89098674|ref|ZP_01171556.1| hypothetical protein B14911_00755 [Bacillus sp. NRRL B-14911]
 gi|89086636|gb|EAR65755.1| hypothetical protein B14911_00755 [Bacillus sp. NRRL B-14911]
          Length = 920

 Score = 70.7 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 56/390 (14%), Positives = 130/390 (33%), Gaps = 98/390 (25%)

Query: 21  HIMYIRNQMQSALDAAVLSGCAS----IVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           ++   ++++     +A+ +  ++     + + +++     K     +  +Q K  L+   
Sbjct: 249 NVYTFKHKIDETGLSAIKAEISAEGDGFIENNSLQSAVNIKGTPKVLIVEQEKSQLENIL 308

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL---------------- 120
                  D     ++  +     P Q I  +     + +EN  +                
Sbjct: 309 DGSGLLADSIVPEKLPTSLSGFLPYQSIIFNNIPATVVSENQMMLIEKAVKEFGSGFIMA 368

Query: 121 -----KGLIPSALTNLS--LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
                 GL     T +   L     I+   E  ++ + +V+D S SM             
Sbjct: 369 GGENSFGLGGYFKTPIEKLLPVNMDIKGKKEMPSLGLMIVMDRSGSMAG----------- 417

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
                                              K+++  E+A   V  +++       
Sbjct: 418 ----------------------------------SKLELAKEAAARSVELLREKDT---- 439

Query: 234 LSVRIGTIAYNI-GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
               +G IA++    V  +  PL +  + V   +  + P   T  + ++  AY EL N K
Sbjct: 440 ----LGFIAFDDRPWVIVETGPLEDKKDAVDK-IGSVTPGGGTEIFTSLEKAYEELENLK 494

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                       +K +I +TDG+++ ++ Y++ + T       +   + + +VA+ +  +
Sbjct: 495 LQ----------RKHIILLTDGQSARSTDYESMIET------GKENNITLSTVALGSDAD 538

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
              L       +G+F+ V DS  +     +
Sbjct: 539 RNLLEELAGLGAGRFYDVTDSSVIPSILSR 568


>gi|329848392|ref|ZP_08263420.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328843455|gb|EGF93024.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 434

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 78/448 (17%), Positives = 156/448 (34%), Gaps = 84/448 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAA-----VLSGCASIVSDRTIKDPTT 55
           +  + + V FL I  A+D + +M ++ ++Q A D A      ++  A   + +      T
Sbjct: 19  IIGLALPVVFLAIGGAVDFSRVMQLKKELQDAADVASVGSVAVNSYAYKANTKGHSSFKT 78

Query: 56  KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
            ++Q   IF   +K   K             +K   N+  +      Y            
Sbjct: 79  GENQALAIFNSNVK---KHNDLNNIKVKAKIKKQSTNLVSEIGVTADYR----------- 124

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
              +L GL+      ++++ST           I   ++LD S SM      K  D     
Sbjct: 125 --PYLLGLMGMNTMPITIKSTSSSTFP---PYIDFYLLLDNSPSMGVGATTKDIDTMVAN 179

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
           ++              K                +IDV+ ++  NL+ +  K  Q   +  
Sbjct: 180 TSDKCAFA---CHQMDKAGNDYYALAKKLKVTTRIDVVRQATQNLMTT-AKNTQTLTDQY 235

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA-----MHHAYRELYN 290
            R+    Y+ G+  +Q        N     ++ L    +T+   A     M   Y+   +
Sbjct: 236 -RMAI--YHFGMAADQIDS----KNPAPYEVSALTTNLSTSASNAAKIDLMTIPYQNYNS 288

Query: 291 EKESSH---------------NTIGSTRLKKFVIFITDGENSGAS-AYQNTLNTLQI--- 331
           +++++                +   S++ ++ + F++DG N G   AY N  +  +I   
Sbjct: 289 DRQTNFPSYLLGMNKVIPSSGDGSSSSKPQQVLFFVSDGANDGYDCAYSNGASCRRISPL 348

Query: 332 ----CEYMRNAGMKI---YSVAVSAPPEG----------------QDLLRKCTDSSGQFF 368
               C+ M+  G+KI   Y+  +  P                      +++C    G +F
Sbjct: 349 DTPQCKAMKARGVKIAVLYTTYLPLPTNAFYNSHLAKYVSPTSQLAAKMQECAT-EGLYF 407

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAP 396
            V  +  + E+ + +  K+    VRI+ 
Sbjct: 408 EVGPNEGISEAMNALFAKVIST-VRISS 434


>gi|118496821|ref|YP_897871.1| von Willebrand factor type A domain-containing protein [Francisella
           tularensis subsp. novicida U112]
 gi|118422727|gb|ABK89117.1| von Willebrand factor type A domain protein [Francisella novicida
           U112]
          Length = 333

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 100/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 59  YLKYLLGFIWILLIISGSGIQWLGKPVSLAQSGRDLIMAIDLSGSMAIQDMKKAN----- 113

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 114 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 136

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 137 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKY 193

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 194 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 238

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +  T + G++F   +S +L + ++ I
Sbjct: 239 MIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRAQNSSDLKKVYESI 288


>gi|320158179|ref|YP_004190557.1| BatA [Vibrio vulnificus MO6-24/O]
 gi|319933491|gb|ADV88354.1| BatA [Vibrio vulnificus MO6-24/O]
          Length = 323

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 39/258 (15%), Positives = 82/258 (31%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM+   + +  D                                      
Sbjct: 87  DLMLVVDLSGSMQQEDILQDGD-----------------------------------YID 111

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +       +               R+G + +         TPL+ +   V ++LN+
Sbjct: 112 RLSAVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVANQLNQ 160

Query: 269 LNPY--EN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +  A +   +          S   ++ VI ++DG N+       T
Sbjct: 161 TIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG-----T 205

Query: 326 LNTLQICEYMRNAGMKIYSVAV------------------SAPPEGQDLLRKCTDSSGQF 367
           L+ ++     +  G+KIY++ +                  SA  + + L +  T + GQ+
Sbjct: 206 LDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKIATMTGGQY 265

Query: 368 FAVNDSRELLESFDKITD 385
           F   D++EL   +  I  
Sbjct: 266 FRARDAQELQAIYQAINQ 283


>gi|327400025|ref|YP_004340864.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
 gi|327315533|gb|AEA46149.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
          Length = 790

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 58/156 (37%), Gaps = 21/156 (13%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
            +    L+N+     + ++ L  Y  T     +  A +EL       +           +
Sbjct: 539 YDVSQTLTNDTLSANNSIDDLWAYGGTPMGGGIKVARQELVANTAPGNIP--------VM 590

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAG-----------MKIYSVAVSAPPEGQDLL 357
           I ++DG N   ++      TL I E +  A            + IY++        + LL
Sbjct: 591 IVLSDG-NPTLTSDGTASETLAIQEAIEEAETTKQTTIGGEQILIYTIGFG-NDANETLL 648

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++   S   ++    S EL   + +I  +++E++ +
Sbjct: 649 KQIATSPDYYYFAATSEELSSIYRQIAKELKEKAAK 684



 Score = 43.7 bits (101), Expect = 0.044,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 63/192 (32%), Gaps = 20/192 (10%)

Query: 87  QKAQINITKDKN--NPLQYIAE-SKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS 143
               INIT + +  +P  Y+ +    +   P E +            + L   GI E S 
Sbjct: 233 DTDTINITVNPSTPDPTLYVDKFVVPEVAQPGEPV---------RITIFLSGEGIAETSR 283

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
               ISI  V+DVS SM+  Y   +      +      P   + S +  ++ +     A 
Sbjct: 284 N---ISIMHVIDVSGSMDPDYYGDNGYTIYKSDYGVATPAKWEGSVYVDDSFQKLAIEAY 340

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
           +   + +D+ ++S        Q AI   +   V    +  N  I      P   +   V 
Sbjct: 341 SENGKDVDLWVKSPDGDFARAQYAIPNGEMYYV-TNPVEGNWSIAVVADYPTGYDTVHVD 399

Query: 264 SRLNKLNPYENT 275
                      T
Sbjct: 400 IY----KKSGGT 407


>gi|284040938|ref|YP_003390868.1| von Willebrand factor A [Spirosoma linguale DSM 74]
 gi|283820231|gb|ADB42069.1| von Willebrand factor type A [Spirosoma linguale DSM 74]
          Length = 359

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 47/264 (17%), Positives = 84/264 (31%), Gaps = 75/264 (28%)

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
           R  ++  I I + +DVS SM +  +                                   
Sbjct: 106 REEQSEGIDIMLAMDVSVSMSESDILP--------------------------------- 132

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
                   ++      A   V             + RIG + +          PL+ + N
Sbjct: 133 -------TRLAAARRVAQAFVR---------GRRNDRIGLVIFAGEAF--SLCPLTTDYN 174

Query: 261 EVKSRLNKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK------KFVIF 310
            +   LN LN        T    A+      + +   +S +T  +   +      K +I 
Sbjct: 175 LLNQYLNDLNDGMIRTSGTAIGDALARCINRMRDRPAASSDTTQAKTEQWKSERSKVIIL 234

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG--------QDLLRKCTD 362
           ++DG+N+  +    T  +L      +   +KIY++AV  P           + +L+K   
Sbjct: 235 LSDGDNTAGNLDPITAASL-----AKAFNIKIYTIAVGQPVASASEASTVDEGILKKIAT 289

Query: 363 -SSGQFFAVNDSRELLESFDKITD 385
              G FF   DS  L   F +I+ 
Sbjct: 290 IGKGSFFRAVDSGRLKTVFAQISQ 313


>gi|262275460|ref|ZP_06053270.1| protein TadG associated with Flp pilus assembly [Grimontia hollisae
           CIP 101886]
 gi|262220705|gb|EEY72020.1| protein TadG associated with Flp pilus assembly [Grimontia hollisae
           CIP 101886]
          Length = 453

 Score = 70.7 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 67/449 (14%), Positives = 132/449 (29%), Gaps = 84/449 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I   + F     A++    +    ++   ++ A L+  A+I SD T           
Sbjct: 17  IFVIAYPLLFGVFVLAVESTRYLQTHARIGDGVEVASLAVAANISSDITEN--------- 67

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK---NNPLQYIAESKAQYEIPTEN 117
            T+ K  +   +  G+    +  +I +K+   I   +               QY++   +
Sbjct: 68  KTLAKNYVDGFVPDGTISLADI-NIERKSCDEIYGSQCGVAGVYDEEGLVFTQYKVTLSS 126

Query: 118 LF-----LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH---- 168
            F          P     + L  T +  +      I +  V D S SM+  + ++     
Sbjct: 127 EFESWYPEDDFAPGFEEIVELGGTAVARKYQ-GFTIDVAFVADFSGSMQQTWNREIKYKG 185

Query: 169 ---------------NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
                          ND+     N   +        ++          +          L
Sbjct: 186 VVNVISDITRKLETFNDHTEQELNGKKVANKVAFIGYNFYPHNGSTFYSNVDYKANYSRL 245

Query: 214 IESAGNLVNSIQ--KAIQEKKN--------LSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                  +  I   +  ++  N          V      Y+          L++N  + +
Sbjct: 246 SYKWQENIPEINYRRTARDPINNKRTPIIGRYVNNTIPLYSDDSYFYTLD-LTDNFTQFR 304

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE------NS 317
           + ++   P   T +Y  +  A          +        ++K +I ++DGE      N 
Sbjct: 305 NTISTFYPDYGTASYEGIIEA----------AKIVNNGENIRKLIIVLSDGEDSINENNP 354

Query: 318 GASAY--------------QNTLNTLQICE-YMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
             + Y              QN +N L+  E   RN   KI+ +      E    L+ C  
Sbjct: 355 YDNRYPGFIAPLIYQSGLCQNIINDLESKEINGRNVEAKIFVIGFGYDLEKNPGLKICAG 414

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQS 391
                  V  +    E FD +   I E+ 
Sbjct: 415 EEN----VQSADSYQEIFDTVLQLISEEV 439


>gi|239833540|ref|ZP_04681868.1| Hypothetical protein OINT_2000308 [Ochrobactrum intermedium LMG
           3301]
 gi|239821603|gb|EEQ93172.1| Hypothetical protein OINT_2000308 [Ochrobactrum intermedium LMG
           3301]
          Length = 637

 Score = 70.3 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 71/218 (32%), Gaps = 72/218 (33%)

Query: 244 NIGIVGNQCTPLSN-----NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           N        TPL++      +  V++ +  + P   TN   AM   +R +      +   
Sbjct: 415 NYSCTTLPLTPLTDVTTEQGMKTVQTAIKAMVPNGGTNVPEAMAWGWRTIVQGAPFTEAR 474

Query: 299 IGSTR-LKKFVIFITDGENS---------------------------------------- 317
             + R   K VI +TDG N+                                        
Sbjct: 475 ASTERGNDKVVIVLTDGANTYYKYDGLAGSGPDRAGNLSYYSTHGYTARITKKYSQSRLF 534

Query: 318 ---GASAYQNTLNTLQI--------CEYMRNAGMKIYSVAV-----SAPPEGQ-DLLRKC 360
              G S  QN     +         C+  + A + + +VA+     ++  + Q DLLR C
Sbjct: 535 QESGVSVSQNNTTYTKALNARFAKLCDNAKAANIIVMTVALDLNEANSTEKAQIDLLRSC 594

Query: 361 TDS---------SGQFFAVNDSRELLESFDKITDKIQE 389
           + +           + F  +   EL E+F +I D++  
Sbjct: 595 SSNSRVRMEGGKPAKLFWNSTGGELSETFRQIGDELSN 632



 Score = 41.4 bits (95), Expect = 0.23,   Method: Composition-based stats.
 Identities = 51/295 (17%), Positives = 93/295 (31%), Gaps = 68/295 (23%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQ 74
            A+D A++M +RN +Q++LDAA L+      +  +    T  +D  + IF   +      
Sbjct: 62  VAVDTANLMRVRNNVQASLDAAALAVGKRFSTGES---HTVVQDYGARIFYANV------ 112

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
                      A   QI   +DK    Q  A +   Y+     +    L           
Sbjct: 113 -----TALSADAINFQIAFPQDKTTDQQVQATAAFTYK-SLFGVVASRLTGDNWDKHQYT 166

Query: 135 STGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNT 194
            T  +   +    I + +VLD S+SM++                                
Sbjct: 167 LTASVRLKNT---IEVALVLDNSKSMDETRSGSSK------------------------- 198

Query: 195 TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP 254
                        ++ID+L ++A  LV ++            +   I Y    V     P
Sbjct: 199 -------------KRIDLLKDAASQLVETMAS----------QSALITYVEKPVQFSLVP 235

Query: 255 LSNNLNEVKSRLNK--LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
            + ++N     LN   ++P   ++           +   ++      GS R  K 
Sbjct: 236 FAGSVNVGPQYLNAAWMDPEGKSSVNLENFTLPVTIDASRKIEEKPAGSGRYYKV 290


>gi|116625272|ref|YP_827428.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228434|gb|ABJ87143.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 323

 Score = 70.3 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 90/270 (33%), Gaps = 82/270 (30%)

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
               I + SSE+  +S+ +V D S SM                                 
Sbjct: 82  SPQEISQFSSEDAPLSVGVVFDCSGSMG-------------------------------- 109

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                         +K+D   ++           +   ++       + +N         
Sbjct: 110 --------------QKLDKSRQAVSQFFK-----LANPEDEFF---LVQFNDSASL--IQ 145

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           P + NL E+++ L        T    A++ A           H    +   +K ++ I+D
Sbjct: 146 PFTRNLEEIQNHLAFTQSKGRTALLDAVYLAL----------HEMKKAKNPRKALLLISD 195

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ----------DLLRKCTD- 362
           G ++ +   +  +  L     ++ A ++IY++ +     G+           LL +  + 
Sbjct: 196 GGDNSSRYTEPEIKNL-----VKEADVQIYAIGIYESAAGRGRTPEESSGPALLTEIAEQ 250

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           + G+ + V++  EL +   KI  +++ Q +
Sbjct: 251 TGGRQYQVDNLNELPDVAAKIGVELRNQYI 280


>gi|194324498|ref|ZP_03058270.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
 gi|194321333|gb|EDX18819.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
          Length = 339

 Score = 70.3 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 100/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 65  YLKYLLGFIWILLIISGSGIQWLGKPVSLAQSGRDLIMAIDLSGSMAIQDMKKAN----- 119

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 120 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 142

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 143 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKY 199

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 200 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 244

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +  T + G++F   +S +L + ++ I
Sbjct: 245 MIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRAQNSSDLKKVYESI 294


>gi|260592520|ref|ZP_05857978.1| BatA protein [Prevotella veroralis F0319]
 gi|260535566|gb|EEX18183.1| BatA protein [Prevotella veroralis F0319]
          Length = 318

 Score = 70.3 bits (170), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 51/313 (16%), Positives = 107/313 (34%), Gaps = 72/313 (23%)

Query: 93  ITKDKNNPLQYI-AESKAQYEIPTENLFLKGLIPS-ALTNLSLRSTGIIERSSENLAISI 150
            T   ++   Y       +  +    +FL+ L+ +  +  L+   T     + +   I I
Sbjct: 31  PTIKMSDTFAYQHISKSWRIRMIHLPMFLRCLVYTLVVIVLARPQTYNSWDNKDAEGIDI 90

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
            + +D+S SM    +  +                                        +I
Sbjct: 91  MLTMDISASMLTEDVFPN----------------------------------------RI 110

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR--LNK 268
           +V  E A +    I     +   L++  G  A+    +      L N L+ V++   +  
Sbjct: 111 EVAKEVASDF---ISGRPNDNIGLTIFAGE-AFTQCPMTVDHAALLNLLHNVRTDLVVKG 166

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L   + T     + ++   L            S    K +I +TDG N+  S    T  +
Sbjct: 167 LIQ-DGTAIGMGLANSVSRL----------KDSKAKSKVIILLTDGSNNVGSISPMTAAS 215

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEG-------QDLLRKCTDSSGQFFAVNDSRELLESFD 381
           +      +  G++IY++ +    EG       + L      ++G+F+      EL + + 
Sbjct: 216 I-----AKKYGIRIYTIGLGKESEGDLGAIDYKTLQNIAVSTNGEFYRAQSQAELSKIYQ 270

Query: 382 KITDKIQEQSVRI 394
            I DK+++  +R+
Sbjct: 271 DI-DKLEKTKLRV 282


>gi|320102039|ref|YP_004177630.1| VWFA-like domain-containing protein [Isosphaera pallida ATCC 43644]
 gi|319749321|gb|ADV61081.1| VWFA-related domain protein [Isosphaera pallida ATCC 43644]
          Length = 784

 Score = 70.3 bits (170), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 79/191 (41%), Gaps = 29/191 (15%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP----LSNNLNEV 262
           + +I  L E+ G  + ++            ++  I +N  +      P     +   ++V
Sbjct: 544 DNRIGALKEAVGVFLGTLPPGS--------KVAVIEFNSFVNPLVFGPANEIFTTRFDDV 595

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           KS++N+      T+ Y A+  A   + N              ++ V+ +TDGE++ +   
Sbjct: 596 KSQVNRFRANGGTSYYDAVDRALELIAN-----------QTGRRAVLALTDGEDTSSRLA 644

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELLESF 380
                 L+     RN G+ ++++ V    E +  +L R   ++ G++F   D+ +L   F
Sbjct: 645 GLDSVILK----ARNLGLPVHTLGVGREDEIEVGELQRLARETRGRYFPARDATKLRVIF 700

Query: 381 DKITDKIQEQS 391
            ++   ++E  
Sbjct: 701 AELAQSLRESY 711


>gi|260576512|ref|ZP_05844501.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021235|gb|EEW24542.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 529

 Score = 70.3 bits (170), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
           S  Q  +   QIC+  +++G+ I+S+   AP  G++ LR C      +F      ++  +
Sbjct: 456 SYGQKDVRLQQICDAAKDSGIVIFSIGFEAPENGRNQLRDCASQPSNYFNAT-GVQITTA 514

Query: 380 FDKITDKIQE 389
           F  I  ++  
Sbjct: 515 FRAIATQLSH 524



 Score = 47.6 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 43/340 (12%), Positives = 86/340 (25%), Gaps = 76/340 (22%)

Query: 16  AIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQG 75
           A+DL      R  +Q  LD + L+  +       ++     +      F K        G
Sbjct: 56  ALDLMRHEQKRTTLQQTLDRSTLAAAS-------LQQSLDPESVVRDYFAKANMTQYLSG 108

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
             + E        A                           N F   ++     +    S
Sbjct: 109 VTVDEGMNYREVNA---------------------LAAADTNPFFMQMVGIDSFDAKAAS 147

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
           T     S+    + + MVLD+S SM                   ++              
Sbjct: 148 TAEQRISN----VEVSMVLDISGSMASNSRLTRLRPAAKEFIDTVINGSDPGRVSISVVP 203

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG---TIAYNI------- 245
            +      A    + +V      N ++S    ++   ++    G     ++         
Sbjct: 204 YNAQVNLGAGMMSQFNV------NALHSTSYCVELPNSVFGSTGLSQATSFVHNGHFDPW 257

Query: 246 -----------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE- 293
                             TP+S +   +K R++ L     T+    +      L    + 
Sbjct: 258 GTGNSSNYNCPPTANVAVTPMSGDAAYLKGRVDLLASMGYTSIDVGVKWGTLLLDPSAQP 317

Query: 294 ----------------SSHNTIGSTRLKKFVIFITDGENS 317
                                     + K ++ ++DGEN+
Sbjct: 318 LINGLVGLGQVDEDFTDRPLDPDEANVLKVLVVMSDGENT 357


>gi|163745746|ref|ZP_02153106.1| hypothetical protein OIHEL45_09145 [Oceanibulbus indolifex HEL-45]
 gi|161382564|gb|EDQ06973.1| hypothetical protein OIHEL45_09145 [Oceanibulbus indolifex HEL-45]
          Length = 554

 Score = 69.9 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 56/360 (15%), Positives = 117/360 (32%), Gaps = 79/360 (21%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           I+     +F   A+DLA+    R   Q+ LD AVL+  + +  D   ++           
Sbjct: 24  IVFFGITIFGGLAVDLANHERTRTTFQTHLDNAVLAAAS-LSQDLDAEEV---------- 72

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT-ENLFLKG 122
               ++ +L                +++ I   +      +     +  +P   N +   
Sbjct: 73  ----VRSYLTSAGL---------DPSEVEIETREEKIGGILVGRTVEASLPAGLNTYFFR 119

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
                   +++ S            I I +VLDVS SM D+     +D + +  +     
Sbjct: 120 FFDIDTLGMTISSEATERVE----DIEISLVLDVSGSMGDI----TSDRSGIKMDLLKRA 171

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS------------------- 223
                     +  + + + +  P + K++      G    S                   
Sbjct: 172 AGDFVETILSDAEEGRVSISIVPYSTKVNPGSALLGQYTVSQEHSYSHCVDFDADDFTHL 231

Query: 224 -IQKAIQEKKNLSVRIGTIAYNIGIVGN---------QCTPLSNNLNEVKSRLNKLNPYE 273
            I  A + ++     IG+ + +    G            TPLS+++ E+K+++  L P  
Sbjct: 232 RIDTATELQRTGHFLIGSESTSNRTAGQWVCRFDSGFAVTPLSSSVAELKAQIAALTPLG 291

Query: 274 NTNTYPAMHH-----------------AYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
           +T+                        A  ++    +   +  G+    K ++ +TDGEN
Sbjct: 292 STSIDMGAKWGLALLDPSAQTPIAAMIASGQVNRAFQGRPHVYGADNSMKVLVLMTDGEN 351



 Score = 56.5 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 2/70 (2%)

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLE 378
            + +      QIC     AG+ IYS+ +        +LL+ C  S   +F V    E+  
Sbjct: 480 DSVEKDRRLRQICGVANAAGVVIYSIGMDVDNTNSLNLLKDCASSESHYFDVE-GLEIQT 538

Query: 379 SFDKITDKIQ 388
           +FD I   I 
Sbjct: 539 AFDMIAASIS 548


>gi|289607418|emb|CBI60804.1| unnamed protein product [Sordaria macrospora]
          Length = 814

 Score = 69.9 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 54/391 (13%), Positives = 102/391 (26%), Gaps = 66/391 (16%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +         +  Q S    N         I+ T   N             ++   N   
Sbjct: 250 NKSACNSAYTYDSQASQADANYTGSRTPDWIDATAYFNGKSACNVAYTYDSQVSQANPNY 309

Query: 121 KGLIPSALTNLSLRSTGIIERSSE-------NLAISICMVLDVSRSMEDLYLQKHNDNNN 173
            G++       S R + I++ +           ++ +   L  +    ++          
Sbjct: 310 TGIMGGWWLT-SNRCSVIVQSNGNPDGYTYGRRSVDVRPFLASNLKATNVQSPTPIWQIT 368

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI--------- 224
            T++     P   KS W+    + K   A            ++    V+ +         
Sbjct: 369 GTNDPSDDRPYEFKSVWNGCIEERKTNSAAINGGSSTTAPSDAYDLDVDLVPYNDDTRWR 428

Query: 225 -----QKAIQEKKNLS-VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
                     +      V    +AY       +     NN +   S LN L     T   
Sbjct: 429 PMWNDVSYYPDWSWSYGVGRQPVAY-CPTEAKRLQNYHNNRSGFVSYLNGLVARGGTYHD 487

Query: 279 PAMHHAYRELYN--------------EKESSHNTIGSTRLKKFVIFITDGEN--SGASAY 322
             M    R L                    +   I    +KK++IF+TDG+   + +   
Sbjct: 488 IGMIWGARFLSTTGLFKSATPETNDVNDPDNPAKIRGFSVKKYMIFMTDGDMSPTWSDYS 547

Query: 323 QNTLNTLQ------------------------ICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
              +  L                          C   +  G+ I+ +A S        + 
Sbjct: 548 AYGIEYLDGRVMGSPTTDNTALLARHLQRFRMACNAAKAKGIDIWVIAFSTTLTAD--MT 605

Query: 359 KCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            C     Q   ++ +  L+  F +I  KI  
Sbjct: 606 NCASKPEQAAGLSSNAALIAKFKEIGSKIAT 636



 Score = 54.5 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 47/316 (14%), Positives = 96/316 (30%), Gaps = 70/316 (22%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MT  +I      +   +D+      +N+ + A DA  L+G   +++  T+     + + T
Sbjct: 22  MTLALIP-LVALMGSGLDMTRAYVAQNRFRQACDAGSLAGR-RMLAGLTLPQA-ARDEAT 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                   + +L+   Y                T   + P     +  +Q  +PT    L
Sbjct: 79  KYFMFDFPQGYLQSAPY----------------TLTMSVPTAGTLQISSQTTVPTT---L 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL       +S   +   +  +      I  V D+S SM                    
Sbjct: 120 MGLFGFDTLPISTTCSATQDFVNT----DIMFVFDLSGSMNCA----------------- 158

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE--KKNLSVRI 238
                           + Y      +  ++  L  +A +  ++++ A  +    NL +R 
Sbjct: 159 -------------PGVTGYCGDVEQSGSRMGALRSAATSFYDTLETAQSQLAANNLRLRY 205

Query: 239 GTIAYNIGIVGNQC--------TPLSNNL-NEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
           G + YN  +   +            S +  +     ++    +   N   A + AY    
Sbjct: 206 GFVNYNSTVNVGRILYEKNPDWMVQSWSYQSRTPDWIDATAYF---NNKSACNSAYTYDS 262

Query: 290 NEKESSHNTIGSTRLK 305
              ++  N  GS    
Sbjct: 263 QASQADANYTGSRTPD 278


>gi|149176865|ref|ZP_01855475.1| BatA [Planctomyces maris DSM 8797]
 gi|148844302|gb|EDL58655.1| BatA [Planctomyces maris DSM 8797]
          Length = 356

 Score = 69.9 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 50/306 (16%), Positives = 96/306 (31%), Gaps = 85/306 (27%)

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           L   G I   +  L+    G  ++ + +  I+I MV+D S SM                 
Sbjct: 55  LLTLGAILFMILGLARPREGREQQVTTSEGIAIEMVVDRSGSM----------------- 97

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                             ++           ++  +   AG  V   ++      +L   
Sbjct: 98  ------------------QAMDFKIDGEHVDRLTAIKNVAGKFVEGKEELEGRFNDL--- 136

Query: 238 IGTIAYNIGIVGNQCTPLS--------NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
           +G + +     G     L         NN+  V +        + T    A+  A  +L 
Sbjct: 137 VGLMTFAGYADGITPPTLDHPYLVSQLNNIQIVTN-----RSEDGTAIGDAISLAVEKLN 191

Query: 290 N-EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             +              K +I +TDGEN+        +  +Q  E     G+K+Y++ V 
Sbjct: 192 ALDARRDEKVKS-----KVIILLTDGENNAG-----EVEPIQAAELAETLGIKVYTIGVG 241

Query: 349 ----------APPEGQDL------------LRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                      P  G+ +            L+K  D + G++F   D+  L + + +I  
Sbjct: 242 TKGEAPVPVTDPFSGKQVVQWMPVNIDEATLQKVADLTHGKYFRATDTDSLEKIYHEIDA 301

Query: 386 KIQEQS 391
             + + 
Sbjct: 302 LEKTKV 307


>gi|254372185|ref|ZP_04987677.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151569915|gb|EDN35569.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 339

 Score = 69.9 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 100/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 65  YLKYLLGFIWILLIISGSGIQWLGKPVSLPQSGRDLIMAIDLSGSMAIQDMKKAN----- 119

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 120 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 142

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 143 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKY 199

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 200 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 244

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +  T + G++F   +S +L + ++ I
Sbjct: 245 MIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRAQNSSDLKKVYESI 294


>gi|332716075|ref|YP_004443541.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
 gi|325062760|gb|ADY66450.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
          Length = 429

 Score = 69.9 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 57/434 (13%), Positives = 140/434 (32%), Gaps = 70/434 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALD----------AAVLSGCASIVSDRTI 50
           +TA+++         A+D+   M ++  +Q A D          +A +     +  D  I
Sbjct: 15  LTALLMVPLCGAAGVALDITRGMSVKADLQQAADSAALAAVADMSASVQAAKKMSGDGVI 74

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                +                  G+   +    I     ++++  K+     + ES   
Sbjct: 75  PVGNEEARAFF------------DGNQRGDADYTI---TSVDVSVIKHGN---VVESSVS 116

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
           ++         GL+     +++  +T    +          ++LD + SM          
Sbjct: 117 FKASVSTTL-SGLLGKDFVSVAGTATA---KYETETFSDFYLLLDNTPSMGVGATPTDVA 172

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +                +     +         +IDV+ ++  +L+++  K+ ++
Sbjct: 173 TLVANTGDKCAFACHIVKDGVADPNSYYFKAKKLGVTTRIDVVAKATASLMDT-AKSTRK 231

Query: 231 KKNLSVRIGTIAYNIGIVGN---QCTPLSNNLNEVKSRLNKLNPYE------NTNTYPAM 281
             N   R+    +          +   L+++L+  K +  ++N         N +     
Sbjct: 232 SSNQY-RMAVYTFGERAEDTKLLEVVSLTSDLDAAKKKAGEINLMSIPYQGYNNDQQTDF 290

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITD--GENSGASAYQNTLNT--------LQI 331
             A  ++ ++  SS     S    K + F++D  G++   S+    L          ++ 
Sbjct: 291 DRALIQIGDKVGSSGTGASSANPDKVIFFVSDGVGDSYKPSSCTKKLTGGRCQEPIDIKD 350

Query: 332 CEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRE 375
           C  ++  G +I   Y+  +  P                   ++ C  S G +F V+ S+ 
Sbjct: 351 CTKLKEKGFRIAVLYTTYLPLPTNDWYNSWIKPFQAEIGSRMQSCA-SPGLYFEVSPSQG 409

Query: 376 LLESFDKITDKIQE 389
           + ++   +  K   
Sbjct: 410 ISDAMTVLFKKAIT 423


>gi|327542237|gb|EGF28726.1| BatA aerotolerance operon protein [Rhodopirellula baltica WH47]
          Length = 345

 Score = 69.9 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 84/274 (30%), Gaps = 73/274 (26%)

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
            G  +  S+   I+I MV+D S SM             M  N    P             
Sbjct: 62  EGREQTVSQTEGIAIEMVIDRSGSM-----------QAMDFNIDGEPV------------ 98

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                        ++  +   A   +   +       +L   +G I +           L
Sbjct: 99  ------------DRLTAVKNVASKFITGGEDLEGRFSDL---VGLITFAAYADAETPPTL 143

Query: 256 --SNNLNEV-KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
             S  ++ + ++ +      + T    A+  +  +L          + S    K +I +T
Sbjct: 144 DHSFVVSRLNQTEIVSRRDEDGTAIGDAIALSVEKLNALDARQERKVQS----KILILLT 199

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS----------APPEGQDLLRK--- 359
           DGEN+        L+ +Q  E     G+KIY++ V            P  G+  L     
Sbjct: 200 DGENTAG-----ELDPIQAAELAETLGIKIYAIGVGTKGKAPVPVRDPFTGRQRLHYMEV 254

Query: 360 ----------CTDSSGQFFAVNDSRELLESFDKI 383
                        + G++F   D+  L   + +I
Sbjct: 255 NIDEATLQKVAEITGGKYFRATDTDSLDAIYREI 288


>gi|85374104|ref|YP_458166.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
 gi|84787187|gb|ABC63369.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
          Length = 623

 Score = 69.9 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 62/184 (33%), Gaps = 32/184 (17%)

Query: 230 EKKNLSVRIGTIAYNI-GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
           + K   ++ G   ++       +   +++   E+ S L+ L P+  T     M    R L
Sbjct: 437 DTKKEFIQTGNWWFSGCPAPAQKLKAMTSG--ELDSYLDSLTPHGATYHDGGMIWGGRLL 494

Query: 289 YNEKESSHNT--IGSTRLKKFVIFITDGENSGAS---------------AYQNTLNTLQ- 330
                 +            + +IF+TDG+                      Q +  TL  
Sbjct: 495 SQYGLFAAENSSKPGRTTSRHLIFLTDGQTEPYDLAYGSYGIDPIDERRWTQTSSLTLAQ 554

Query: 331 --------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
                    C  ++  G  ++ VA       +  ++ C  S G++F   ++ +L ++F  
Sbjct: 555 TVEERFLFACNEVKKLGATVWVVAFGTAANDK--MKTCAGS-GRYFEAANASQLNDAFST 611

Query: 383 ITDK 386
           I   
Sbjct: 612 IAKS 615



 Score = 59.9 bits (143), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 45/293 (15%), Positives = 92/293 (31%), Gaps = 71/293 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSD-RTIKDPTTKKDQ 59
           + A ++          +D++      +++Q A D+ VL+   ++ ++  T+ D  T    
Sbjct: 16  IAAGLLP-LLAMAGSGVDMSRAYLAESRLQQACDSGVLAARKALGTEIATLTDIPTDAG- 73

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
             T  ++    + + G+Y  +N     +   + +  D      Y     A  ++PT  + 
Sbjct: 74  --TRGQEFFNSNFQDGNYGTQN-----RTFNMVLEND------YSVSGTATVDVPTSVMT 120

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           + G      T + ++       S  +  + + MVLDV+ SM+                  
Sbjct: 121 VFGF-----TKIPVKVECQARISFSD--VDVMMVLDVTGSMKHTNSGDTL---------- 163

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                                        KID L  +  N  + ++ A        +R G
Sbjct: 164 ----------------------------SKIDSLKATVRNFYDQMEGAKSAGTR--IRYG 193

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA-----MHHAYRE 287
            + Y   +              V S   +      T T  A      + AY+ 
Sbjct: 194 FVPYASNVNVGHLLKDEW---VVNSWAYQSRAISGTTTVEAGTKTRENWAYKS 243


>gi|327542784|gb|EGF29248.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 264

 Score = 69.5 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 99/279 (35%), Gaps = 41/279 (14%)

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
                L P+  TNL +R   +    S    + + +V+D S SM        +D       
Sbjct: 24  PVFSPLFPTMGTNLEIRPQRVA--VSTQSTMDVALVIDRSGSMA-----YASDETPDPYV 76

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                PP     W+           P P N +   L+ S       +  + Q       +
Sbjct: 77  NPASAPP----GWTY--------GDPVPPNSRWLDLVASVNAFNGFLVDSPQ-----YEK 119

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKES 294
           +    Y+     ++   L++   E+ + L+ ++       T+    + H    L +    
Sbjct: 120 LCLATYSS--TASRDCDLTHTYAEISNELDAISYQFDGGGTSVGYGLEHGLAVLTDA--- 174

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
           +H    +    + ++ +TDG ++   + ++ +  LQ      N G+ ++++  S   +  
Sbjct: 175 THARKFAV---RVMVLMTDGHHNTGKSPESMMYHLQ------NHGVTLFTITFSDDADQS 225

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            +        G+ F   D+ +L  +F KI  K+     +
Sbjct: 226 RMSNLANACGGENFHATDASQLQNAFQKIAKKLPSLMTQ 264


>gi|328675375|gb|AEB28050.1| BatA in aerotolerance operon [Francisella cf. novicida 3523]
          Length = 333

 Score = 69.5 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 54/290 (18%), Positives = 99/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 59  YLKYLLGVIWILLIISGSGIQWLGKPISLPQSGRDLIMAIDLSGSMAIQDMKKSN----- 113

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 114 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 136

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 137 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKY 193

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 194 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 238

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +    + G++F   +S +L + ++ I
Sbjct: 239 MIVETTFGQRLINTSEDLDTTVLEKIAEMTGGKYFRAQNSSDLKKVYESI 288


>gi|222616410|gb|EEE52542.1| hypothetical protein OsJ_34771 [Oryza sativa Japonica Group]
          Length = 654

 Score = 69.5 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 45/263 (17%), Positives = 87/263 (33%), Gaps = 56/263 (21%)

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
           P      +G        L           + ++ + +  VLDVS SM D        +N 
Sbjct: 36  PIFPTIPRGQTNKDFQVLLRVEAPPAADLNSHVPLDVVAVLDVSGSMNDPVAAASPKSNL 95

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
             S                                ++DVL  S   ++  +         
Sbjct: 96  QGS--------------------------------RLDVLKASMKFVIRKLADGD----- 118

Query: 234 LSVRIGTIAYNIGIVGNQCTPL----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
              R+  +A+N G V    + L     +  +    ++++L     T   PA+  A + L 
Sbjct: 119 ---RLSIVAFNDGPVKEYSSGLLDVSGDGRSIAGKKIDRLQARGGTALMPALEEAVKILD 175

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
             + SS N +G      F++ +TDG+++    +        +      A   +++  + A
Sbjct: 176 ERQGSSRNRVG------FILLLTDGDDTTGFRWTRDAIHGAV------AKYPVHTFGLGA 223

Query: 350 PPEGQDLLRKCTDSSGQFFAVND 372
             + + LL     S G +  V+D
Sbjct: 224 SHDPEALLHIAQGSRGTYSFVDD 246


>gi|167946540|ref|ZP_02533614.1| BatB protein, putative [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 345

 Score = 69.5 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 41/267 (15%), Positives = 79/267 (29%), Gaps = 85/267 (31%)

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
             +      + + +D SRSM       H                                
Sbjct: 89  TENRTAGYDLMLAVDTSRSMTAEDFTVHGREV---------------------------- 120

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
                   ++ VL    G  V+           +  RIG I +         +PL+ + N
Sbjct: 121 -------SRLSVLKGIMGKFVD---------GRVGDRIGLIIFGD--TSYVLSPLTFDRN 162

Query: 261 EVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            +   L+ +        T     +    ++L    E S          + +I +TDG+N 
Sbjct: 163 AIHQLLDGIVPTLAGGGTAIGDGIGLGIKKLRERPEGS----------RVLILVTDGKNE 212

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL-------------------- 357
                  T+  L+  +  +  G++IY++ V +      LL                    
Sbjct: 213 TG-----TIPPLKAAQLAKQEGIRIYTIGVGSTKNRVRLLSPDLRTYEIATGLAIDEETL 267

Query: 358 -RKCTDSSGQFFAVNDSRELLESFDKI 383
            +    + G +F  ND+  L + + +I
Sbjct: 268 QQIAETTGGAYFRANDTAGLEKVYQRI 294


>gi|294678572|ref|YP_003579187.1| hypothetical protein RCAP_rcc03056 [Rhodobacter capsulatus SB 1003]
 gi|294477392|gb|ADE86780.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 647

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
           N+          T ++C+  ++ G+ I+SVA  AP  G+ LL+ C+  +  ++ V     
Sbjct: 570 NAVYDTSVKDARTKKLCDLAKSKGIYIFSVAADAPSGGKTLLKYCSSGTSYYYEVQ-GSN 628

Query: 376 LLESFDKITDKIQE 389
           L  +F  I   I  
Sbjct: 629 LSTAFASIAASISS 642



 Score = 49.1 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 57/400 (14%), Positives = 110/400 (27%), Gaps = 107/400 (26%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           V  +    AIDL  +   R  +Q+ +D AVL+  +  ++ +       K      + K  
Sbjct: 42  VMLITTGIAIDLVRVEERRTLIQNTIDRAVLAAAS--LTQKRDPTLVVKD----YLTKAG 95

Query: 68  IKKHLKQGSYIRENAGDIAQK-AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPS 126
           +       S+  +  G IA    ++++  D +                        L+  
Sbjct: 96  LGYIASDSSFTPKVEGSIALGWRRVSVEVDDD-----------------MPTIFGPLLGV 138

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
           +    SL +TG          + I +VLD+S SM +      +   N TS+K        
Sbjct: 139 S----SLAATGDTTAMQAVGNVEISLVLDLSGSMTEYVKDNPSCTKNCTSSKTRFQYLQV 194

Query: 187 KSFWSKNTTKSKYAPAPAPANRKID-------------------------------VLIE 215
            +    NT  +      A     +                                 + +
Sbjct: 195 AAKSFINTVFASSGSGVAAGRTSVSVVPYSTNVYLGSEMQEGYTLSSDFSVTGSSFAMPQ 254

Query: 216 SAGNLVNSIQKAIQEKKNLSVRI------------------GTIAYNIGI--------VG 249
            A  + N     + +      R                   G+ + N G           
Sbjct: 255 CADFVANDYNTMVIDGTGPLTRTMYGSSYKYSDSLSALVSDGSTSNNPGQDWHNCMNTPQ 314

Query: 250 NQCTPLSNNLNEVKS----RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS---- 301
           N+  PLS++   + +     ++KL     T+           L +          +    
Sbjct: 315 NRVIPLSSDPTFLAADKTGFIDKLTAGGWTSIDVGAKWG-LALLDPSARDEVAKMTSVSS 373

Query: 302 -------------TRLKKFVIFITDGENSGASAYQNTLNT 328
                            K ++ +TDG N+   +      T
Sbjct: 374 AFRETKPRPINYDGDTMKVLVLMTDGANTTNFSTLPGYRT 413


>gi|152990152|ref|YP_001355874.1| von Willebrand factor A [Nitratiruptor sp. SB155-2]
 gi|151422013|dbj|BAF69517.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 305

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 75/247 (30%), Gaps = 66/247 (26%)

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
           +     I + +D S SM                                   + K     
Sbjct: 79  KKKGYDIVLAIDASGSM-----------------------------------QEKGFDPT 103

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
            P   K DV+          I K   +       IG + +         +PL+ N   VK
Sbjct: 104 DPQKTKFDVVRSLVKAF---ISKRRNDN------IGVVIFGSFAYI--ASPLTFNKEAVK 152

Query: 264 SRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
             L+ L+       T    A+  + R L            S    K VI +TDG ++ + 
Sbjct: 153 KILDYLDIGVAGSKTAIDDALIESVRLL----------KESQAKSKIVILLTDGIDTASK 202

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-GQDLLRKCTDSS-GQFFAVNDSRELLE 378
              +        +  +  G+KIY++ +       +  LR       G +F   D+  L +
Sbjct: 203 TPPDV-----AVKMAKKYGVKIYTIGIGDKRGIDEAFLRWLAQQGHGYYFYAKDASMLRK 257

Query: 379 SFDKITD 385
            +D+I  
Sbjct: 258 IYDEINR 264


>gi|323135950|ref|ZP_08071033.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
 gi|322399041|gb|EFY01560.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
          Length = 432

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 59/430 (13%), Positives = 130/430 (30%), Gaps = 88/430 (20%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++ +  +    A+D + I   ++ +  A DA VL+          +K+   +  Q    +
Sbjct: 21  LMPLALMAGG-AVDFSQISRQKSALNQAADAGVLTA---------LKEAREQLKQGKPDW 70

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           +   +K   +      +           I    +     +      Y       FL+ + 
Sbjct: 71  QSIAEKQGGKAFTNNASKIGGVSGTGATINLSLSGG---VLSGSLNYAANAPTHFLR-IA 126

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                NL   ++  +  +       I  V+DVS SM     +        +    +    
Sbjct: 127 GLNTINLKGSASATMSAAQYR---DIHFVIDVSASMGIGATKADQQAMQNSVGCAVACHH 183

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
            + +      T +  A     A  +IDV+ ++  + +  I        + S R+   +++
Sbjct: 184 AEAAD---PATDNLAAVRAIGATLRIDVVRKAVMDALAKI------PNDGSTRVAIHSFS 234

Query: 245 IGIVGNQCTPLSNNLNEVKSR-----LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
             +      PLS N+    S      L   N    TN     H++  +L N   S+ N +
Sbjct: 235 NSL--KTVFPLSTNIAGAISATQSIDLTNENGQGGTN----FHYSLNQLNNLLASAGNGL 288

Query: 300 GSTRLKKFVIFITD-----------------------------GENSGASAYQNTLNTLQ 330
            +++ + FV+  TD                             G  S  +   + +    
Sbjct: 289 TASQPRGFVLLATDAVEDSSLFFYADGVAPPFARQWVEPNFVVGNPSYFAWGLHYVQAPD 348

Query: 331 I--CEYMRNAGMKIYSV-------------------AVSAPPEGQDLLRKCTDSSGQFFA 369
              C  ++  G  + ++                       P   +  +  C  +   +F 
Sbjct: 349 AANCSAIKAKGYTMMTLETEYLIPDGVYNPTFDAVRGDMGPAMTKS-MTDCASAPDYYFH 407

Query: 370 VNDSRELLES 379
               +E+  +
Sbjct: 408 AESPQEIDRA 417


>gi|218671335|ref|ZP_03521005.1| hypothetical protein RetlG_06538 [Rhizobium etli GR56]
          Length = 49

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 20/47 (42%)

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            AP  GQ LL+ C   +  +F      +L  +F  I  K   Q  R+
Sbjct: 1   MAPEGGQALLQYCASDASHYFQAEKMEDLFAAFKAIGAKASTQVTRL 47


>gi|299534564|ref|ZP_07047896.1| hypothetical protein BFZC1_01007 [Lysinibacillus fusiformis ZC1]
 gi|298729937|gb|EFI70480.1| hypothetical protein BFZC1_01007 [Lysinibacillus fusiformis ZC1]
          Length = 864

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 52/329 (15%), Positives = 107/329 (32%), Gaps = 78/329 (23%)

Query: 66  KQIKKHLKQGSYIRENA-GDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
            ++  +L+  + I +N  G +  +A++++ +                    EN F  G  
Sbjct: 329 NELSSYLQYNAIIFDNVPGHLVGEAKMSVIEQTVKNFGVGFTMVG-----GENSFGLGGY 383

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
                   L     I+   +  ++ + +VLD S SM+                       
Sbjct: 384 FKTPIETLLPVEMEIKGKEQLPSLGLVIVLDRSGSMQG---------------------- 421

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
                                   K+++  E+A   V  ++            +G IA++
Sbjct: 422 -----------------------SKLELAKEAAARSVEMLRDEDT--------LGFIAFD 450

Query: 245 I-GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
                  +  PLS+    V + +  + P   T  Y ++  AY  L + K           
Sbjct: 451 DRPWEIIETGPLSSKEEAVDT-ILSVTPGGGTEIYSSLAKAYENLADLKLQ--------- 500

Query: 304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDS 363
            +K +I +TDG++          N   +    +  G+ + +VA+    +   L       
Sbjct: 501 -RKHIILLTDGQSQAG-------NYEDLITEGKEDGITLSTVAIGQDADANLLEALSDMG 552

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQSV 392
           SG+F+ V D + +     + T  I    +
Sbjct: 553 SGRFYDVIDEQTIPSILSRETAMISRTYI 581


>gi|59713864|ref|YP_206639.1| hypothetical protein VF_A0681 [Vibrio fischeri ES114]
 gi|59482112|gb|AAW87751.1| hypothetical membrane spanning protein [Vibrio fischeri ES114]
          Length = 321

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 85/256 (33%), Gaps = 81/256 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM +  ++  N                                       
Sbjct: 84  DMMLVVDLSGSMAEEDMKTSN----------------------------------GDFVD 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  + +   + ++  +           R+G + +         TPL+ + N V+ +L++
Sbjct: 110 RLTAVKQVVSDFIDQRKG---------DRLGLVLFGDHAYLQ--TPLTFDRNTVREQLDR 158

Query: 269 --LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
             LN     T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLNLVGQRTAIGEGLGLA----------TKTFIESNAPQRTIILLSDGANTAG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L  L+  +  ++   KIY+V + A                    +   L +  T + GQ+
Sbjct: 204 LEPLEAAQLAKDNHAKIYTVGIGAGEMQVRGFFGKQTVNTARDLDEDTLTKIATMTGGQY 263

Query: 368 FAVNDSRELLESFDKI 383
           F   ++ EL E +  I
Sbjct: 264 FRARNADELAEIYQTI 279


>gi|320333536|ref|YP_004170247.1| von Willebrand factor type A [Deinococcus maricopensis DSM 21211]
 gi|319754825|gb|ADV66582.1| von Willebrand factor type A [Deinococcus maricopensis DSM 21211]
          Length = 509

 Score = 69.5 bits (168), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 69/183 (37%), Gaps = 22/183 (12%)

Query: 209 KIDVLIESAGNLVN---SIQKAIQEKKNLSVRIGTIAYNIGI---VGNQCTPLSNN--LN 260
           +ID L  +   L     ++        N   R+  I ++         + TP +    L 
Sbjct: 337 RIDALKTALRGLSGADTTLTGRYATFANRE-RVTLIPFSSAPGAPRTTELTPATRGAALK 395

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           +++++++ L P   TN Y A+  AY +        + +         ++ +TDGE +   
Sbjct: 396 QLRAQVDALTPDGGTNIYGALQAAYEQARAAPAGRYTS---------IVLMTDGERTEGP 446

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
           +      T       R   +K ++V      +  ++ R  T + G+ F   +  +L  +F
Sbjct: 447 SADQFRATYAALPE-RARQVKTFTVLFGDS-DATEMNRIATLTGGRTFDGQN--DLRAAF 502

Query: 381 DKI 383
             I
Sbjct: 503 KDI 505


>gi|156741949|ref|YP_001432078.1| von Willebrand factor type A [Roseiflexus castenholzii DSM 13941]
 gi|156233277|gb|ABU58060.1| von Willebrand factor type A [Roseiflexus castenholzii DSM 13941]
          Length = 847

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 87/259 (33%), Gaps = 30/259 (11%)

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
           +P+ + +L   +T      SE   +   + +    S      +       +       P 
Sbjct: 330 VPAGVLSLDQMATLREFVRSEGRGL---LAIGGRSSFTLGAYKDTPLEETLPVTMVPPPR 386

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
           P +             +  P     K  +  E+A     S++           RIG +A+
Sbjct: 387 PERSDTTLLLIIDQSASMGPETGLSKFTMAKEAAIMATESLRAED--------RIGVLAF 438

Query: 244 NIGIV-GNQCTPLSNNLN--EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           ++         P+   L+  +++ R++ L     T+ Y A+     EL  +         
Sbjct: 439 DVSTRWVVDFQPVGTGLSLADIQRRISTLPLGGGTDIYNALQTGLPELARQPGR------ 492

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
                +  + +TDG     S   +      + E  R+  + + ++A+    +  DLL+  
Sbjct: 493 ----VRHAVLLTDG----RSFTDDRQAYQALIEEARSRNITLSTIAIGTDAD-IDLLQTL 543

Query: 361 TD-SSGQFFAVNDSRELLE 378
               +G+++   +  ++  
Sbjct: 544 ARWGAGRYYFAAEPGDIPR 562


>gi|256426121|ref|YP_003126774.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
 gi|256041029|gb|ACU64573.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
          Length = 462

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/271 (13%), Positives = 83/271 (30%), Gaps = 63/271 (23%)

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
           Y  P  N   +         ++++  G  E S   + ++I +VLD S SM          
Sbjct: 45  YVKPGNNWVYQNSNGDCYLYVNIKG-GEGEASKPRVPLNISLVLDRSGSMSG-------- 95

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 KI    ++A  L++ +      
Sbjct: 96  -------------------------------------DKIKYARQAAKFLIDQLNSTDH- 117

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN 290
                  +  + Y+  +     +    N   +K+ ++K++   +TN    M   Y ++ +
Sbjct: 118 -------LSIVNYDDRVEVTSPSQSVKNKEALKAAIDKIHDRGSTNLSGGMLEGYTQVKS 170

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
            ++  +           V+ +TDG  +        L  L      +  G+ + +  V A 
Sbjct: 171 TRKEGYVNR--------VLLLTDGLANQGITDPLELKRLAE-NKYKEDGIALSTFGVGAD 221

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFD 381
                L     +    ++ ++   ++ + F 
Sbjct: 222 YNEDLLTMLAENGRANYYFIDSPDKIPQIFA 252


>gi|153010351|ref|YP_001371565.1| hypothetical protein Oant_3028 [Ochrobactrum anthropi ATCC 49188]
 gi|151562239|gb|ABS15736.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 605

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 66/472 (13%), Positives = 152/472 (32%), Gaps = 103/472 (21%)

Query: 22  IMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIREN 81
            +    ++++ ++ A++   +  + +        + D       + ++    Q + I  +
Sbjct: 134 TLSSSVRLKNTIEVALVLDNSRSMDETRSGSTKKRIDLLKEAASQLVETMAAQSTLIT-H 192

Query: 82  AGDIAQKAQINITKDKNNPLQYIAES----KAQYEIPTENLFLKGLIPS--ALTNLSL-- 133
             +  Q + +      N   QY+  +    + +  +  EN  L   I S   +    +  
Sbjct: 193 VENPVQFSLVPFAGSVNVGPQYLNAAWMDPEGRSPVNLENFTLPVTIDSTRKIEEKPVGS 252

Query: 134 -----RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKS 188
                  TG  ER+++  + +  +  D+S   ++ +L       +      L   PP  +
Sbjct: 253 GRYYKSGTGWGERNNKPYSRA-ELYADLSLRSKETWLPWQGCVESRPGTYALDVTPPSDN 311

Query: 189 F------------WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA-IQEKKNLS 235
                           NT       +    +   D    +     + ++K  +++  +  
Sbjct: 312 NPDTLFVPMFGPAEYYNTDSRGNVTSTVLNSWWQDDTSLAYSPRQSDLKKYYLRDSLDKI 371

Query: 236 VRIGTI---AYNIGIVGNQCTPLSN-----NLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
            R G       N     +  TPL++      +  +++ +  + P   TN   AM   +R 
Sbjct: 372 YRGGRSNDGGPNYSCTSSPLTPLTDVTTEQGMKTIQTAIKAMVPSGGTNVPEAMAWGWRT 431

Query: 288 LY-NEKESSHNTIGSTRLKKFVIFITDGENSG---------------------------- 318
           +      +           K VI +TDG N+                             
Sbjct: 432 IVRGAPFTEARPSTERGNDKVVIVLTDGANTYYKYDGLAGSGPDRAANFSYYSAHGYTAR 491

Query: 319 ---------------------ASAYQNTLNTL--QICEYMRNAGMKIYSVAV-----SAP 350
                                 S Y   +N    ++C+  ++A + + +VA+     ++ 
Sbjct: 492 ITKHYSQARLFQESGVSVSQNNSTYTKAMNARFAKLCDNAKSANIIVMTVALDLSETNST 551

Query: 351 PEGQ-DLLRKCTDS---------SGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + Q DLLR C+ +           + F  +   EL E+F +I D++    +
Sbjct: 552 EKAQIDLLRSCSSNSRVRTESGRPAKLFWNSTGGELSETFRQIGDELSNLRI 603



 Score = 40.3 bits (92), Expect = 0.63,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 58/149 (38%), Gaps = 18/149 (12%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQ 74
            A+D A++M +RN +Q++LDAA L+      +  +         Q  T            
Sbjct: 30  VAVDSANLMRVRNNVQASLDAAALAVGRRFSTGESQTVVQVYGAQVFT----------AN 79

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
            + +  +A +       + T D     Q  A +   Y+     +  +        N    
Sbjct: 80  LTALSADAVNFDVAFPKDKTTD----QQIQATAGFTYKSLFGVIASRLTGDDWDQNQYTL 135

Query: 135 STGIIERSSENLAISICMVLDVSRSMEDL 163
           S+ +  +++    I + +VLD SRSM++ 
Sbjct: 136 SSSVRLKNT----IEVALVLDNSRSMDET 160


>gi|260434111|ref|ZP_05788082.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417939|gb|EEX11198.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 600

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 60/400 (15%), Positives = 115/400 (28%), Gaps = 80/400 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +T  +I + F+   +A+D+      R ++Q ALD AVL+                     
Sbjct: 36  LTLFLIMIVFVASGFAVDVMRYDRERAKLQYALDRAVLAAA---------------DLDQ 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               K  +  +LK+    +   GD        +  D       + +   + E   +    
Sbjct: 81  ELCPKDVVIDYLKKEGLDKYLTGD------PKVEPDVCGSTAAVLKGYRRVEANADMDIE 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM----------------EDLY 164
              +          +   +   S    + I +VLDVS SM                +D++
Sbjct: 135 MHFMKWRGIETIASAATSVAEESIGN-VEISLVLDVSGSMRGSKLENLKKAANLFIDDMF 193

Query: 165 LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA----------------PANR 208
            +  +   +++   Y           +K  T+   + A                      
Sbjct: 194 AKTEDGKVSISIVPYSEQVSIPDYLMNKLNTQGTNSIANCVDFASADFATTRFTAFDVTD 253

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY-----NIGIVGNQCTPLSNNLNEVK 263
            +  ++     L  +I   I +  +     G ++      N      + T L  +   +K
Sbjct: 254 PVTGIVTPGTTLARTIHHDIGDGSDRRPYNGFVSSTICRPNTSTNHREITILQKDPVALK 313

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNE------------------KESSHNTIGSTRLK 305
             +N LN    T+           L +                   K+      G   + 
Sbjct: 314 KEINLLNASGWTSIDVGAKWGVTLLDDSFQPLTKKLVTESKVPSIFKDRPDQNKGYDTM- 372

Query: 306 KFVIFITDGENSGASAYQNTLN--TLQICEYMRNAGMKIY 343
           K +I +TDGEN+         N  T  I          +Y
Sbjct: 373 KVMILMTDGENTKQHKVNPPYNHGTSDIWWNADKEKYSVY 412



 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 8/88 (9%)

Query: 310 FITDGENSGASAYQNTLNTLQ-------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
           F T   N   +     LN +Q       IC+  ++  + I+S+A  AP   + LL+ C  
Sbjct: 508 FGTSYANEWYNTSTTVLNQVQKDPRLTSICQKAKDEKIIIFSIAFDAPDGVKPLLKGCVS 567

Query: 363 SSGQFFAVNDSR-ELLESFDKITDKIQE 389
             G ++   D+  +++  F  I   IQ 
Sbjct: 568 DDGAYYEAKDNDKDIISVFSSIGSTIQN 595


>gi|37676036|ref|NP_936432.1| hypothetical protein VVA0376 [Vibrio vulnificus YJ016]
 gi|37200576|dbj|BAC96402.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 323

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 39/258 (15%), Positives = 82/258 (31%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM+   + +  D                                      
Sbjct: 87  DLMLVVDLSGSMQQEDILQDGD-----------------------------------YID 111

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +       +               R+G + +         TPL+ +   V ++LN+
Sbjct: 112 RLSSVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVANQLNQ 160

Query: 269 LNPY--EN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +  A +   +          S   ++ VI ++DG N+       T
Sbjct: 161 TIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG-----T 205

Query: 326 LNTLQICEYMRNAGMKIYSVAV------------------SAPPEGQDLLRKCTDSSGQF 367
           L+ ++     +  G+KIY++ +                  SA  + + L +  T + GQ+
Sbjct: 206 LDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKIATMTGGQY 265

Query: 368 FAVNDSRELLESFDKITD 385
           F   D++EL   +  I  
Sbjct: 266 FRARDAQELQTIYQAINQ 283


>gi|222616155|gb|EEE52287.1| hypothetical protein OsJ_34277 [Oryza sativa Japonica Group]
          Length = 367

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 80/232 (34%), Gaps = 55/232 (23%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
           ++ I +  VLDVS SM D  +   +   N                               
Sbjct: 43  HVPIDVVEVLDVSGSMGDPAMASSDFKKNKPP---------------------------- 74

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLN 260
               ++DVL ++   ++  ++           R+  +A+N   V    T L     N   
Sbjct: 75  ---SRLDVLKDAMKFIIRKLEDGD--------RLSIVAFNDRPVKEYSTGLLDISGNGRR 123

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
             + +++ L     T   PA+  A R L      S N +G      F++ +TDG+++   
Sbjct: 124 IAEKKVDWLEGRGGTALMPALEEAIRVLDCRPGDSRNRVG------FILLLTDGDDTSGF 177

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
            +   +    +          +++  + A    + LL    +S G +  V+D
Sbjct: 178 RWSRDVINGAV------GKYPVHTFGLGAAHSSEALLYIAQESRGTYSFVDD 223


>gi|332291974|ref|YP_004430583.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170060|gb|AEE19315.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
          Length = 334

 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 70/203 (34%), Gaps = 53/203 (26%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++ L + A + +N          +   RIG I Y         TP++++ + V S L 
Sbjct: 112 NRLEALKKVAASFIN------GRPND---RIGLIEYAGESFTK--TPITSDKSIVLSALK 160

Query: 268 KLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            +         T     +      L            S  L K +I +TDGEN+      
Sbjct: 161 SIQYNNIIEGGTAIGMGLATGVNRL----------KDSKALSKVIILMTDGENNAGQ--- 207

Query: 324 NTLNTLQICEYMRNAGMKIYSVA-----------------------VSAPPEGQDLLRKC 360
             ++     E  +  G+K+Y++                        +    + + L    
Sbjct: 208 --IDPRIAAELAQEFGIKVYTIGMGTNGMALSPYARNANGTFVYENIQVTIDEELLEEIA 265

Query: 361 TDSSGQFFAVNDSRELLESFDKI 383
             + GQ+F   ++ +L E +D+I
Sbjct: 266 ATTGGQYFRATNNEKLQEIYDEI 288


>gi|222528098|ref|YP_002571980.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222454945|gb|ACM59207.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 902

 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 49/342 (14%), Positives = 102/342 (29%), Gaps = 73/342 (21%)

Query: 52  DPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY 111
           D          + K      +   +  RE+  D    +     KD    L  I  + +  
Sbjct: 319 DAVKSDQANFGLDKLLGYSFVILCNVSRESFSDEFLSSVEKYVKDLGGGLLVIGGTNSYA 378

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
                N  L+ ++P             I+   +   I + +VLD S SM D         
Sbjct: 379 LGNYSNSVLEKMLPVK---------MEIKNKEKEKNIDVVLVLDHSGSMADTEDA----- 424

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
                                                K+++   ++  ++  ++ +    
Sbjct: 425 ----------------------------------GIPKLEIAKSASAKMIEHLESSDG-- 448

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
                 +G IA++            +   +V   ++ +     T   P +  A + L   
Sbjct: 449 ------VGVIAFDHNYYWAYKFGKISKKEDVIESISSIEVGGGTAIIPPLSEAVKTLKKS 502

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           K  S            ++ +TDG                     +   +KI ++ V    
Sbjct: 503 KAKSKL----------IVLLTDG-------MGEQGGYEIPANEAKRNNIKITTIGVGKYV 545

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
               L    + +SG+F+ V++  EL++ F K T  I+ + ++
Sbjct: 546 NATVLSWIASFTSGRFYLVSNPSELVDVFLKETKIIKGKYIK 587


>gi|328676285|gb|AEB27155.1| BatA in aerotolerance operon [Francisella cf. novicida Fx1]
          Length = 333

 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 100/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 59  YLKYLLGVIWILLIISGSGIQWLGKPVSLPQSGRDLIMAIDLSGSMAIQDMKKAN----- 113

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 114 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 136

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 137 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKY 193

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 194 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 238

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +  T + G++F   +S +L + ++ I
Sbjct: 239 MIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRAQNSSDLKKVYESI 288


>gi|313207255|ref|YP_004046432.1| von willebrand factor type a [Riemerella anatipestifer DSM 15868]
 gi|312446571|gb|ADQ82926.1| von Willebrand factor type A [Riemerella anatipestifer DSM 15868]
 gi|315023479|gb|EFT36485.1| aerotolerance operon BatA [Riemerella anatipestifer RA-YM]
 gi|325335298|gb|ADZ11572.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Riemerella anatipestifer RA-GD]
          Length = 330

 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 74/202 (36%), Gaps = 51/202 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL- 266
            ++  L E A   +             + RIG + Y+   +     PL+++   V+  L 
Sbjct: 108 DRLTALKEIARTFIKQ---------RTTDRIGLVEYSGEALMR--VPLTSDHRVVEEELM 156

Query: 267 --NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
             N ++    TN    +  A   L            S    K +I +TDG N+  +A   
Sbjct: 157 SFNPMDLEGGTNIGDGLAVAVSHL----------RKSKAKSKIIILMTDGVNTIDNA--- 203

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAP-----PEGQD-----------------LLRKCTD 362
            ++ L   E  RN  +K+Y++ + +      P  QD                 LLR    
Sbjct: 204 -MSPLTAAELARNNDIKVYTIGIGSNGLALMPTQQDIFGNLVFTEEQVKIDEYLLRDVAQ 262

Query: 363 -SSGQFFAVNDSRELLESFDKI 383
            + G++F    +  L + +++I
Sbjct: 263 ITGGKYFRATSNESLKQIYEEI 284


>gi|254443725|ref|ZP_05057201.1| von Willebrand factor type A domain protein [Verrucomicrobiae
           bacterium DG1235]
 gi|198258033|gb|EDY82341.1| von Willebrand factor type A domain protein [Verrucomicrobiae
           bacterium DG1235]
          Length = 339

 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 97/283 (34%), Gaps = 83/283 (29%)

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
           +  L+       ER S++    I + +D+SRSME                          
Sbjct: 66  IIALARPQAVTTERHSKSRGYDIVLAVDLSRSME-------------------------- 99

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
                    ++        + ++  +       +N         +  + RIG IA+    
Sbjct: 100 ---------AEDYFVDRKRSNRLQAVKPVLSAFIN---------RRENDRIGLIAFAGR- 140

Query: 248 VGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELY-NEKESSHNTIGSTR 303
                 PL+ +   +  +  +L      + T    ++  A   L    KE +    G+  
Sbjct: 141 -AYTVAPLTFDHKWLARQTERLQIGLIEDGTAIGDSLAVATSRLLEGAKERAGEREGA-- 197

Query: 304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP------------ 351
              F++ +TDGEN+          TL      ++AG+++Y++A                 
Sbjct: 198 ---FIVLLTDGENTAGMMDPMEGATL-----AKDAGIRVYTIAAGKNGYVPFPRRNERGE 249

Query: 352 -----------EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                      + + L++   +++G+FF   +S  + ++F+KI
Sbjct: 250 RIGTTQEFLRVDTETLMKIANETNGEFFRAENSDTIDQAFEKI 292


>gi|188580137|ref|YP_001923582.1| hypothetical protein Mpop_0869 [Methylobacterium populi BJ001]
 gi|179343635|gb|ACB79047.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 477

 Score = 68.8 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 71/469 (15%), Positives = 140/469 (29%), Gaps = 98/469 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ +      +   ID    +  + ++ +A DAAVL+G  +       +   +   Q 
Sbjct: 29  MFALALLPTLGLVGLGIDYGMAITSKTRLDNAADAAVLAGVVTA-----KEYIASNAKQG 83

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                       +       N G +     +++++           +   Y    +N F 
Sbjct: 84  DATAAGLTAGRNQATKAFAINTGKVPFAT-VSVSRLDVTRSGQTLTATVIYTATIQNTF- 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  + T  +   T   + +S    +   +++DVS SM         +     + +  
Sbjct: 142 GKILGLSSTTFTNTITASADLAS---YLDFYLMVDVSGSMGLPTAAADAEKLASITKEDQ 198

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F      +  +  A      + D +  +   L+   + A     N   RIG 
Sbjct: 199 GNCQFACHF----PGRKGWNNAAGKIQLRSDAVNNAVCELLK--RAATPVVPNQY-RIGF 251

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKS-------------RLNKLNPYENTNTYPA------- 280
             +   +     +PLS+    + +                 L    +T  +         
Sbjct: 252 YPFINRLA--TLSPLSDTTTSMTALRTAAQCDKTWPLAFTNLLDTGSTQLFTGNNPTTGT 309

Query: 281 ------MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE------------------- 315
                    A  ++    +   +   +T  K FV  ITDG                    
Sbjct: 310 GSGGTHFEKALPQMKATIQPYGDGSSTTNSKPFVFLITDGMQNSQSYSTNNDARTFPGSP 369

Query: 316 -------NSGASAYQNTLNTLQICEYMRNAGMKI-----------------YSVAVSAPP 351
                  N+G    Q        C+ +++AG  I                 Y V  +   
Sbjct: 370 SLFKGYGNAGWDGSQPAQIDPSKCKELKDAGAIISILYIPYNQVKNYTNDSYIVWENNRV 429

Query: 352 EG-----QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            G      D LRKC  S G F+  N + ++  S       + +Q++R+A
Sbjct: 430 NGFSPTLADPLRKCA-SQGFFYTANSADDITASLG----AMFDQALRVA 473


>gi|254373668|ref|ZP_04989152.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571390|gb|EDN37044.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 339

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 100/290 (34%), Gaps = 85/290 (29%)

Query: 119 FLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +LK L+      L +  +GI       S       + M +D+S SM    ++K N     
Sbjct: 65  YLKYLLGVIWILLIISGSGIQWLGKPVSLPQSGRDLIMAIDLSGSMAIQDMKKAN----- 119

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             + D+++  A   +++ +         
Sbjct: 120 -----------------------------GQMESRFDLVMRVANQFLDTRKG-------- 142

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNE 291
             R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++L   
Sbjct: 143 -DRVGLILFGTRAYLQ--TPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKF 199

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA----- 346
              S          K +I +TDGEN+       TL  LQ  E  +   +KIY++      
Sbjct: 200 PGDS----------KALILLTDGENNSG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQ 244

Query: 347 -VSAPPEGQDLL------------RKCTDSSGQFFAVNDSRELLESFDKI 383
            +     GQ L+            +  T + G++F   +S +L + ++ I
Sbjct: 245 MIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRAQNSSDLKKVYESI 294


>gi|153871328|ref|ZP_02000529.1| von Willebrand factor type A domain protein [Beggiatoa sp. PS]
 gi|152072210|gb|EDN69475.1| von Willebrand factor type A domain protein [Beggiatoa sp. PS]
          Length = 280

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 82/257 (31%), Gaps = 34/257 (13%)

Query: 148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW-SKNTTKSKYAPAPAPA 206
           I I    D +       +                   P    W S   +           
Sbjct: 37  IDIEYAYDKNG-----VVTVSATERVTGQTLPKQAQIPDDLSWLSLPPSPESVTLVHQSV 91

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSV----RIGTIAYNIGIVGNQCTPLSNNLNEV 262
              IDV     G+ +   ++A QE    S      IG I +         + L+ N   +
Sbjct: 92  FLLIDVSYSMDGSALAEAKQAAQEFVRKSDLAHTAIGLIEFGSK--AKIISGLTQNAKHL 149

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
              +N+L    +TN    +  AY +L N  +            +F+I +TDG  +     
Sbjct: 150 YKAINRLKTNGSTNMTEGLTTAYLKLKNVDDP-----------RFIILLTDGLPNHPK-- 196

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
               NT QI + +   G+++ ++        +  L+         F    +  ++ +F +
Sbjct: 197 ----NTQQIAQEICADGIELITIGTG--DADKTYLQSLACYDQNSFFA-KAGTMVSTFSR 249

Query: 383 ITDKIQE--QSVRIAPN 397
           I   + E    ++I  N
Sbjct: 250 IAQVLTESGSYIQITQN 266


>gi|163848654|ref|YP_001636698.1| von Willebrand factor type A [Chloroflexus aurantiacus J-10-fl]
 gi|222526590|ref|YP_002571061.1| von Willebrand factor type A [Chloroflexus sp. Y-400-fl]
 gi|163669943|gb|ABY36309.1| von Willebrand factor type A [Chloroflexus aurantiacus J-10-fl]
 gi|222450469|gb|ACM54735.1| von Willebrand factor type A [Chloroflexus sp. Y-400-fl]
          Length = 947

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 93/290 (32%), Gaps = 63/290 (21%)

Query: 108 KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK 167
           +    I  E+ F  G         +L     +        ++I  V+D S SM+      
Sbjct: 370 RGLLMIGGEDSFGVGGYGRTAVEEALPVYMDVRNRELRPDLAIVFVIDKSGSMD------ 423

Query: 168 HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA 227
                            P +            AP  + + RKID+  ++       +Q A
Sbjct: 424 -----------ACHCADPDRG-----------APITSSSERKIDIAKDAI------VQAA 455

Query: 228 IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN--LNEVKSRLNKLNPYENTNTYPAMHHAY 285
                  +V  G + ++     +   P +    + +V   ++ + P   TN    +  A 
Sbjct: 456 ALLGPQDTV--GVVTFDG--AASATFPATRGATVEQVMDAVSGVEPRGPTNIRAGLLRAE 511

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
             L                 K +I +TDG       + +  + L +   +R  G+ + +V
Sbjct: 512 EMLQQVDARI----------KHMILLTDG-------WGSGGDQLDLAARLREQGITL-TV 553

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF-----DKITDKIQEQ 390
             +       L +   +  G+++   D  E+ + F       I + I EQ
Sbjct: 554 VAAGSGSAAYLKQLAAEGGGRYYPAADMAEVPQIFVQETITAIGNYIVEQ 603


>gi|218781310|ref|YP_002432628.1| hypothetical protein Dalk_3472 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762694|gb|ACL05160.1| conserved hypothetical protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 308

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 72/255 (28%), Gaps = 65/255 (25%)

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
           T    R  +   + I + LD S SM                                   
Sbjct: 74  TVDASREIKTPGVDIILCLDASESMAQPDFAID--------------------------- 106

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                        ++  + +   + V          +  + RIG + +          PL
Sbjct: 107 --------GQRVNRLTAVKKVVHDFVK---------RRDTDRIGLVVFGDYAFTQA--PL 147

Query: 256 SNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
           + +   + + +  L        T    A+  A                   + K VI ++
Sbjct: 148 TLDKGLLLNLIENLRIGMAGRKTAIGDALGVA----------GKRIKDIPAMSKVVILLS 197

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVN 371
           DGEN+                     G+KIY++ +     G ++L +      G+++  +
Sbjct: 198 DGENTAGDMTPQGAAEALA-----ALGIKIYTIGMGTEQAGSKELAQIAAIGQGKYYHAS 252

Query: 372 DSRELLESFDKITDK 386
           ++ +L   + +I   
Sbjct: 253 NTEQLDSIYKEIDKA 267


>gi|116626306|ref|YP_828462.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229468|gb|ABJ88177.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 310

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 78/181 (43%), Gaps = 23/181 (12%)

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
           ++A   +  +  A Q+K         ++++        + L  +  ++   +  L P   
Sbjct: 108 DAASEFIKGVVHANQDKAM------LVSFDTK--AELVSDLIGDTEKLDHAIRSLRPGGG 159

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T  Y A+  A R+  ++ +  H        ++ ++ ++DG+++     Q+     Q  E 
Sbjct: 160 TALYDAIFFACRDKLSQDQPKHK------FRRAIVIVSDGDDN-----QSQYTRDQALEM 208

Query: 335 MRNAGMKIYSVAVSAPP---EGQDLLRK-CTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            + A + +YS++ +      +G  +L+    ++ G+ F      +L +SF+ I ++++ Q
Sbjct: 209 AQKADVVLYSISTNISKIESDGDKVLKYYAAETGGKAFFPFKVEDLEQSFENIANELRHQ 268

Query: 391 S 391
            
Sbjct: 269 Y 269


>gi|87200512|ref|YP_497769.1| hypothetical protein Saro_2499 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136193|gb|ABD26935.1| hypothetical protein Saro_2499 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 631

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 47/416 (11%), Positives = 119/416 (28%), Gaps = 55/416 (13%)

Query: 27  NQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK--------KHLKQGSYI 78
            Q+ +  D  V +  +S  ++ T  D +    + +++               +       
Sbjct: 219 EQILTGYDTPVTTTASSYSNETTGNDQSYNSTRYNSLSACNTAKPADVAWANYGSATQSS 278

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
                   Q+              Y  +              +          +   T +
Sbjct: 279 TTTTNSAGQQIVTVTVTQPQRKTTYTCQMSGGRYRIYYYYTTRNYYTYTYNTSNPVYTTV 338

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
             +   N A    + +DVS   +   +   N  N    +        ++   + ++    
Sbjct: 339 TSQVFSNFAYK-QINVDVSSYKKFQTVTVQNGTNGANVSYTWKGCIEERDTEAASSFSYS 397

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP---- 254
                +P +  +D+ I+   +   + + A    +    R  +   +  +   + T     
Sbjct: 398 TVDGMSP-STALDLDIDRVPDSDPATKWAPMWPELGYYRTASSRSSTPVSTLETTSGSQL 456

Query: 255 -----------LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE----SSHNTI 299
                       + + +   +  + L+   +T     M    R    +       +    
Sbjct: 457 SAACPYKAQLLQTMSQSAFYAYADALSANGSTYHDLGMLWGLRLSSPDGPWQAMVNETPE 516

Query: 300 GSTRLKKFVIFITDGENSGA-----------------------SAYQNTLNTLQICEYMR 336
               + + +IF+TDG+                              ++TL    +C+  +
Sbjct: 517 NGGEVSRHIIFMTDGQMDTNYKVMSTYGIEWHDRRITDDGVTDQDARHTLRFRALCDAAK 576

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             G +++ +A ++     D L  C  +S   F   ++ EL  +F +I   + E  V
Sbjct: 577 AKGFRVWVIAFASDLN--DDLSYCASASST-FPATNATELNTAFQEIAKNVAELRV 629



 Score = 57.2 bits (136), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 48/298 (16%), Positives = 91/298 (30%), Gaps = 46/298 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  + V  L I   +D+  +   RN++QSA DA  L+G  S+ S         +    
Sbjct: 4   LAATCVPVLILLIGSGLDMGRLYKARNRLQSACDAGALAGRRSVSSAGYDDAAKAQAAAF 63

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 +      + ++   +A                        +    E+   NLF 
Sbjct: 64  FNANFNEDDLGATETNFATSSAD---------------GGSLVEGIATTDVEMVLMNLFG 108

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMED--------------LYLQ 166
              +P    N+   +T  I  +       + MVLD + SM                  ++
Sbjct: 109 VISVP---INVECSATMDIGNT------DVTMVLDTTGSMSQTLSGTTTKRIDALRTAMK 159

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
              D  +  +             +S +    +      P        I+S   + N++ +
Sbjct: 160 NFYDTVSAATTGSNARVRYSFVPYSSSVNVGQLIYDLDPDYLVDTWAIQSRTPVFNTVTE 219

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
            I    +  V     +Y+    G       N+ +   +R N L+   NT     +  A
Sbjct: 220 QILTGYDTPVTTTASSYSNETTG-------NDQSYNSTRYNSLSAC-NTAKPADVAWA 269


>gi|192360615|ref|YP_001982630.1| von Willebrand factor type A domain-containing protein [Cellvibrio
           japonicus Ueda107]
 gi|190686780|gb|ACE84458.1| von Willebrand factor type A domain protein [Cellvibrio japonicus
           Ueda107]
          Length = 318

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 80/246 (32%), Gaps = 67/246 (27%)

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
             S  N    + + +D+S SM +  +  +N                              
Sbjct: 81  ATSMPNSGRDLLLAVDISGSMREPDMVYNNRRI--------------------------- 113

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                    ++  + +  G+ V          +  S R+G + +          PL+ ++
Sbjct: 114 --------TRLMAVKKVVGDFVA---------RRQSDRLGLVLFGTQAFLQA--PLTFDV 154

Query: 260 NEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
             V+  L +       E T    A+  + + L  +             K+ +I +TDGEN
Sbjct: 155 KTVQEMLIEAESGYAGEATAIGDAIALSIKRLREQP----------NAKRVIILLTDGEN 204

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---GQDLLRKCTDSSGQFFAVNDS 373
           +       T   L +      A  KIY++A S          + +    + G+FF   ++
Sbjct: 205 TAGELGIATATDLAV-----KANTKIYTIAFSPYDREVDSHSMQQIAEQTGGEFFRARNT 259

Query: 374 RELLES 379
           R+L E 
Sbjct: 260 RDLEEI 265


>gi|296120496|ref|YP_003628274.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
 gi|296012836|gb|ADG66075.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
          Length = 396

 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 60/407 (14%), Positives = 125/407 (30%), Gaps = 61/407 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++        + + L+++   R ++++A DAA  S    +V  ++           
Sbjct: 25  LAAFVMVALLALAGFFLSLSYVELTRAELRAATDAAARSAVIRLVETQSTTSGRAAARDI 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQIN--ITKDKNNPLQYIAESKAQYEIPTENL 118
           ++ F+   K      + I+            +  I     N  +               L
Sbjct: 85  ASRFEVGGKALSLNDNDIQFGRSTRQSNGSYSFAINGTPTNAARVFGRKTKTSAAGPVEL 144

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-----EDLYLQKHNDNNN 173
              G + +   +  L +  +       L   I +VLD S SM        +         
Sbjct: 145 PFGGFVGAPEYSTELNAVAM------RLDYDIVIVLDRSGSMGWDLSGVEFEYPEAVRQR 198

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
                Y  PP P  S W                     +L  S  + +  +      ++ 
Sbjct: 199 PLVENYFSPPDPTGSRW--------------------AILSASVNDFLTILN-----QRQ 233

Query: 234 LSVRIGTIAYNIGIVGNQCTPL-----SNNLNEVKSRLNKLNP------YENTNTYPAMH 282
           ++ R+G + Y       + + +     S+  +   +  +KL           T+    + 
Sbjct: 234 VAARVGLVTYAGDYTFGKYSSVKLTVESDLTSTFSTITSKLTAIGQVPLIGGTDIGAGIT 293

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A   L    +              +I  +DG  +  +   +   +         +   I
Sbjct: 294 AAQTMLTTSSQ--ARLKTGQP---IIIVFSDGMFNQGTEPVSLAASAYS-----QSSTII 343

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQ--FFAVNDSRELLESFDKITDKI 387
           +SV   A  +G+  +   T ++G+      N + EL ESF  I + I
Sbjct: 344 HSVTFGATAQGRATMNSVTATAGKGLSLHANTAAELAESFRSIANAI 390


>gi|28210485|ref|NP_781429.1| membrane-associated protein [Clostridium tetani E88]
 gi|28202922|gb|AAO35366.1| membrane-associated protein [Clostridium tetani E88]
          Length = 842

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 52/354 (14%), Positives = 113/354 (31%), Gaps = 76/354 (21%)

Query: 50  IKDPTTKKDQTSTIFKK-QIKKHLKQGSYIRENAGDIAQKAQINITKDK--NNPLQYIAE 106
           I D   + +    + K   I       + +  +   ++   +I +      N P  +   
Sbjct: 300 IGDKNEELENIYRLLKNVNIDSQKYFSNEVSGDVNFLSDFNEIILVNTDYKNLPKDFDTN 359

Query: 107 SKAQYE--------IPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSR 158
            +   +        I  EN F  G   +      L  +  ++   +     I +++D S 
Sbjct: 360 LEKVVKEFGSGLMVIGGENSFALGSYENTKFEELLPVSCNVKNKRKQGDAGIVLLIDCSG 419

Query: 159 SMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
           SM+D                                         +   +KI++  + A 
Sbjct: 420 SMDD----------------------------------------ESGGVKKIELAKQGAI 439

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
             + +++            IG + ++  I        + N  ++   + KL P   T   
Sbjct: 440 ETIKALESED--------YIGILGFSDTIDWVVPFQKAENKEKLIKEVGKLKPKGGTLII 491

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
           P +    + L + K             K +I +TDG+     A +N  +  +  E M+  
Sbjct: 492 PGLIEGVKTLSSAKTK----------VKHMILLTDGQ-----AEKNGFD--KYLENMKKN 534

Query: 339 GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            M + +V +    + + L      + G+ +  ND + +   F K T   Q++ +
Sbjct: 535 NMTLSTVGLGEDSDREVLTHLSDFTGGRKYFSNDFKSVPIIFAKETRISQKKYI 588


>gi|32475535|ref|NP_868529.1| BatA [Rhodopirellula baltica SH 1]
 gi|32446077|emb|CAD75906.1| BatA [Rhodopirellula baltica SH 1]
          Length = 357

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 84/274 (30%), Gaps = 73/274 (26%)

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
            G  +  S+   I+I MV+D S SM             +  N    P             
Sbjct: 74  EGREQTVSQTEGIAIEMVIDRSGSM-----------QALDFNIDGEPV------------ 110

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                        ++  +   A   +   +       +L   +G I +           L
Sbjct: 111 ------------DRLTAVKNVASKFITGGEDLEGRFSDL---VGLITFAAYADAETPPTL 155

Query: 256 --SNNLNEV-KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
             S  ++ + ++ +      + T    A+  +  +L          + S    K +I +T
Sbjct: 156 DHSFVVSRLNQTEIVSRRDEDGTAIGDAIALSVEKLNALDARQERKVQS----KILILLT 211

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS----------APPEGQDLLRK--- 359
           DGEN+        L+ +Q  E     G+KIY++ V            P  G+  L     
Sbjct: 212 DGENTAG-----ELDPVQAAELAETLGIKIYAIGVGTTGKAPVPVRDPFTGRQRLHYMEV 266

Query: 360 ----------CTDSSGQFFAVNDSRELLESFDKI 383
                        + G++F   D+  L   + +I
Sbjct: 267 NIDEATLQKVAEITGGKYFRATDTDSLDAIYREI 300


>gi|116623631|ref|YP_825787.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226793|gb|ABJ85502.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 589

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 46/338 (13%), Positives = 96/338 (28%), Gaps = 53/338 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            T ++ SV    +  AID      +R ++ SA+D   L+    +    +  +   +    
Sbjct: 19  FTLLVSSVLIPMVGLAIDGGRGYLVRLKLSSAVDGGALAAARLL---GSGSNAAQQLSMA 75

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNP---------LQYIAESKAQY 111
                + +  +     +    +G  A    ++   D ++P           Y   + A  
Sbjct: 76  KATAAQFVNANFPAKFFGASLSG--AANVCVDPGTDSSDPCGVGNGSGISTYKVRTVAVK 133

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
              T       +I      +S   T           + + +V+D S SM   Y   +   
Sbjct: 134 ATATMPTLFMRIIGMPTVTVSGSGTASRRD------VRVILVMDRSSSMGTYYSGINQTP 187

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
            ++             +                          +  G +V      +   
Sbjct: 188 PSINDMALKFVNSFSGAGEFGG--------------------RDEVGLVVYGGSGIVAYP 227

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNE---VKSRLNKLNPYENTNTYPAMHHAYREL 288
                +             + TP  NN      +   +  +    NT T  A++ AY  L
Sbjct: 228 PRDITK-------DYTDYTKFTPPDNNFKASGNIPKYIADITSGSNTGTAEALYLAYMTL 280

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
             +  ++ +          ++  TDG  +G +A  N  
Sbjct: 281 RADAATNPDLATKLN---VIVLFTDGIPNGVTAMANDK 315


>gi|254496635|ref|ZP_05109500.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354157|gb|EET12827.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 342

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/266 (16%), Positives = 83/266 (31%), Gaps = 82/266 (30%)

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
           +  E    +I M LD+S SME   +  H+                               
Sbjct: 83  KPIEREGYNIMMALDLSGSMEIPDMILHDRPA---------------------------- 114

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
                   ++ V+  +A   V            L  +IG I +         TPL+ +  
Sbjct: 115 -------SRLTVVKNAAEQFVR---------DRLGDKIGLILFGSRAYLQ--TPLTYDRQ 156

Query: 261 EVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            V  R+         + T+   A+  A + L    +            + +I +TDG N+
Sbjct: 157 TVLLRIEDATVGLAGKTTSIGDAVGLAVKRLDAVPQKG----------RVIILLTDGANN 206

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-----LLRKCTDS--------- 363
                   L  L+  E  ++ G+KIY++ + A  + +      L++              
Sbjct: 207 SG-----ILEPLKAAELAKDEGIKIYTIGLGAATDPRALTNGFLMQAAAADLDEETLKEM 261

Query: 364 ----SGQFFAVNDSRELLESFDKITD 385
                G++F   D+  L   +  I  
Sbjct: 262 SAMTGGRYFRATDTATLNSIYKTINQ 287


>gi|114567231|ref|YP_754385.1| chloride channel [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338166|gb|ABI69014.1| conserved putative chloride channel [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 951

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 74/201 (36%), Gaps = 30/201 (14%)

Query: 194 TTKSKYAPAPAPANRKIDVLIESA---GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
             KS      +    K+++  E+A    +++  +  A           G +A++      
Sbjct: 413 IDKSGSMSEGSGGYSKVELAKEAAIQATSILGPLDMA-----------GVVAFDDTAQWV 461

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
                  + + ++  +  +     T+ YPA+  AY  L    + +H         K +I 
Sbjct: 462 VEFQAVKDKDAIQDDIATIRADGGTSIYPALALAYTAL----KDAHTKF------KHIIL 511

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAV 370
           +TDG+++         +   +   M  AG+ + +VAV    +   L +      G+++  
Sbjct: 512 LTDGQSATTG------DYYFLSRRMARAGITMSTVAVGEGADTLLLEQLAAWGQGRYYFS 565

Query: 371 NDSRELLESFDKITDKIQEQS 391
           ++   +   F K T K  +  
Sbjct: 566 DEISNIPRIFTKETMKAIKSY 586


>gi|197336671|ref|YP_002158318.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
 gi|197313923|gb|ACH63372.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
          Length = 321

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 84/256 (32%), Gaps = 81/256 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM +  ++  N                                       
Sbjct: 84  DMMLVVDLSGSMAEEDMKTSN----------------------------------GDFVD 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  + +   + ++  +           R+G + +         TPL+ + N V+ +L++
Sbjct: 110 RLTAVKQVVSDFIDQRKG---------DRLGLVLFGDHAYLQ--TPLTFDRNTVREQLDR 158

Query: 269 --LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
             L      T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLRLVGQMTAMGEGLGLA----------TKTFIESNAPQRTIILLSDGANTAG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L  L+  +  ++   KIY+V + A                    +   L +  T + GQ+
Sbjct: 204 LEPLEAAQLAKDNHAKIYTVGIGAGEMQVRGFFGKQTVNTARDLDEDTLTKIATMTGGQY 263

Query: 368 FAVNDSRELLESFDKI 383
           F   ++ EL E +  I
Sbjct: 264 FRARNADELAEIYQTI 279


>gi|148656823|ref|YP_001277028.1| von Willebrand factor, type A [Roseiflexus sp. RS-1]
 gi|148568933|gb|ABQ91078.1| von Willebrand factor, type A [Roseiflexus sp. RS-1]
          Length = 851

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/258 (13%), Positives = 83/258 (32%), Gaps = 28/258 (10%)

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
           +P++       +T      SE   +   + +    S      +       +       P 
Sbjct: 330 VPASALTFDQMATLREFVRSEGRGL---LAIGGRSSFTLGAYKNTPLEETLPVEMTPPPR 386

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
           P +             +  P     K  +  E+A     S+++          RIG +A+
Sbjct: 387 PERSDTTLLLIIDQSASMGPETGISKFTMAKEAAIMATESLRQED--------RIGVLAF 438

Query: 244 NIG---IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           ++    +V  Q   +  +L +V+ R++ L     T+ Y A+      L  +         
Sbjct: 439 DVSTRWVVDFQPVGVGLSLADVQRRISTLPLGGGTDIYNALQEGLPALAQQPGR------ 492

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
                +  + +TDG     S   +      + E  R+  + + ++A+    +   L    
Sbjct: 493 ----VRHAVLLTDG----RSFTDDRQAYRMLLEEARSQNITLSTIAIGTDADINLLQELA 544

Query: 361 TDSSGQFFAVNDSRELLE 378
              +G++    +  ++  
Sbjct: 545 RWGAGRYHYAAEPNDIPR 562


>gi|228472814|ref|ZP_04057572.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275865|gb|EEK14631.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 332

 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 42/287 (14%), Positives = 85/287 (29%), Gaps = 92/287 (32%)

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
           RS+  I ++     I I + +D+S SM                                 
Sbjct: 77  RSSSEITKTKTTEGIDIILSIDMSSSML-------------------------------- 104

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                   A      +I+ L   A   +             S RIG + Y+         
Sbjct: 105 --------AKDLKPNRIEALKRVAAQFIQQ---------RASDRIGIVVYSGESYTK--V 145

Query: 254 PLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           P + + + V   L ++      + T     +  A   L            S    K +I 
Sbjct: 146 PATTDKSIVLQALKEIRQGEIEDGTAIGMGLGTAINRL----------KDSKTKSKVIIL 195

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV---------------------SA 349
           +TDG N+        ++ L   E  +  G+++Y++ +                       
Sbjct: 196 MTDGVNNTG-----VIDPLSAAELAKEYGIRVYTIGIGTNGKALSPVAYNPDGSFQYDMV 250

Query: 350 P--PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           P   + + L      + G++F   D+ +L + + +I    + +   +
Sbjct: 251 PVEIDEKLLAEISKITGGKYFRATDNNKLAQIYTEIDKLEKSKIEEL 297


>gi|254786433|ref|YP_003073862.1| von Willebrand factor A [Teredinibacter turnerae T7901]
 gi|237687231|gb|ACR14495.1| von Willebrand factor type A domain protein [Teredinibacter
           turnerae T7901]
          Length = 347

 Score = 68.0 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 52/280 (18%), Positives = 100/280 (35%), Gaps = 59/280 (21%)

Query: 130 NLSLRSTGIIERSSENLA--ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
           NL  ++TG   +  +  A  +++  VL V+ S    ++               LP   + 
Sbjct: 43  NLQHQATGTPAQQHKISAGWLALIWVLLVAASARPQWV----------GEPVTLPATGRD 92

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
              + + + S   P     +++I   I     +VN   +     +  S R+G I +    
Sbjct: 93  LLLAVDISGSMKTPDMVVQDKQI-ARILVVKYVVNEFIE-----RRESDRLGLILFGSQA 146

Query: 248 VGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                 PL+ +   V + L++       E T    A+  A + L     S          
Sbjct: 147 YLQA--PLTFDRKTVSTLLDEAQLGFAGEQTAIGDAVGLAIKRLRERPAS---------- 194

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL-------- 356
           ++ +I +TDG N+        +   Q  +  + AG+KIY+V V A    Q +        
Sbjct: 195 QRVLILLTDGANTAG-----EVAPRQAADLAKQAGIKIYTVGVGADQMEQRMGLFGGFSR 249

Query: 357 ------------LRKCT-DSSGQFFAVNDSRELLESFDKI 383
                       LR     + G +F   + +EL   ++++
Sbjct: 250 TVNPSSDLDEDTLRYMAETTGGLYFRARNPQELQAIYEEL 289


>gi|118468162|ref|YP_887464.1| hypothetical protein MSMEG_3149 [Mycobacterium smegmatis str. MC2
           155]
 gi|118169449|gb|ABK70345.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 327

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 65/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G       P +N     K+ L+KL   + T T   + 
Sbjct: 116 EAAKQFADQLTPGINLGLIAY-AGTATVLVQPTTNR-EATKNGLDKLQLADRTATGEGIF 173

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       ++ ++DG+ +  S   N           ++ G+ I
Sbjct: 174 TALQAIATVG--AVIGGGDEPPPARIVLMSDGKETVPSNPDNPKGAFTAARTAKDQGVPI 231

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +V+                 P + + L +    S G  F  +   +L   F  +  +I 
Sbjct: 232 STVSFGTPYGYVEINDQRQPVPVDDEMLEKIAQLSGGDAFTASSLEQLKAVFTSLQQQIG 291

Query: 389 EQSVR 393
            ++++
Sbjct: 292 YETIK 296


>gi|309791336|ref|ZP_07685859.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
 gi|308226646|gb|EFO80351.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
          Length = 853

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 34/260 (13%), Positives = 82/260 (31%), Gaps = 32/260 (12%)

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
           +P+   +L   +T      SE   +   + +    S      Q     + +       P 
Sbjct: 335 VPATALSLDQMATVREFVRSEGRGL---LAMGGHTSFTLGSYQNTPLADVLPVLMEPPPR 391

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
           P +             +   +    K D+  E+A     S+Q           RIG +A+
Sbjct: 392 PQRSDVALLLIMDRSASMLASFGVSKFDMAKEAAQLATESLQ--------PEDRIGLLAF 443

Query: 244 NIGIVGNQCTPLSNN---LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           +   +      L +    + +++ ++  L     T    A+      L  +         
Sbjct: 444 DTETLWVVPFQLISGGLSVAQIQEQIASLPSGGGTRIERALEVGLPALAEQPTK------ 497

Query: 301 STRLKKFVIFITDGE--NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                +  + +TDG    +  + YQ  + T       R+  + + ++A+    +   L +
Sbjct: 498 ----VRHAVLLTDGRSFMNDNALYQRLVET------ARSQQITLSTIAIGLDSDTALLKQ 547

Query: 359 KCTDSSGQFFAVNDSRELLE 378
                 G+++  +   ++  
Sbjct: 548 LAAWGGGRYYYADQPADIPR 567


>gi|304312669|ref|YP_003812267.1| von Willebrand factor, type A protein [gamma proteobacterium HdN1]
 gi|301798402|emb|CBL46626.1| von Willebrand factor, type A protein [gamma proteobacterium HdN1]
          Length = 347

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 60/171 (35%), Gaps = 40/171 (23%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEK 292
            RIG I +         TPL+ +   V++ LN+         T    A+  A + L    
Sbjct: 137 DRIGLILFGTQAYLQ--TPLTFDHKTVRTLLNESRIGIAGGQTAIGDAIGLALKRL---- 190

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP- 351
                        K +I +TDG N+  S     ++ +Q  E     GMKIY+V V A   
Sbjct: 191 ------KNHKTGSKVLILLTDGANTAGS-----VSPVQAAELAARQGMKIYTVGVGADEM 239

Query: 352 -------------------EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                              +   + +  + +  Q+F   ++ EL   +  I
Sbjct: 240 RIPGVLGFGSQIVNPSADLDEVTMKKIASLTGAQYFRARNTDELRRIYQHI 290


>gi|91216721|ref|ZP_01253686.1| batA protein [Psychroflexus torquis ATCC 700755]
 gi|91185190|gb|EAS71568.1| batA protein [Psychroflexus torquis ATCC 700755]
          Length = 334

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 53/324 (16%), Positives = 105/324 (32%), Gaps = 97/324 (29%)

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
           Q A I ++  +   +  +A+ +    I  + L L  L  +     ++  T  ++++    
Sbjct: 35  QNASIKMSSTQGFKMSTLAKLRPLLFI-LKMLALVLLTIAMARPRTVDVTTKVKKTE--- 90

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I M +D+S SM    L+ +                                      
Sbjct: 91  GIDIIMAVDISASMLARDLEPN-------------------------------------- 112

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++ L + A N +           +   RIG + Y         TPL+ + + + + +
Sbjct: 113 --RLEALKKVAINFIE------GRPND---RIGLVIYAGESYTK--TPLTTDKSIIFNAI 159

Query: 267 NKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           N L         T     +  +  +L            S    K +I +TDGEN+     
Sbjct: 160 NDLEYSQNIEGGTAIGMGLATSVNKL----------KDSKAESKVIILLTDGENNAGFID 209

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAP----------PEGQ------------DLLRKC 360
             T   L          +K Y++ V +             GQ             LL+  
Sbjct: 210 PKTATQL-----ATEYDIKTYTIGVGSNGMALSPVGIKANGQFEYRNIEVKIDEALLKTI 264

Query: 361 TDS-SGQFFAVNDSRELLESFDKI 383
            +S  G++F   D+++    +++I
Sbjct: 265 AESNGGKYFRATDNQKFEAIYEEI 288


>gi|330830423|ref|YP_004393375.1| FlpL [Aeromonas veronii B565]
 gi|328805559|gb|AEB50758.1| FlpL [Aeromonas veronii B565]
          Length = 460

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 49/143 (34%), Gaps = 24/143 (16%)

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK--------KFVIFITDG 314
           +  L+ L    NTNT   +   +R L  E +       +   +        K ++  +DG
Sbjct: 326 RQALDTLYAAFNTNTAEGVMWGWRLLSPEWQGRWRQGAAALPRPYELQDNRKIMVLFSDG 385

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           E+    A       L +C  M+  G++IY+VA          + +C              
Sbjct: 386 EHM-TEAALRDRKQLLLCREMKRKGIQIYTVAFEGDTR---FVAQCASDRS--------- 432

Query: 375 ELLESFDKITDKIQEQSVRIAPN 397
               +F      I+    R+A +
Sbjct: 433 ---LAFKATKSNIRTVLTRLASS 452


>gi|260437096|ref|ZP_05790912.1| putative von Willebrand factor type A domain protein [Butyrivibrio
           crossotus DSM 2876]
 gi|292810406|gb|EFF69611.1| putative von Willebrand factor type A domain protein [Butyrivibrio
           crossotus DSM 2876]
          Length = 623

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 88/243 (36%), Gaps = 55/243 (22%)

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
           +S N+     +++D S SM                        P   +  KNT     + 
Sbjct: 91  NSNNIVFDTVILIDCSGSM--------------------RTNDPDFEYSVKNTLYPGSSY 130

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
                 RK+     ++ N V +        +    R G + +      N    L+N+   
Sbjct: 131 QITTCYRKL-----ASKNYVKA--------QGNDDRTGIVLFTSE--ANTVCELTNSEYV 175

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           + + ++K+     TN   A+  + R L N +  S         +K ++ ++DGE+  +S+
Sbjct: 176 LMNAIDKIYSNGGTNFNNAIKESIRILTNTRNDS---------EKRILLVSDGESELSSS 226

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT-DSSGQFFAVNDSRELLESF 380
                    + +      +KI +V +       +LL+     + G++F    + EL+  +
Sbjct: 227 ---------VIDLAIENNIKINTVYIGG-QNNNELLKNVAERTGGKYFKAVTADELINIY 276

Query: 381 DKI 383
            +I
Sbjct: 277 SEI 279


>gi|187934443|ref|YP_001887479.1| von Willebrand factor type A domain protein [Clostridium botulinum
           B str. Eklund 17B]
 gi|187722596|gb|ACD23817.1| von Willebrand factor type A domain protein [Clostridium botulinum
           B str. Eklund 17B]
          Length = 1596

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 56/339 (16%), Positives = 99/339 (29%), Gaps = 99/339 (29%)

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK----------------------- 178
             ++ +  I +VLD S SM+    Q   D      +                        
Sbjct: 85  YEDSKSREIVLVLDTSGSMDQEINQLCEDCAYYCKDCDKWIYETRENHKNQKPYINHTIV 144

Query: 179 ------YLLPPPPKKSFWSKNTTKSKYA-------------PAPAPANRKIDVLIESAGN 219
                 Y             +     YA              A      KI  L ++A N
Sbjct: 145 RRFGGYYCYDCNKYIENEETHINYRPYANHSFSDKKYCNNHKAYESYTTKIHELKKAAKN 204

Query: 220 LVNSIQKAIQE---KKNLSVRIGTIAYNIG--------IVGNQCTPLSNNLNEVKSRLNK 268
            ++S+     +       +++IG ++YN           V +     + N+NE+K  +  
Sbjct: 205 FIDSLTSTKTDGQTPNVKNLKIGIVSYNNSGYINEGLVQVTDSDRKNNGNINELKDTIEN 264

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L     TNT   +  A   L  E E++          K VIF+ DGE +  S+ +   + 
Sbjct: 265 LRADGGTNTGDGLRKAAYLLNEENEAN----------KTVIFMGDGEPTYYSSDRWGNDY 314

Query: 329 LQICEY-------------------MRNAGMKI-------YSVAVSAPPEG--------- 353
             + +                     +  G  I       +SV      E          
Sbjct: 315 TNLDDTNQYVGGTGYSDADGKCLSYAKTIGEIIKGEQYNVFSVGYGLGDENSASNNKMKQ 374

Query: 354 -QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             + +   +      F  +D   + + F +I D I + S
Sbjct: 375 IHESMGGISSGENSTFFASDEGAIDKVFQQIADTIIKTS 413


>gi|153812017|ref|ZP_01964685.1| hypothetical protein RUMOBE_02410 [Ruminococcus obeum ATCC 29174]
 gi|149831916|gb|EDM87002.1| hypothetical protein RUMOBE_02410 [Ruminococcus obeum ATCC 29174]
          Length = 2099

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 61/425 (14%), Positives = 124/425 (29%), Gaps = 66/425 (15%)

Query: 24   YIRNQMQSALDAAVLSGCASIVSDRTIKDPTT----KKDQTSTIFK---------KQIKK 70
            Y  N  + A DA + +   ++   +   D       + +Q     K          Q+  
Sbjct: 1140 YKENGTEEATDAPLNNTSFTLDEMKNTSDGVYTQIFQNEQIGGNEKYIYKVEETGSQVNG 1199

Query: 71   HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA-QYEIPTENLFLKGLIPSALT 129
            +  + +         +      I +  +                  E      L+     
Sbjct: 1200 YTVETTQTVSGGDVQSDGKSTKIGEKDSATFTITNTYTPIDINSVIEYNKTATLLDWNQR 1259

Query: 130  NLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYL-----------QKHNDNNNMTSN 177
               +  T   + +        I +VLD S SM   ++            +        + 
Sbjct: 1260 TYKIDLTASSKTTQSMKTPYDIVLVLDQSGSMSQKFVEYNKINGSSMFWRKTYYIKTQNG 1319

Query: 178  KYLLPPPPKKSFWSK-----------NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
             Y        + WS            +   +    A      KID L  +A   VN++  
Sbjct: 1320 IYQQLSWSWDNTWSYTDSYSGKTVTVDPNTTDVYVAQKSNQTKIDALKSAATTFVNNVA- 1378

Query: 227  AIQEKKNLSVRIGTIAYNI-----GIVGNQCTPLSNNLNE--VKSRLNKLNPYENTNTYP 279
                 KN   R+G + ++       I  N  T      ++  + + ++ L    +T    
Sbjct: 1379 ----NKNSDCRVGIVTFSNDGYIKPITNNSYTLAKVGTSKGDIINTIDGLKTGGDTYPAK 1434

Query: 280  AMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNTLN-TLQICEYMR- 336
             +  A         +S      +   KK V+F+TDG  + A+      N         + 
Sbjct: 1435 GLDKANEIFSENSSNSWETVEQTDGRKKMVVFLTDGVPAPANTNNFDENLAGAGTNSAKI 1494

Query: 337  --NAGMKIYSVAV--SAPPEG----------QDLLRKCTDSSGQFFAVNDSRELLESFDK 382
              + G+  Y++ +  +A  +G             ++    S  ++   +    L   F+ 
Sbjct: 1495 LHDQGVATYALGIFGAANSDGTMDNASVQRIDKYMQSIASSHEKYMTADSVDNLSSLFES 1554

Query: 383  ITDKI 387
            IT+ I
Sbjct: 1555 ITNNI 1559


>gi|315185579|gb|EFU19348.1| von Willebrand factor type A [Spirochaeta thermophila DSM 6578]
          Length = 459

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 78/250 (31%), Gaps = 53/250 (21%)

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
           +    IS  +VLD S SM D                                      P 
Sbjct: 84  NREEGISFLLVLDASGSMWDALDGT---------------------------------PT 110

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
             P   +I     +    +  +        +   R+G   +N         P+ ++   V
Sbjct: 111 EDPDRMRITHAKRAIREFLPLL--------SERDRVGLAVFN--RTYRMIQPIVDDPALV 160

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
             +L+ +         P+   AY ELY   E +  +      ++ ++ ++DGEN      
Sbjct: 161 LEKLDAIE-------RPSREQAYTELYRSMEEALTSFEEEGRRRVLVVLSDGENFPVDPE 213

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFD 381
           ++        +     G+  Y +      +   L+      + G+ F   ++ EL   + 
Sbjct: 214 KSPATPGTAVDLAHRYGITCYVIHFGTEKD--RLIGDLASETGGRVFDARNALELASVYT 271

Query: 382 KITDKIQEQS 391
            I +++ ++ 
Sbjct: 272 AIQEQVLQEY 281


>gi|270158235|ref|ZP_06186892.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|289163509|ref|YP_003453647.1| hypothetical protein LLO_0165 [Legionella longbeachae NSW150]
 gi|269990260|gb|EEZ96514.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|288856682|emb|CBJ10493.1| putative unknown protein [Legionella longbeachae NSW150]
          Length = 342

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 41/260 (15%), Positives = 82/260 (31%), Gaps = 82/260 (31%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
             +I M LD+S SME   +  H                                      
Sbjct: 89  GYNIMMALDLSGSMEIPDMILH-----------------------------------GRP 113

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++++  +A   V               +IG I +         TPL+ + + +  RL
Sbjct: 114 TSRLNIVKSAAEQFVRE---------RSGDKIGLILFGTRAYLQ--TPLTYDRHSILLRL 162

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
                    + T+   A+  A + L +  +            + +I +TDG N+      
Sbjct: 163 EDATAGLAGKTTSIGDAVGLAVKRLDSAPKKG----------RVIILLTDGANNSG---- 208

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL------------------RKCTDSSG 365
             L  L+  E  +  G+KIY++ + +  + + L+                  +    + G
Sbjct: 209 -VLAPLKAAELAKEEGIKIYTIGLGSEGDSRALVGDFLMQSPAADLDEETLKKMSDMTGG 267

Query: 366 QFFAVNDSRELLESFDKITD 385
           ++F   D+  L   +  I  
Sbjct: 268 RYFRATDTESLHLIYKTINQ 287


>gi|139439379|ref|ZP_01772820.1| Hypothetical protein COLAER_01839 [Collinsella aerofaciens ATCC
           25986]
 gi|133775158|gb|EBA38978.1| Hypothetical protein COLAER_01839 [Collinsella aerofaciens ATCC
           25986]
          Length = 2432

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 97/299 (32%), Gaps = 61/299 (20%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
              +   + +     + I MVLD S SM+D      N                  +  ++
Sbjct: 97  SAISSTSDTTISGKPLDIVMVLDASGSMDDPMGTGDNTKRIDALKTAANTFIDAIAAQNQ 156

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
           + T +           ++ ++  +        +K   +  N + R G   YN        
Sbjct: 157 SITDAS-------KQHRVAIVKFAG-------KKKTDKVGNDTYRDGRYTYNYSQTMKNL 202

Query: 253 TPLS-NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFI 311
           T     + + +K  +  +NP  +T     +  A        E+     G    KK V+F 
Sbjct: 203 TSCKGKDADSLKDTVGNINPAGSTQADYGLELA--------ENITINSGRADAKKIVVFF 254

Query: 312 TDGENSGASAYQNTL--NTLQICEYMRNAGMKIYSVAV------SAPPEG------QDLL 357
           TDG  + +S +Q ++  + +   + ++  G  IY++ +      SA P           +
Sbjct: 255 TDGSPTSSSGFQASVADSAIASAKSLKANGADIYTIGIFSGANPSADPTAEGTSKVNKFM 314

Query: 358 RKC------------------------TDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                                       ++S  + +   + EL + F++I+  I +   
Sbjct: 315 HAVSSNYPGATSSISFWGEWVIDYGTRAENSDYYKSATSASELEKIFEEISGSIIQTGY 373


>gi|268316013|ref|YP_003289732.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
 gi|262333547|gb|ACY47344.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
          Length = 329

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 63/172 (36%), Gaps = 41/172 (23%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEK 292
            RIG + +           L  +   + + L +L      + T    A+  A   L    
Sbjct: 127 DRIGLVVFAGQAFTQVPPTL--DYRFLLTMLQRLQVGRLEDGTAIGTAIATAINRL---- 180

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                   S    K +I +TDG+N+        ++ L   E  R AG++IY++ +S   E
Sbjct: 181 ------KNSEARSKVIILLTDGQNNRG-----EIDPLTAAELARQAGIRIYTIGLSGRGE 229

Query: 353 G--------------------QDLLRKCTD-SSGQFFAVNDSRELLESFDKI 383
                                + ++R+  + + G++F   D+R L   + +I
Sbjct: 230 APYPVQTPFGTRPQPVPVEIDEAMMREVAEKTGGRYFRATDARTLEAIYAEI 281


>gi|226314068|ref|YP_002773964.1| hypothetical protein BBR47_44830 [Brevibacillus brevis NBRC 100599]
 gi|226097018|dbj|BAH45460.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 677

 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 77/207 (37%), Gaps = 24/207 (11%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL---SNN 258
             + +  K D    +A  +   I  +   +     RIG +AYN  IV  Q       + N
Sbjct: 52  DTSNSMNKTDPGKTAAEVMSMFIDMSEATR----TRIGFVAYNDRIVQAQSPASMAEARN 107

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG---- 314
             ++K  +  L     ++    +      +   K+ +           F+I ++DG    
Sbjct: 108 REQLKRTIQGLRYSGYSDLGLGLRRGAEMIEKAKDPARKP--------FLILLSDGGTDL 159

Query: 315 -ENSGA-SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAV 370
            +N+G  S   +  +   +    +  G  IY++ ++     Q   L +    + G  F  
Sbjct: 160 RQNAGGRSVAASNKDVETVISKAKAQGYPIYTIGLNNDGSVQKEQLKKIAEATGGTSFVT 219

Query: 371 NDSRELLESFDKI-TDKIQEQSVRIAP 396
             + +L E F++I    IQ Q V +A 
Sbjct: 220 QSTDDLPEIFNQIFAKHIQSQLVSVAA 246


>gi|34558787|gb|AAQ75132.1| BatA protein [Alvinella pompejana epibiont 6C6]
          Length = 300

 Score = 67.6 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 54/281 (19%), Positives = 102/281 (36%), Gaps = 67/281 (23%)

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRS--TGIIERSSENLAISICMVLDVSRSMEDLYLQ 166
            +Y I  +N  L  +    L  L+L S  T   +  S      + + +DVS SM      
Sbjct: 40  PKYSIWWDNSILWIVTIYTLLVLALASPFTYEAKELSTKKGRDLILTIDVSGSMA----- 94

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                              +K F  + + KS+Y           +V  E A   +     
Sbjct: 95  -------------------QKGFSKEESEKSRY-----------EVAKEIAKRFIK---- 120

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMH 282
                   S  IG + +  G      +PL+ +L  +    + ++       NT    A+ 
Sbjct: 121 -----NRFSDNIGIVIF--GSFSFSASPLTYDLKALLEMFDLMSDVGIAGNNTAIGDAIF 173

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + L + +  S          K +I +TDG+++         +  +     +  G+KI
Sbjct: 174 EAIKNLESGEAKS----------KVIILLTDGKHNFGK-----KSPKEGVVEAKKRGIKI 218

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           Y+V +    + + L +   +++ + F   +S+EL E F +I
Sbjct: 219 YTVGIGTDYDKKLLEKMAKETNAKSFFAKNSKELEEVFKEI 259


>gi|254784286|ref|YP_003071714.1| matrixin family protein [Teredinibacter turnerae T7901]
 gi|237683907|gb|ACR11171.1| matrixin family protein [Teredinibacter turnerae T7901]
          Length = 877

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 83/256 (32%), Gaps = 62/256 (24%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D S SM                                       + AP P+  
Sbjct: 421 DVVLVMDRSGSM-------------------------------------NLSSAPDPSVS 443

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC----TPL-SNNLNEVK 263
           K+D L  +A   ++ +        +   R G + ++  +V         P+ + +L+  +
Sbjct: 444 KMDALKYAANVFMDFLD------LDAGHRAGLVQFHEVVVPFSPAFNLQPVNAASLSAAQ 497

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           + +N +     TN    ++    +L    + S         ++ ++ +TDG ++      
Sbjct: 498 TAINSMTAGGMTNIIDGVNEGIAQLTTAVDPSD--------RQIMLLLTDGLHNRPVGTS 549

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFD 381
            T  T  +      + + +YSV         +L      + G      D  +L   + F 
Sbjct: 550 VTDITAPLL----ASEVTLYSVGFGTSTNEAELTPLALSTGGVHLENKDVSDLQLRKHFL 605

Query: 382 KITDKIQEQSVRIAPN 397
            I     + +  I P+
Sbjct: 606 SIAASAADSTTLIDPH 621


>gi|269104787|ref|ZP_06157483.1| protein BatA [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161427|gb|EEZ39924.1| protein BatA [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 321

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 84/258 (32%), Gaps = 81/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM    +Q  +  +                                    
Sbjct: 84  DMMLAVDLSGSMAIKDMQTQSGQSI----------------------------------D 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     N +          K    R+G + +         TPL+ + + V+ +L++
Sbjct: 110 RLTAIKHVLSNFIE---------KRKGDRLGLVLFGDHAYLQ--TPLTFDRHTVEQQLDR 158

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  ++T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLGLVGQSTAIGEGLGIA----------TKTFIKSKAPQRVIILLSDGANTAG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ L+  +  + +G+ IY+V + A                    + + L +    + G++
Sbjct: 204 IDPLEAAKLAKESGVTIYTVGIGADEMLQRSIFGVQKVNPSQDLDEKTLTKIAQMTGGKY 263

Query: 368 FAVNDSRELLESFDKITD 385
           F   + +EL + +  I  
Sbjct: 264 FRARNPQELDKIYQIINQ 281


>gi|209809314|ref|YP_002264852.1| hypothetical protein VSAL_II0524 [Aliivibrio salmonicida LFI1238]
 gi|208010876|emb|CAQ81278.1| putative membrane protein [Aliivibrio salmonicida LFI1238]
          Length = 320

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 83/256 (32%), Gaps = 82/256 (32%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM +  ++  +                                       
Sbjct: 84  DMMLVVDLSGSMSEEDMKTDSGFV-----------------------------------D 108

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + +          K    R+G + +         TPL+ + N V+ +LN+
Sbjct: 109 RLTAVKRVVSDFIE---------KRKGDRLGLVLFGDHAYLQ--TPLTFDRNTVQEQLNR 157

Query: 269 --LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
             L      T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 158 TVLGLVGQRTAIGEGLGLA----------TKTFIESNAPQRTIILLSDGANTAG-----V 202

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ ++  +  ++   KIY+V + A                    +   L +  T + GQ+
Sbjct: 203 LDPIEAAQLAKDNNAKIYTVGIGAGEMQVRGFFGNQTVNTARDLDEDTLTKIATMTGGQY 262

Query: 368 FAVNDSRELLESFDKI 383
           F   ++ EL E +  I
Sbjct: 263 FRARNADELAEIYQTI 278


>gi|226326038|ref|ZP_03801556.1| hypothetical protein COPCOM_03856 [Coprococcus comes ATCC 27758]
 gi|225205580|gb|EEG87934.1| hypothetical protein COPCOM_03856 [Coprococcus comes ATCC 27758]
          Length = 275

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 79/227 (34%), Gaps = 24/227 (10%)

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
            N Y +    +         K +       AN +   L ++A N    + ++        
Sbjct: 43  GNWYYIDDSKEGLGEKLTDNKERLYYTTNDANDRFYYLKQAATNFTTQLAQSSPNS---- 98

Query: 236 VRIGTIAYNIGIVGNQCTP-LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
             I  + +N           +  +   +   +N +     T+    +  AY+ L N++  
Sbjct: 99  -EIALVTFNKTATEQFDFKNVGKDSAYITETINAMETSGGTHQNEGLDRAYKILNNDQ-- 155

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP--- 351
                 ++ LK++V+ +TDG  +G +  Q T +       +++   K+ +V V       
Sbjct: 156 -----NTSNLKRYVVLLTDGCPNGVTYDQITTSI----NKIKSTNTKLITVGVGLDETNT 206

Query: 352 ---EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                +D L+         +  ND+  L   F +I  +    +  ++
Sbjct: 207 GLKAAKDYLQANA-DDNMAYNANDASHLNTIFTQILGQTTNSNTPLS 252


>gi|254450361|ref|ZP_05063798.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|254450938|ref|ZP_05064375.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198264767|gb|EDY89037.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198265344|gb|EDY89614.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 75

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 330 QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            IC   R  G+ IY+VA  AP  GQ  L+ C  S    F V +  ++  +F  I   I+ 
Sbjct: 12  DICAAARAQGVVIYTVAFEAPSGGQSALQDCASSPSHHFDV-NGTDISSAFSAIASDIRA 70


>gi|256823198|ref|YP_003147161.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
 gi|256796737|gb|ACV27393.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
          Length = 348

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 89/231 (38%), Gaps = 46/231 (19%)

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
            +   LP   +    S + + S   P     ++++D L+     L + I +   +     
Sbjct: 76  GDTMDLPATGRDLMISIDISGSMEMPDMVIEDKEVDRLVAVKALLTDFIARRKGD----- 130

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK----LNPYENTNTYPAMHHAYRELYNE 291
            R+G I +         TPL+ +L  V++ L++    L     T     +  A + L   
Sbjct: 131 -RVGMILFGEQAYLQ--TPLTFDLKTVQTMLDETTIGLAGSSRTAIGDGIGLAVKRL--- 184

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           +E   N        + +I +TDG+N+        LN LQ  E   +AG+ IY++ V A  
Sbjct: 185 RERDANN-------RVLILLTDGQNNTG-----ALNPLQAAELAEHAGITIYTIGVGADE 232

Query: 352 -------------------EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                              + + L+     + G++F   D++E+ E +  I
Sbjct: 233 MIVKNRFFGNRRINPSLELDEESLIAVAEKTGGRYFRARDTKEMEEIYQII 283


>gi|208780564|ref|ZP_03247903.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
 gi|208743539|gb|EDZ89844.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
          Length = 333

 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 79/204 (38%), Gaps = 43/204 (21%)

Query: 206 ANRKIDVLIESAGNL---VNSIQKAIQEKKNLS--VRIGTIAYNIGIVGNQCTPLSNNLN 260
            +  I  + ++ G +    + + +   +  +     R+G I +         TPL+ ++ 
Sbjct: 102 GSMAIQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIA 159

Query: 261 EVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+
Sbjct: 160 TVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKFPGDS----------KALILLTDGENN 209

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVA------VSAPPEGQDLL------------RK 359
                  TL  LQ  E  +   +KIY++       +     GQ L+            + 
Sbjct: 210 SG-----TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKI 264

Query: 360 CTDSSGQFFAVNDSRELLESFDKI 383
            T + G++F   +S +L + ++ I
Sbjct: 265 ATMTGGKYFRAQNSSDLKKVYESI 288


>gi|148261962|ref|YP_001236089.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|326405471|ref|YP_004285553.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
 gi|146403643|gb|ABQ32170.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|325052333|dbj|BAJ82671.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
          Length = 431

 Score = 67.2 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 73/434 (16%), Positives = 149/434 (34%), Gaps = 69/434 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA++       +   ID    +  ++QM+S  DAA L+     +             Q+
Sbjct: 22  ITALVSLTLIFILGMGIDYGLAIDRKSQMESYADAAALAAVTPAM---------VAAGQS 72

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S I          Q  +  +           N              +  QY+  ++ +  
Sbjct: 73  SAITT-------AQNVFNAQALTMTGVTYNANDVTVSIATSGDKRTATVQYQAQSQAMLP 125

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK------HNDNNNM 174
             +       +  ++T     ++    I   ++LD S SM     Q        N     
Sbjct: 126 DVM-GFGSIKIGGQATA---TTTIAPNIDFYLLLDDSPSMAIAATQSGINTMVANTTAQG 181

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR-KIDVLIESAGNLVNSIQKAIQEKKN 233
                     P          +  YA A +     +ID+L ++  +L+ + Q   + +K 
Sbjct: 182 GCAFGCHEENPSADKLGNPYGEDNYALARSLGVTLRIDMLRQATQDLMTTAQT-TETQKG 240

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL----------------NKLNPYENTNT 277
            + R+    ++IG+  N    L+++L++ ++                  N  N  E+TN 
Sbjct: 241 TTYRMAIYTFDIGL--NTIGNLTSDLSQAQTEAGNIQLLEVYSNNWLTQNDYNDDEDTNY 298

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG---ENSGASAYQNTLNTLQICEY 334
             A++     +     +     G T  ++ + F+TDG   E+   +  Q+ LNT  +C  
Sbjct: 299 DTALN-GINAIMPNPGNGTGAAGDT-PQEVLFFVTDGVEDEDVNGNRQQSLLNT-DLCTA 355

Query: 335 MRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELLE 378
           ++N G++I   Y+  +  P                   L++C  S G +F V    ++  
Sbjct: 356 IKNRGIRIAVLYTEYLPLPTNSWYNTYIAPFQNSIAPTLQQCA-SPGLYFEVKSGGDISA 414

Query: 379 SFDKITDKIQEQSV 392
           +   +     + S 
Sbjct: 415 AMSALFQTAVQSSY 428


>gi|126727880|ref|ZP_01743708.1| hypothetical protein RB2150_00467 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702821|gb|EBA01926.1| hypothetical protein RB2150_00467 [Rhodobacterales bacterium
           HTCC2150]
          Length = 576

 Score = 67.2 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 31/79 (39%), Gaps = 2/79 (2%)

Query: 312 TD-GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAV 370
           TD G  S  +  Q+       C   ++ G+ I+++A  AP   +  L  C  S   ++  
Sbjct: 494 TDWGSTSARTGSQSDTLMSANCTAAKDRGITIFTIAFEAPSNAETQLNNCATSDNHYYDA 553

Query: 371 NDSRELLESFDKITDKIQE 389
                +   F  I   IQ+
Sbjct: 554 Q-GTSITSVFSSIATTIQK 571



 Score = 59.5 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 54/372 (14%), Positives = 109/372 (29%), Gaps = 77/372 (20%)

Query: 1   MTAI---IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           MTA    I+++       +ID       R QMQ  LD AVLS  + +             
Sbjct: 39  MTAFGIFIVAIMVTSAGLSIDFMRQERTRVQMQQNLDTAVLSAASLL------------- 85

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                   + +        Y+ +   D+     +N+++  N          A      E 
Sbjct: 86  --------QTLGAEAVVTDYMSKANIDVDYNLSVNVSEGINFR-----AVDATATATLET 132

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           LFL  L        SL  T           + I +VLDVS SM       +         
Sbjct: 133 LFLGLL-----NIDSLGITVTSGAEERIPNLEISLVLDVSGSMGSNSRLTNLKTAATQFV 187

Query: 178 KYLLP------------PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ 225
             ++             P       S++   +         +  I+   +   +    + 
Sbjct: 188 STIISGGSGGTVAMSIIPFSSSVTPSQSVIDAITMEDNHDYSTCIEFADDDFSSSSLDLD 247

Query: 226 KAIQE--KKNLSVRIGTIAYNI---------GIVGNQCTPL---SNNLNEVKSRLNKLNP 271
              +     +     G+  ++              ++   L   S++   + +++  L  
Sbjct: 248 STYKRAVFTSRYSDTGSGDFDDADDFNQDWRSCYMDEYFELLAYSDDETVLYNKIQGLLA 307

Query: 272 YENTNTYPAMHHA-------YRELYNE------KESSHN----TIGSTRLKKFVIFITDG 314
             +T  +  M          ++ + N        +++H         T   K ++F++DG
Sbjct: 308 QGSTAGHTGMKWGTSLLDPEFQAVTNSMIAAGVVDAAHAGMPVAYSDTNTMKIIVFMSDG 367

Query: 315 ENSGASAYQNTL 326
            N     + +  
Sbjct: 368 NNHTQRRFGSDY 379


>gi|310814568|ref|YP_003962532.1| von Willebrand factor, type A [Ketogulonicigenium vulgare Y25]
 gi|308753303|gb|ADO41232.1| von Willebrand factor, type A [Ketogulonicigenium vulgare Y25]
          Length = 1160

 Score = 67.2 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 69/249 (27%), Gaps = 64/249 (25%)

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
           L   S        E   I++  VLD S SM                              
Sbjct: 732 LETLSPLSARLPHEGPGIAMVFVLDRSGSMSQTVGDV----------------------- 768

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
                             ++DV  ++     N +     + +  S  +G + +       
Sbjct: 769 -----------------TRLDVAKQAVSAAANLL-----DPQTGS--LGVVMFGSEAEVA 804

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
                  +   + + L  L P   TN YP +  A++ L      +          + ++ 
Sbjct: 805 LPLGPLPDAAGIAAALGHLQPGGGTNIYPGLQLAFQALRASDADA----------RHIVV 854

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAV 370
           +TDG         +  +   +   +R  G+ + SVA+ +  E            G+F   
Sbjct: 855 MTDG-------MSDEADFPGLLAAIRAEGITVSSVAIGSTSETSIAEDIALLGGGRFHNT 907

Query: 371 NDSRELLES 379
            D   L   
Sbjct: 908 RDFGALPSI 916


>gi|330862285|emb|CBX72446.1| hypothetical protein YEW_HH31780 [Yersinia enterocolitica W22703]
          Length = 457

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 57/432 (13%), Positives = 136/432 (31%), Gaps = 87/432 (20%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           II       I    +++H +  + ++  A++ A L+     + +  I D   +    + +
Sbjct: 31  IIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALA---IENNEIPDEPQQIKN-NAL 86

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY--EIPTENLFLK 121
               +  +L    ++                 D  + L+Y A     Y  +  +++ F  
Sbjct: 87  VLSYVNAYLPSKKFLVPIIN----------INDNTHYLEYNAAVTMAYPAKFLSQSPFTN 136

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN---------- 171
            +    +T+  +        +SE     +  V D S SM   + +    +          
Sbjct: 137 TISDMNITDNGVAIKNKAIEASE--PTDVIFVADYSGSMLYNFNENKPRDHERIDALRSA 194

Query: 172 ---------NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                    +N   N     P    +       + +      P + KI       GN ++
Sbjct: 195 FRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPK---GNYLS 251

Query: 223 SIQKAIQEKKNLSVRIG----------TIAYNIGIVGNQCTPLSNN---LNEVKSR---- 265
              K       L   IG          +I  N   +    + +      L    +     
Sbjct: 252 DEIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGDVCLQGSNAYSLEQ 311

Query: 266 ---------LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
                    + ++ P+  T     +  A     N+ ++ H        KK +I ++DG +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNIFKNKAKNGH--------KKLMIILSDGVD 363

Query: 317 SGASAYQNTLNTLQ------ICEYMRNAGMKIYSVAVS-APPEGQDL-----LRKCTDSS 364
           +        +   +      +CE ++   +++  +A++ +P   ++       +KC    
Sbjct: 364 TDDFPSSKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GE 422

Query: 365 GQFFAVNDSREL 376
             ++  +++ EL
Sbjct: 423 DNYYEAHNAHEL 434


>gi|271964702|ref|YP_003338898.1| von Willebrand factor type A [Streptosporangium roseum DSM 43021]
 gi|270507877|gb|ACZ86155.1| von Willebrand factor type A [Streptosporangium roseum DSM 43021]
          Length = 514

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 62/182 (34%), Gaps = 19/182 (10%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL-------SNNLNE 261
           +I+ L ++   L  +   A         R   I    G       P           L +
Sbjct: 341 RIEALRQALVTLTGADTSASGTFSRFRSRENVIMIPFGGSAGLPQPFILPERDPQPALAQ 400

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           +++   +L     T  Y  +  AY +   +    H T         ++ +TDGEN+  S+
Sbjct: 401 IRAYAERLRAAGGTAIYDGLRAAYGQ-AGDAGRDHYTS--------IVLMTDGENTDGSS 451

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFD 381
           Y++     +     R   ++ + V      +  ++ R  T + G  F       L  +F 
Sbjct: 452 YEDFEAYYRSLPEARRQ-VRTFVVLFGES-DADEMERIATLTRGAVFDARTG-SLASAFK 508

Query: 382 KI 383
           +I
Sbjct: 509 EI 510


>gi|159896929|ref|YP_001543176.1| von Willebrand factor type A [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889968|gb|ABX03048.1| von Willebrand factor type A [Herpetosiphon aurantiacus ATCC 23779]
          Length = 579

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 48/321 (14%), Positives = 102/321 (31%), Gaps = 76/321 (23%)

Query: 72  LKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNL 131
           L     +  N  D  +  +I++      P   + +   Q     EN     +   +  NL
Sbjct: 295 LGDIDGVEVNRIDDTRHPEIDMYLSIMRPTGVVTDVPRQNVKVFENNNQ--IEGFSWVNL 352

Query: 132 SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
           S               ++I +V+D S SM                               
Sbjct: 353 SRV----------QDPLNIMLVIDTSGSMG------------------------------ 372

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ 251
                          +  +D    +A + ++ +        N +V  G I +   +  + 
Sbjct: 373 --------PSKEGLTDGGLDAAKIAALDFIDHL------PSNANV--GLIHFGTLVTVDH 416

Query: 252 CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFI 311
              L+N++  V+  +++L P   T  Y A+  +Y +L                  F++ I
Sbjct: 417 --SLTNDIGAVRQSISELKPEGQTAIYDALAISYTQL--------RRAKGQT---FIVLI 463

Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP-EGQDLLRKCTDSSGQFFAV 370
           +DG ++ +       N   I      A +  Y + +++P  +GQ L     D+    +  
Sbjct: 464 SDGADTASKGD----NYDSIVAKATKANIPTYIIGLTSPEFDGQLLEDLQRDTKAMIYQT 519

Query: 371 NDSRELLESFDKITDKIQEQS 391
               +L   + ++  ++  Q 
Sbjct: 520 PSKEQLGGFYTEVAQEVSGQY 540


>gi|209545606|ref|YP_002277835.1| hypothetical protein Gdia_3496 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533283|gb|ACI53220.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 568

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/252 (11%), Positives = 72/252 (28%), Gaps = 70/252 (27%)

Query: 211 DVLIESAGNLVNS--IQKAIQEKKNLSVRIGT-IAYNIGIVGNQCTPLSNNLNEVKSRLN 267
                S G +  S  I        +L    G  +  N+G   +   P + + + V++ ++
Sbjct: 315 SAARSSYGQMAESPLITSFPTTSGSLVTESGLQVGPNLGCDPSPTLPETASRSVVEAHIS 374

Query: 268 KLNPY--ENTNTYPAMHHAYRELYNE------KESSHNTIGSTRLKKFVIFITDGE---- 315
            +       T    A+   +  +           +      +  + K ++ +TDG     
Sbjct: 375 SMPMMSRGGTMLPQALQAGWFTISPNWQGFWPNPALPLAYNTPNMTKVLVLMTDGNNQIC 434

Query: 316 ----------------------------------------NSGASAYQNTLNT------- 328
                                                   N       N  ++       
Sbjct: 435 PCFPVYNYYGPVAPPQSNGDTDMVAYGRLLQNELGVVSSYNGNGYYGSNGFSSNILPEMN 494

Query: 329 ---LQICEYMRNAGMKIYSV-----AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
                +C+ ++N+G+ IY +        A    Q +L+ C    G ++    +  + ++F
Sbjct: 495 SLVSTVCDNIKNSGITIYVILYTHEGEEADATTQAMLQNCASKPGNYYDAPTAASMKQAF 554

Query: 381 DKITDKIQEQSV 392
             +  ++    +
Sbjct: 555 SDLGGQLSALRI 566



 Score = 53.0 bits (125), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 55/161 (34%), Gaps = 18/161 (11%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGC--ASIVSDRTIKDPTTKKDQT 60
           A+            ++LA I  ++ ++Q+ALDAA +      S V++      +   D T
Sbjct: 12  AVCAFAMLAISMMGVELARIYIVQERLQTALDAASIVAAREMSAVNNVGTCTGSCASDTT 71

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +  +      H   G    +                  N      ++  Q       L  
Sbjct: 72  AIFWANFSSAHQANGLGPFQAV-------STGPVITPQNASTITIQANVQL-----PLLF 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             ++  +   LS  +  +      N+ + + +VLD + S+E
Sbjct: 120 TKILGVSQIALSEHAQAV----RSNMGMELALVLDNTDSLE 156


>gi|260775644|ref|ZP_05884540.1| protein TadG associated with Flp pilus assembly [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608060|gb|EEX34229.1| protein TadG associated with Flp pilus assembly [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 407

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 52/421 (12%), Positives = 125/421 (29%), Gaps = 49/421 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I + F       D A  +  + +++        +  A+ ++     D     D+ 
Sbjct: 12  LFAMLIPLLFGVFALGSDGARAIQSKARIED-------ASEAAALALSARDDEHAMSDEN 64

Query: 61  STIFKKQIKKHL--KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENL 118
            TI +  I+++L  +           +         +          +   +        
Sbjct: 65  KTIVQAYIEEYLPVEDSDVTILGIERLECDDMPECRQGSGRGEARYTQYSVRVSADQTPW 124

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
           F  G     +  +     G   R  ++ A+ I    D S SM   +            + 
Sbjct: 125 FGGGSPEVEVPEVWRSQGGAKARKYQSNAVDIVFAADFSGSMASPWTGGSQPKYRDLIDI 184

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                     +   +   +                + +  NL       + +      R 
Sbjct: 185 LEKVTVELAPYNFDSQRYNSSVGVSGFNALTYRNELCAVNNLEKQGLLGVVD----YSRT 240

Query: 239 GTIAYNIG---------IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
               +              G    PL+++ +     +++      T +Y A+    R L 
Sbjct: 241 VARMWETKSCRPPSISNSAGFHDVPLTDDYSTFNRTVDRFTARGGTASYQAVMSGARLLD 300

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM------------RN 337
           +   +          ++ +I I+DG+++  + + N L    +C  +            R+
Sbjct: 301 HGSNN----------RQILIVISDGQDNNLN-HTNGLVNAGMCRDIISRLEGRPSANGRD 349

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
              ++  +     P     + +C       F   ++ EL   F++I   I+E+   +A  
Sbjct: 350 VSARLAFIGFDFEPSMNPAMVRCV-GEDNVFKAENTDEL---FEQIMFLIREEVGHLATR 405

Query: 398 R 398
           R
Sbjct: 406 R 406


>gi|89255637|ref|YP_512998.1| hypothetical protein FTL_0203 [Francisella tularensis subsp.
           holarctica LVS]
 gi|134302613|ref|YP_001122584.1| hypothetical protein FTW_1793 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156501587|ref|YP_001427652.1| hypothetical protein FTA_0219 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009921|ref|ZP_02274852.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella tularensis subsp. holarctica FSC200]
 gi|224456527|ref|ZP_03665000.1| hypothetical protein FtultM_01598 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254367031|ref|ZP_04983067.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953465|ref|ZP_06558086.1| hypothetical protein FtulhU_03745 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313263|ref|ZP_06803900.1| hypothetical protein FtulhU_03730 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143468|emb|CAJ78644.1| hypothetical membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|134050390|gb|ABO47461.1| conserved membrane protein with von Willebrand factor type A domain
           [Francisella tularensis subsp. tularensis WY96-3418]
 gi|134252857|gb|EBA51951.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|156252190|gb|ABU60696.1| conserved membrane protein with von Willebrand factor, type A
           domain [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|282158589|gb|ADA77980.1| hypothetical protein NE061598_01650 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 333

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 39/198 (19%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            +K +  +ES  +LV  +     + +    R+G I +         TPL+ ++  VK  L
Sbjct: 109 MKKANGQMESRFDLVMRVANQFIDTRKG-DRVGLILFGTRAYLQ--TPLTFDIATVKKML 165

Query: 267 NKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           +  +   P   T    A+  A ++L      S          K +I +TDGEN+      
Sbjct: 166 DDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG---- 211

Query: 324 NTLNTLQICEYMRNAGMKIYSVA------VSAPPEGQDLL------------RKCTDSSG 365
            TL  LQ  E  +   +KIY++       +     GQ L+            +  T + G
Sbjct: 212 -TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGG 270

Query: 366 QFFAVNDSRELLESFDKI 383
           ++F   +S +L + ++ I
Sbjct: 271 KYFRAQNSSDLKKVYESI 288


>gi|269105138|ref|ZP_06157832.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268160588|gb|EEZ39087.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 436

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 67/440 (15%), Positives = 129/440 (29%), Gaps = 74/440 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I V F   T A D A  +  + +++ A +AA L+  A    +       +     
Sbjct: 14  LFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPNVNSDGLGSGSKVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDI-------AQKAQINITKDKNNPLQYIAESKAQYEI 113
             I    +K ++     I                 + +N  K +    +  A +      
Sbjct: 74  RRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRFFEYEVEALTTQNSWF 133

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL-------- 165
           P  N+             S R   +  +     A+ +    D S+SME+ +         
Sbjct: 134 PGNNVISGF-----GDTFSTRGHSLARKYQSE-AVDVVFAADFSKSMEEPWTGGRQKYKD 187

Query: 166 ---------------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
                             N  +    N   + P    ++   +   S +           
Sbjct: 188 LVRVINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCFMKQDYFEKNSR 247

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
           D   +   ++  ++     EK N S   G  + +          L+N+ +     + K  
Sbjct: 248 DHRKKKYVDIKRTLNNIFIEKGNDS--CGFKS-DDPDAVFHDIYLTNDFDTFNKEIRKFR 304

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P   T +   +  + + L             T  ++ +I I+DG N     Y     T +
Sbjct: 305 PGNGTASCQGIIRSAQML----------RKGTNSRRLLIIISDG-NDWYYPYSGYKETDK 353

Query: 331 ----------ICEYMRN--------AGMKIYS----VAVSAPPEGQDLLRKCTDSSGQFF 368
                     +C  +R         +G +I +    +           L  C       F
Sbjct: 354 EIANKLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCA-GEDNVF 412

Query: 369 AVNDSRELLE-SFDKITDKI 387
                 ELL+     IT++I
Sbjct: 413 KAQYRDELLDQILSLITEEI 432


>gi|149187170|ref|ZP_01865468.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
 gi|148838706|gb|EDL55645.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
          Length = 324

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 82/256 (32%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM    +   +D                                      
Sbjct: 86  DMMLVIDLSYSMSQQDMAYQDD-----------------------------------YID 110

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + V+         +    R+G + +         TPL+ +   VK++LN+
Sbjct: 111 RLTAVKHVVSDFVD---------RRKGDRVGLVYFADHAYLQ--TPLTFDRETVKTQLNQ 159

Query: 269 LNP---YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +  A +   +              ++ +I ++DG N+        
Sbjct: 160 TVLKLIGTQTAIGDGIGLATKTFVDSN----------APQRVMILLSDGSNNAG-----V 204

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ +Q  E  +  G  IY++ V A                    + + L++    + GQ+
Sbjct: 205 LDPVQAAEIAKKYGTTIYTIGVGAGEMQVKDFFMTRTVNTAEDLDEKTLIKIANITGGQY 264

Query: 368 FAVNDSRELLESFDKI 383
           F   ++ EL   +D I
Sbjct: 265 FRARNADELATIYDTI 280


>gi|120403735|ref|YP_953564.1| hypothetical protein Mvan_2751 [Mycobacterium vanbaalenii PYR-1]
 gi|166988604|sp|A1T8Q8|Y2751_MYCVP RecName: Full=UPF0353 protein Mvan_2751
 gi|119956553|gb|ABM13558.1| von Willebrand factor, type A [Mycobacterium vanbaalenii PYR-1]
          Length = 335

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 68/185 (36%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ ++KL   + T T   + 
Sbjct: 124 EAAKQFADQLTPGINLGLIAY-AGTATVLVSPTTNR-EATKAAIDKLQLADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       ++ ++DG+ +  S   N           ++ G+ I
Sbjct: 182 TALQAVATVG--AVIGGGDEPPPARIVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +V+                 P + + L +    S G  F  +   +L + F  + ++I 
Sbjct: 240 STVSFGTPYGYVEINDQRQPVPVDDEMLKKIADLSGGDAFTASSLEQLKQVFTNLQEQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|115486675|ref|NP_001068481.1| Os11g0687100 [Oryza sativa Japonica Group]
 gi|77552567|gb|ABA95364.1| von Willebrand factor type A domain containing protein, expressed
           [Oryza sativa Japonica Group]
 gi|113645703|dbj|BAF28844.1| Os11g0687100 [Oryza sativa Japonica Group]
          Length = 633

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 41/263 (15%), Positives = 83/263 (31%), Gaps = 56/263 (21%)

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
           P      +G        L           + ++ + +  VLDVS SM D        +N 
Sbjct: 36  PIFPTIPRGQTNKDFQVLLRVEAPPAADLNSHVPLDVVAVLDVSGSMNDPVAAASPKSNL 95

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
             S                                ++DVL  S   ++  +         
Sbjct: 96  QGS--------------------------------RLDVLKASMKFVIRKLADGD----- 118

Query: 234 LSVRIGTIAYNIGIVGNQCTPL----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
              R+  +A+N G V    + L     +  +    ++++L     T   PA+  A + L 
Sbjct: 119 ---RLSIVAFNDGPVKEYSSGLLDVSGDGRSIAGKKIDRLQARGGTALMPALEEAVKIL- 174

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
              E   ++        F++ +TDG+++    +        +          +++  + A
Sbjct: 175 --DERQGSSRNHVG---FILLLTDGDDTTGFRWTRDAIHGAV------FKYPVHTFGLGA 223

Query: 350 PPEGQDLLRKCTDSSGQFFAVND 372
             + + LL     S G +  V+D
Sbjct: 224 SHDPEALLHIAQGSRGTYSFVDD 246


>gi|312621090|ref|YP_003993818.1| protein tadg, associated with flp pilus assembly [Photobacterium
           damselae subsp. damselae]
 gi|311872811|emb|CBX86902.1| Protein TadG, associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae]
          Length = 436

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 68/440 (15%), Positives = 130/440 (29%), Gaps = 74/440 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I V F   T A D A  +  + +++ A +AA L+  A    +       +     
Sbjct: 14  LFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPNVNSDGLGSGSKVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDI-------AQKAQINITKDKNNPLQYIAESKAQYEI 113
             I    +K ++     I                 + +N  K +    +  A +      
Sbjct: 74  RRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRFFEYEVEALTTQNSWF 133

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL-------- 165
           P  N+             S R   +  +     A+ +    D S+SME+ +         
Sbjct: 134 PGNNVISGF-----GDTFSTRGHSLARKYQSE-AVDVVFAADFSKSMEEPWTGGRQKYKD 187

Query: 166 ---------------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
                             N  +    N   + P    ++   +   S +           
Sbjct: 188 LVRVINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCFMKQDYFEKNSR 247

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
           D   +   ++  ++     EK N S   G  + +          L+N+ +     + K  
Sbjct: 248 DHRKKKYVDIKRTLNNIFIEKGNDS--CGFKS-DDPDAVFHDIYLTNDFDTFNKEIMKFR 304

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P   T +Y  +  + + L             T  ++ +I I+DG N     Y     T +
Sbjct: 305 PGNGTASYQGIIRSAQML----------RKGTNSRRLLIIISDG-NDWYYPYSGYKETDK 353

Query: 331 ----------ICEYMRN--------AGMKIYS----VAVSAPPEGQDLLRKCTDSSGQFF 368
                     +C  +R         +G +I +    +           L  C       F
Sbjct: 354 EIANKLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCA-GEDNVF 412

Query: 369 AVNDSRELLE-SFDKITDKI 387
                 ELL+     IT++I
Sbjct: 413 KAQYRDELLDQILSLITEEI 432


>gi|227820127|ref|YP_002824098.1| transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227339126|gb|ACP23345.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 451

 Score = 66.9 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 60/370 (16%), Positives = 135/370 (36%), Gaps = 55/370 (14%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           II +        +D      ++++MQS LDAA+++     + +    D     ++    F
Sbjct: 35  IIPMILAV-GAGLDYTRAYNVQSRMQSDLDAALVAA----IKEIDEYDEDEIAEKIKDWF 89

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
             Q +K                  A  ++T+   +   +   + A   +PT    L  L 
Sbjct: 90  DAQSEKQ----------------SATYDLTEITVDKSGHTITASASGTVPTT---LMTLA 130

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM------EDLYLQKHNDNNNMTSNK 178
                 + + S      +S    + + +V+D S SM      ED  + + + N       
Sbjct: 131 DIKTVPVGVISAIEGPATS---YLEVYIVIDKSPSMLLAATSEDQAMLRADANITCEFAC 187

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
           +    P KK+     +T   Y  +     R  DV +++   +++ +  A ++      RI
Sbjct: 188 HDTKDPVKKNGTVIASTYYNYIKSLGVKLR-TDVALDAVEEVLDMVDAADED----HARI 242

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA----MHHAYRELYNEKES 294
               Y++G   ++    + + +  + +L+  +    T+           A + L  +  +
Sbjct: 243 KVGLYSLGETISEVLEPTYSTSTARKKLSD-DSSGLTSATSMSATYFQTALKALKKKVGT 301

Query: 295 SHNTIGSTRLKKFVIFITDGENS-------GASAYQNTLNTLQ--ICEYMRNAGMK---I 342
           + +   +    K V+ +TDG  S        +  Y   +  L    C+Y+++       +
Sbjct: 302 AGDGTSAASPLKLVLLLTDGVQSNRDWVIKWSGKYWGRVTPLNPDWCDYLKDNDATMAVL 361

Query: 343 YSVAVSAPPE 352
           Y+  ++ P +
Sbjct: 362 YTEYLAIPAD 371


>gi|254283762|ref|ZP_04958730.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219679965|gb|EED36314.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 325

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 47/301 (15%), Positives = 91/301 (30%), Gaps = 75/301 (24%)

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSR 158
                IA +   Y +    ++L  L+  A            E +       + + +D+S 
Sbjct: 50  RSGSVIASASWWYRLVVIAVWLLLLVGLAKPQWVGEPITKTETAR-----DVMLAIDLSA 104

Query: 159 SMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
           SM+                 Y   P P                       + D +     
Sbjct: 105 SMD-----------------YRDFPGPD-----------------GKPVSRFDAVQRVVD 130

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENT 275
             V               R+G I +          P + +LN  ++ ++ +        T
Sbjct: 131 QFVA---------NREGDRVGLIVFGAKAYLQ--LPFTRDLNTARALVDLMQVGMAGPQT 179

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
               ++  A R   + +             + +I +TDG  +  ++    +N  +I    
Sbjct: 180 ALGDSIGLAIRAFESSEVDD----------RVLILLTDG--NDTASKMTPINAAEI---A 224

Query: 336 RNAGMKIYSVAVS-APPEGQD------LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           +  G++IY++ +  A   G+D      L      S GQFF   D   L + +D+I     
Sbjct: 225 QLNGIEIYTIGIGDAEATGEDRIDFETLASIAERSGGQFFDAQDETALRQVYDRIDALAV 284

Query: 389 E 389
            
Sbjct: 285 A 285


>gi|309790845|ref|ZP_07685389.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
 gi|308227132|gb|EFO80816.1| von Willebrand factor type A [Oscillochloris trichoides DG6]
          Length = 885

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 40/251 (15%), Positives = 77/251 (30%), Gaps = 66/251 (26%)

Query: 129 TNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKS 188
              +L     +    +   +++  V+D S SM +                          
Sbjct: 391 VEAALPVYMDVRDREQRPDLALVFVIDRSGSMAE-------------------------- 424

Query: 189 FWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV 248
                         PA   +K+D+  E+   LV +I+    E      R+G + ++    
Sbjct: 425 --------------PAGNVQKLDIAKEA---LVQAIRMLYGE-----DRVGIVTFDSQAY 462

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
                       EV   +  +     TN    +    R L           G     K +
Sbjct: 463 TTMPITQGVGEEEVLQAIASVTADGGTNIGAGLSAGQRMLT----------GVEAKIKHM 512

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF 368
           I +TDG       +    + L + E MR  G+ +  VA +     ++L    T   G+++
Sbjct: 513 ILLTDG-------WGEGNDQLAVVEAMRAQGITLSVVA-AGSDTAEELKTLATAGGGRYY 564

Query: 369 AVNDSRELLES 379
           A    + + + 
Sbjct: 565 AAAIMQAVPQI 575


>gi|187932172|ref|YP_001892157.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187713081|gb|ACD31378.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 333

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 39/198 (19%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            +K +  +ES  +LV  +     + +    R+G I +         TPL+ ++  VK  L
Sbjct: 109 MKKANGQMESRFDLVMRVANQFIDTRKG-DRVGLILFGTRAYLQ--TPLTFDIATVKKML 165

Query: 267 NKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           +  +   P   T    A+  A ++L      S          K +I +TDGEN+      
Sbjct: 166 DDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG---- 211

Query: 324 NTLNTLQICEYMRNAGMKIYSVA------VSAPPEGQDLL------------RKCTDSSG 365
            TL  LQ  E  +   +KIY++       +     GQ L+            +  T + G
Sbjct: 212 -TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGG 270

Query: 366 QFFAVNDSRELLESFDKI 383
           ++F   +S +L + ++ I
Sbjct: 271 KYFRAQNSSDLKKVYESI 288


>gi|162147499|ref|YP_001601960.1| hypothetical protein GDI_1715 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786076|emb|CAP55658.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 571

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/216 (10%), Positives = 63/216 (29%), Gaps = 67/216 (31%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPY--ENTNTYPAMHHAYRELYNE------KESS 295
           N+G   +   P + + + V++ ++ +       T    A+   +  +           + 
Sbjct: 354 NLGCDPSPTLPETASRSVVEAHISSMPMMSRGGTMLPQALQAGWFTISPNWQGFWPNPAL 413

Query: 296 HNTIGSTRLKKFVIFITDGE---------------------------------------- 315
                +  + K ++ +TDG                                         
Sbjct: 414 PLAYNTPNMTKVLVLMTDGNNQICPCFPVYNYYGPVAPPQSNGDTDMVAYGRLLQDELGV 473

Query: 316 ----NSGASAYQNTLNT----------LQICEYMRNAGMKIYSV-----AVSAPPEGQDL 356
               N       N  ++            +C+ ++N+G+ IY +        A    Q +
Sbjct: 474 VSSYNGNGYYGSNGFSSNILPEMNSLVSTVCDNIKNSGITIYVILYTHEGEEADATTQAM 533

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           L+ C    G ++    +  + ++F  +  ++    +
Sbjct: 534 LQNCASKPGNYYDAPTAASMKQAFSDLGGQLSALRI 569



 Score = 53.4 bits (126), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 55/161 (34%), Gaps = 18/161 (11%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGC--ASIVSDRTIKDPTTKKDQT 60
           A+            ++LA I  ++ ++Q+ALDAA +      S V++      +   D T
Sbjct: 15  AVCAFAMLAISMMGVELARIYIVQERLQTALDAASIVAAREMSAVNNVGTCTGSCASDTT 74

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +  +      H   G    +                  N      ++  Q       L  
Sbjct: 75  AIFWANFSSAHQANGLGPFQAV-------STGPVITPQNASTITIQANVQL-----PLLF 122

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             ++  +   LS  +  +      N+ + + +VLD + S+E
Sbjct: 123 TKILGVSQIALSEHAQAV----RSNMGMELALVLDNTDSLE 159


>gi|86143679|ref|ZP_01062055.1| batA protein [Leeuwenhoekiella blandensis MED217]
 gi|85829722|gb|EAQ48184.1| batA protein [Leeuwenhoekiella blandensis MED217]
          Length = 334

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 46/275 (16%), Positives = 85/275 (30%), Gaps = 93/275 (33%)

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
           +  R++    I I + +DVS SM    L+ +                             
Sbjct: 82  VSTRTNTTRGIDIVIAIDVSASMLARDLKPN----------------------------- 112

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                      +++ L E A   +             S RIG + Y         TP+++
Sbjct: 113 -----------RLEALKEVASQFIA---------DRPSDRIGLVEYAGESYTR--TPITS 150

Query: 258 NLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           + + V S LN +         T     +  +   L            S    K +I +TD
Sbjct: 151 DKSIVLSSLNDIQYNSIIEGGTAIGMGLATSVNRL----------KDSRAKSKVIILMTD 200

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG-------------------- 353
           G N+      +T + L      +  G+K+Y++ +                          
Sbjct: 201 GVNNAGFIEPSTASEL-----AQEFGIKVYTIGLGTNGTALSPVALRPDGSFQYGSIPVE 255

Query: 354 --QDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
             + LL++  D + G +F   D+  L E + +I  
Sbjct: 256 IDEALLQEIADKTGGLYFRATDNESLEEIYAEINK 290


>gi|254409659|ref|ZP_05023440.1| von Willebrand factor type A domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183656|gb|EDX78639.1| von Willebrand factor type A domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 413

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 89/265 (33%), Gaps = 66/265 (24%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
           PS+   LS+    I +   ++L +++C++LD S SM                        
Sbjct: 19  PSSQRQLSIAIRAITQSQDQSLPLNLCLILDHSGSM------------------------ 54

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
                                  R ++ + ++A  L+  +++          RI  IA++
Sbjct: 55  ---------------------HGRPLETVKKAAMQLIERLKEGD--------RICVIAFD 85

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                       +NLN +KS++ +L+    T     +     E+           G    
Sbjct: 86  HRAKVLVPNQAIDNLNTIKSQIRQLSADGGTAIDEGLKLGIEEV---------AKGKADA 136

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
              V  +TDGEN       +    L++  +     + I ++   A      L +     S
Sbjct: 137 VSQVFLLTDGENEHG----DNERCLKLAHFAVEHKLTINTLGFGASWNQDVLEKIADSGS 192

Query: 365 GQFFAVNDSRELLESFDKITDKIQE 389
           G    +    + ++ F ++ ++IQ 
Sbjct: 193 GTLCYIEQPEQAVQEFGRLFNRIQA 217


>gi|254368552|ref|ZP_04984568.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157121455|gb|EDO65646.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 339

 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 39/198 (19%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            +K +  +ES  +LV  +     + +    R+G I +         TPL+ ++  VK  L
Sbjct: 115 MKKANGQMESRFDLVMRVANQFIDTRKG-DRVGLILFGTRAYLQ--TPLTFDIATVKKML 171

Query: 267 NKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           +  +   P   T    A+  A ++L      S          K +I +TDGEN+      
Sbjct: 172 DDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG---- 217

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPE------GQDLL------------RKCTDSSG 365
            TL  LQ  E  +   +KIY++ +           GQ L+            +  T + G
Sbjct: 218 -TLQPLQAAEIAKQYHIKIYTIGLGGDQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGG 276

Query: 366 QFFAVNDSRELLESFDKI 383
           ++F   +S +L + ++ I
Sbjct: 277 KYFRAQNSSDLKKVYESI 294


>gi|315122409|ref|YP_004062898.1| hypothetical protein CKC_03305 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495811|gb|ADR52410.1| hypothetical protein CKC_03305 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 411

 Score = 66.5 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 65/405 (16%), Positives = 143/405 (35%), Gaps = 45/405 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           ++A+++S     +    D   ++ +RN +QS++D A+ +      ++ ++     ++   
Sbjct: 25  VSAVLLSSFLTIMDIMRDYTDMIRVRNMLQSSIDYALHNNP----NELSVGTIKQREMLI 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  +  + K      E    I  ++ ++IT+    P Q+    +    I  ++L L
Sbjct: 81  KKRIGYFLDSNYKGTLLTEEQIKLIVNQSTVSITERSFYPQQFHINIELHKNIQLKSLIL 140

Query: 121 K-GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
              + P    N+S R         +N+A+   MV+  + + E  ++         T ++ 
Sbjct: 141 HMAMNPKKDFNISQR---KSSLYKKNVAL---MVVPFTWTGE--WIPPSLFTTQFTVSQD 192

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI----QKAIQEKKNLS 235
           LLP   K   + K    +K          KI            S      + I   K   
Sbjct: 193 LLPSDLKTEHFKKTEYFNKRNQFFKMFLSKIKENNLCIAPYHYSAIVYWSEGIFSYKLPF 252

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
                 ++    V    T    ++    + +  L      ++          L       
Sbjct: 253 STTFLYSFRDIYVKQYST--IWDMKP-SNYILDLFAGAELHS--------NRLTPADP-- 299

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI---CEYM-RNAG------MKIYSV 345
                    KKF++ I  G  +  S  +N+    ++   C  M +N G      + +YS+
Sbjct: 300 -CFRRGVIQKKFMLIIAAG--NQISDRKNSAEYFKMKHGCTLMGKNMGKNPQEEITVYSL 356

Query: 346 AVS-APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            +S  P   +DL++ CT    +++ +   +++    D++   I  
Sbjct: 357 GISPDPDTKRDLIQ-CTRHPDRYYEIQSYKDIAPVIDRLERNISS 400


>gi|89072369|ref|ZP_01158948.1| hypothetical protein SKA34_06335 [Photobacterium sp. SKA34]
 gi|89051901|gb|EAR57353.1| hypothetical protein SKA34_06335 [Photobacterium sp. SKA34]
          Length = 321

 Score = 66.5 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 35/258 (13%), Positives = 83/258 (32%), Gaps = 81/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM    +   N  +                                    
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSV----------------------------------D 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + +          K    R+G + +         TPL+ +   V+ +L++
Sbjct: 110 RLTAVKHVLSDFIE---------KRKGDRLGLVLFADHAYLQ--TPLTFDRKTVEKQLDR 158

Query: 269 LNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  ++T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLGLIGQSTAIGEGLGIA----------TKTFINSKAPQRVIILLSDGANTSG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ L+  +  + +G+KIY+V V A                    + + L      + G++
Sbjct: 204 IDPLEAAKLAKESGVKIYTVGVGADQMVQQGFFGDRIVNPSQDLDEKTLTDIAKMTGGEY 263

Query: 368 FAVNDSRELLESFDKITD 385
           F   + ++L + +D I  
Sbjct: 264 FRARNPQQLEKIYDIINK 281


>gi|330447847|ref|ZP_08311495.1| von Willebrand factor type A domain protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328492038|dbj|GAA05992.1| von Willebrand factor type A domain protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 321

 Score = 66.5 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 84/258 (32%), Gaps = 81/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM    +   N  +                                    
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSI----------------------------------D 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + +          K    R+G + +         TPL+ + N V+ +L++
Sbjct: 110 RLTAVKHVLSDFIE---------KRKGDRLGLVLFADHAYLQ--TPLTFDRNTVEQQLDR 158

Query: 269 LNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  ++T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLGLIGQSTAIGEGLGIA----------TKTFINSKAPQRVIILLSDGANTSG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ L+  +  + +G+KIY+V V A                    + + L      + G++
Sbjct: 204 IDPLEAAKLAKESGVKIYTVGVGADQMVQKGFFGDRLVNPSQDLDEKTLTEIAKMTGGEY 263

Query: 368 FAVNDSRELLESFDKITD 385
           F   + ++L + +D I  
Sbjct: 264 FRARNPQQLEKIYDIINK 281


>gi|126730249|ref|ZP_01746060.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
 gi|126708982|gb|EBA08037.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
          Length = 666

 Score = 66.5 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 62/178 (34%), Gaps = 48/178 (26%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI---------------- 299
           S++   + + ++ +  ++ T     + +A   L +    S  T                 
Sbjct: 484 SDDAATLSAFIDNMRMHDGTGIQYGLKYA-LALLDPATGSAVTELISAGLVDSRFLGRPI 542

Query: 300 --GSTRLKKFVIFITDGENSGA---------------------------SAYQNTLNTLQ 330
                  +KF++ ++DG  +                             S   N L+ L 
Sbjct: 543 AWEDEETEKFIVVMSDGAVTDQYRPVDPFAPLNGETELQTQGSGSYTTFSTRGNNLDNLH 602

Query: 331 I-CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
             C+  R+ G+ +++VA        D LR C  S   FF V    E++++FD I  +I
Sbjct: 603 TQCQLARDLGVTVFAVAFETTDADADELRLCASSDSHFFHVQ-GTEIIDAFDTIARQI 659



 Score = 44.1 bits (102), Expect = 0.034,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 60/160 (37%), Gaps = 32/160 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            +  ++ +  +    ++D+ +   IR ++Q+ LD AVL+            D   ++D  
Sbjct: 63  FSTFMLVLILVITGASVDIMYQEAIRARLQATLDRAVLAAA----------DLDQQQDPV 112

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + +       ++ +   + E+  D+     +           Y     A   +  +  FL
Sbjct: 113 AVV-----NDYVTKAGLV-EHLTDVIATPGL-----------YDRTVAADAGLTLDTYFL 155

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
           + +       +   ST     ++    + I +V+D+S SM
Sbjct: 156 R-MSGWQTLPVIAASTAEERIAN----VEISLVMDISGSM 190


>gi|307718398|ref|YP_003873930.1| hypothetical protein STHERM_c06990 [Spirochaeta thermophila DSM
           6192]
 gi|306532123|gb|ADN01657.1| hypothetical protein STHERM_c06990 [Spirochaeta thermophila DSM
           6192]
          Length = 458

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 41/268 (15%), Positives = 84/268 (31%), Gaps = 55/268 (20%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
            ++   L +RS  +    +    IS  +VLD S SM D                      
Sbjct: 68  GASWRLLPVRS--VRRGVNREEGISFLLVLDASGSMWDALDGT----------------- 108

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
                           P   P   +I     +    +  +            R+G   +N
Sbjct: 109 ----------------PTEDPDRMRITHAKRAIREFLPLLSGRD--------RVGLAVFN 144

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                    P+  + + V  +L+ +         P+   AY ELY   E +    G    
Sbjct: 145 RTYRV--IQPIVGDPSLVLEKLDAIE-------RPSREQAYTELYRSMEEALTDFGEEGR 195

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-S 363
           ++ ++ ++DGEN      ++        +     G+  Y +      +   L+      +
Sbjct: 196 RRVLVVLSDGENFPVDPSESPSTPGTAIDLAHRYGITCYVIHFGTEKD--RLIGDLASET 253

Query: 364 SGQFFAVNDSRELLESFDKITDKIQEQS 391
            G+ F   ++ EL   +  I +++ ++ 
Sbjct: 254 GGRVFDARNALELASVYTAIQEQVLQEY 281


>gi|332185631|ref|ZP_08387379.1| hypothetical protein SUS17_560 [Sphingomonas sp. S17]
 gi|332014609|gb|EGI56666.1| hypothetical protein SUS17_560 [Sphingomonas sp. S17]
          Length = 420

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 62/422 (14%), Positives = 128/422 (30%), Gaps = 62/422 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ + V    I   +D A       + QS L+A   +     VS              
Sbjct: 2   MFALALPVLTCSIGMGVDYARA----AKAQSKLNAIADAAALLAVSK---NAMRADDATA 54

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +   +      L+  + ++ +   ++       T         +      Y   +EN+F 
Sbjct: 55  AYFARSFFS--LQSAALVKSDGITLSNVTVQAPTDGNGRRTAVV-----NYRATSENVFA 107

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK--HNDNNNMTSNK 178
           + L   +   +S +S      +     I   M+LDVS SM         +    + TS  
Sbjct: 108 RIL-GMSTLTISGKSETANAIA---PDIDFYMLLDVSASMALPTTSSGLNKVAQSNTSRC 163

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI---QKAIQEKKNLS 235
                  +K F   +    +        +  + + I++ G+ VN +    +++  K    
Sbjct: 164 VFACHTGEKRFRGYDAHGKQTDLYGVALSYGLPLRIDAEGDAVNQLTATARSMASKNGSD 223

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-----------------YENTNTY 278
            RI    +      +   PL+N+L     +   L P                     +  
Sbjct: 224 YRIAITTFRGARGFSVRQPLTNDLTAAGHKAANLKPPYYASIGCPTSACKSSEVGWNDRD 283

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT---LQICEYM 335
                A  ++        + +     +  V  +TDG  +  S              C+ +
Sbjct: 284 TGSSDAMDQINAMIPQPGSGVNGQDPQAVVFMVTDGMRNEKSPKGARPEVAFDTAKCDMI 343

Query: 336 RNAGMKI---YSVAVSAPPEGQD---------------LLRKCTDSSGQFFAVNDSRELL 377
           ++ G++I   Y+  +    +G                  L+ C  S G +  V    ++ 
Sbjct: 344 KHRGIRIAVLYTEYLRDAVKGTTNLERSVEPYLYQVEPALQSCA-SPGLYTKVTTDGDIS 402

Query: 378 ES 379
            +
Sbjct: 403 AA 404


>gi|85374478|ref|YP_458540.1| hypothetical protein ELI_08255 [Erythrobacter litoralis HTCC2594]
 gi|84787561|gb|ABC63743.1| hypothetical protein ELI_08255 [Erythrobacter litoralis HTCC2594]
          Length = 626

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 54/158 (34%), Gaps = 34/158 (21%)

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI---GSTRLKKFVIFITDGENSGAS 320
           SR+N L+P   T     M  A R +  +   + +         + + VIF+TDGE   + 
Sbjct: 466 SRINALSPKGGTMHDIGMIWAGRLISPDGIFAADNASAPNGDPISRHVIFMTDGEMGASP 525

Query: 321 AYQ-----------------------------NTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           +                               + L    IC+ +RN  + I+S+A   P 
Sbjct: 526 SNTTAYGNYDMDGRMAGFAASGSWTENQLAAIHNLRLEAICKAIRNKNVTIWSIAFGLPH 585

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 + C   + +     +S EL   F  I   I E
Sbjct: 586 SAYT--QGCATGTSRALTAANSSELDSRFRDIAGSIAE 621



 Score = 44.9 bits (104), Expect = 0.022,   Method: Composition-based stats.
 Identities = 40/260 (15%), Positives = 78/260 (30%), Gaps = 63/260 (24%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A II +    +   +D + +   ++++Q A DAA L+    +    +I + T   +   
Sbjct: 6   AASIIPLV-GVVGGGVDASRMYLAKSRLQQACDAATLAARKELA-GSSISNGTIPAN-IQ 62

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                    +   G Y   N G              +       +  A   +PT  L   
Sbjct: 63  DKADNFFDTNFPSGMYGTTNVGY-----------TLSAGTATQMDGAATASVPT-TLMKV 110

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
             +P     ++  +   +        I + +VLD+S SM                     
Sbjct: 111 FNVPQIDIAVNCSAELDL------PNIDVVLVLDMSGSMNSNGTT--------------- 149

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                                    +++I  L  +  +  + +     +     VRIG +
Sbjct: 150 ------------------------GSKRITALKNAVFSFYDVV--MAAKPAGTRVRIGIV 183

Query: 242 AYNIGI-VGNQCTPLSNNLN 260
            YN  + VG++   LS    
Sbjct: 184 PYNGAVSVGDELLTLSTTTG 203


>gi|56707447|ref|YP_169343.1| hypothetical protein FTT_0293 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669918|ref|YP_666475.1| hypothetical protein FTF0293 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314141|ref|YP_762864.1| hypothetical protein FTH_0198 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|254370860|ref|ZP_04986865.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874284|ref|ZP_05246994.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56603939|emb|CAG44926.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320251|emb|CAL08309.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129040|gb|ABI82227.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|151569103|gb|EDN34757.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840283|gb|EET18719.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 339

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 39/198 (19%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            +K +  +ES  +LV  +     + +    R+G I +         TPL+ ++  VK  L
Sbjct: 115 MKKANGQMESRFDLVMRVANQFIDTRKG-DRVGLILFGTRAYLQ--TPLTFDIATVKKML 171

Query: 267 NKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           +  +   P   T    A+  A ++L      S          K +I +TDGEN+      
Sbjct: 172 DDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG---- 217

Query: 324 NTLNTLQICEYMRNAGMKIYSVA------VSAPPEGQDLL------------RKCTDSSG 365
            TL  LQ  E  +   +KIY++       +     GQ L+            +  T + G
Sbjct: 218 -TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGG 276

Query: 366 QFFAVNDSRELLESFDKI 383
           ++F   +S +L + ++ I
Sbjct: 277 KYFRAQNSSDLKKVYESI 294


>gi|145224243|ref|YP_001134921.1| hypothetical protein Mflv_3659 [Mycobacterium gilvum PYR-GCK]
 gi|189040172|sp|A4T9I4|Y3659_MYCGI RecName: Full=UPF0353 protein Mflv_3659
 gi|145216729|gb|ABP46133.1| von Willebrand factor, type A [Mycobacterium gilvum PYR-GCK]
          Length = 335

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 69/185 (37%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ ++KL   + T T   + 
Sbjct: 124 EAAKQFADQLTPGINLGLIAY-AGTATVLVSPTTNR-ESTKTAIDKLQLADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       V+ ++DG+ +  S   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDEPPPARVVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +V+                 P + + L +    S G+ F  +   +L + F  + ++I 
Sbjct: 240 STVSFGTPYGYVEINEQRQPVPVDDEMLKKIADLSGGEAFTASSLEQLKQVFTNLQEQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|332162963|ref|YP_004299540.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667193|gb|ADZ43837.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 457

 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 57/432 (13%), Positives = 136/432 (31%), Gaps = 87/432 (20%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           II       I    +++H +  + ++  A++ A L+     + +  I D   +    + +
Sbjct: 31  IIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALT---IENNEIPDEPQQIKN-NAL 86

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY--EIPTENLFLK 121
               +  +L    ++                 D  + L+Y A     Y  +  +++ F  
Sbjct: 87  VLSYVNAYLPSKKFLVPIIN----------INDNTHYLEYNAAVTMAYPAKFLSQSPFTN 136

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN---------- 171
            +    +T+  +        +SE     +  V D S SM   + +    +          
Sbjct: 137 TISDMNITDNGVAIKNKAIEASE--PTDVIFVADYSGSMLYNFNENKPRDHERIDALRSA 194

Query: 172 ---------NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                    +N   N     P    +       + +      P + KI       GN ++
Sbjct: 195 FRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPK---GNYLS 251

Query: 223 SIQKAIQEKKNLSVRIG----------TIAYNIGIVGNQCTPLSNN---LNEVKSR---- 265
              K       L   IG          +I  N   +    + +      L    +     
Sbjct: 252 DEIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGDVCLQGSNAYSLEQ 311

Query: 266 ---------LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
                    + ++ P+  T     +  A     N+ ++ H        KK +I ++DG +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNIFKNKAKNGH--------KKLMIILSDGVD 363

Query: 317 SGASAYQNTLNTLQ------ICEYMRNAGMKIYSVAVS-APPEGQDL-----LRKCTDSS 364
           +        +   +      +CE ++   +++  +A++ +P   ++       +KC    
Sbjct: 364 TDDFPSSKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GE 422

Query: 365 GQFFAVNDSREL 376
             ++  +++ EL
Sbjct: 423 DNYYEAHNAHEL 434


>gi|326795817|ref|YP_004313637.1| von Willebrand factor type A [Marinomonas mediterranea MMB-1]
 gi|326546581|gb|ADZ91801.1| von Willebrand factor type A [Marinomonas mediterranea MMB-1]
          Length = 337

 Score = 66.5 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 58/171 (33%), Gaps = 38/171 (22%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEK 292
            RIG I +          PLS +   V+  + +       E T    A+    ++L    
Sbjct: 137 DRIGVIVFGTKAYLQA--PLSFDTKTVRQLIQETQIGFAGEKTAIGDAIGLGIKQLSELP 194

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-- 350
                       KK +I +TDG N+        ++ LQ   +    G+ I+++ + A   
Sbjct: 195 SD----------KKVLILMTDGANTAGR-----VSPLQAANFAAEQGVTIHTIGIGADEM 239

Query: 351 ---------------PEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                             + LL      + G+++    + +L E +  I +
Sbjct: 240 EVQGFFGPQTVNPSEDLDEALLENVASLTGGKYYRAKSTSDLEEIYGDINN 290


>gi|90577284|ref|ZP_01233095.1| hypothetical protein VAS14_09574 [Vibrio angustum S14]
 gi|90440370|gb|EAS65550.1| hypothetical protein VAS14_09574 [Vibrio angustum S14]
          Length = 321

 Score = 66.5 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 35/258 (13%), Positives = 83/258 (32%), Gaps = 81/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM    +   N  +                                    
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSI----------------------------------D 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + +          K    R+G + +         TPL+ +   V+ +L++
Sbjct: 110 RLTAVKHVLSDFIE---------KRKGDRLGLVLFADHAYLQ--TPLTFDRKTVEQQLDR 158

Query: 269 LNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  ++T     +  A          +   I S   ++ +I ++DG N+        
Sbjct: 159 TVLGLIGQSTAIGEGLGIA----------TKTFINSKAPQRVIILLSDGANTSG-----V 203

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ L+  +  + +G+KIY+V V A                    + + L      + G++
Sbjct: 204 IDPLEAAKLAKESGVKIYTVGVGADQMVQQGFFGDRIVNPSQDLDEKTLTEIAKMTGGEY 263

Query: 368 FAVNDSRELLESFDKITD 385
           F   + ++L + +D I  
Sbjct: 264 FRARNPQQLEKIYDIINK 281


>gi|304406204|ref|ZP_07387861.1| von Willebrand factor type A [Paenibacillus curdlanolyticus YK9]
 gi|304344788|gb|EFM10625.1| von Willebrand factor type A [Paenibacillus curdlanolyticus YK9]
          Length = 762

 Score = 66.5 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 54/395 (13%), Positives = 126/395 (31%), Gaps = 54/395 (13%)

Query: 6   ISVCFLFITYAIDLAHIMYIRNQM--QSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
                     AID ++   I+ ++  +   + + LS     + + T+   T +       
Sbjct: 186 APKSLKLAIDAIDASNYPTIKVKLAVEDGSEQSDLSSGQVAIKENTVAQKTAEV------ 239

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
                       +   +   +I     ++ T   N   + +       ++          
Sbjct: 240 -----------NANTADKTYEIVYDTTVSNTNPPNGEQRVVDLVIGDNKLSESYKSPS-- 286

Query: 124 IPSALTNLSLRSTGIIERSSENLAISIC-----MVLDVSRSMEDLYLQKHNDNNNMTSNK 178
                 ++   S    E    N+  S+      +V D    M  +         +  +  
Sbjct: 287 --QKKLHIDDVSYNTDEYPKVNVYFSLYDENNQLVED----MNPVKTAFTVKEGDKETKN 340

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                  +K   + +T            + K+  + ++A   ++    A  +       +
Sbjct: 341 ASFSKLTEKPQ-AISTNLVIDVSDSMSEDNKLTKVKDAATQFLSHASFASNDV------V 393

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           G ++++      Q +  +  +  +KS +  +     T  Y A++ A          S+  
Sbjct: 394 GLMSFSDASNIRQ-SDFTTEIESIKSSIAGMQTSGCTALYEALNQAV---------SNTA 443

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
             S    K+V+  TDG+N+      N ++   +       G+ IY++ V       DL +
Sbjct: 444 YNSVEGSKYVVVFTDGKNTICD-GTNWVSPSTVINNALQWGVPIYAIGVEEDA---DLQQ 499

Query: 359 KCTDSSGQFF-AVNDSRELLESFDKITDKIQEQSV 392
               ++GQ+    ND  +L   +  I    ++Q V
Sbjct: 500 IAEQTNGQYHVLGNDFTDLNAIYSDIYTNKKKQYV 534


>gi|171913221|ref|ZP_02928691.1| hypothetical protein VspiD_18615 [Verrucomicrobium spinosum DSM
           4136]
          Length = 868

 Score = 66.5 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 52/383 (13%), Positives = 110/383 (28%), Gaps = 91/383 (23%)

Query: 18  DLAHIMYIRNQMQSALDAAVLSGCASI-VSDRTIK--------DPTTKKDQTSTIFKKQI 68
           D  +I   R  ++     A+ +   ++ + D   +        D    +     + K+ I
Sbjct: 264 DTRNIYKYRAVLEGFAGDAIPANNEALTLVDVRGRLRLLYVEGDMNEGQYLVQAMAKEGI 323

Query: 69  KKHLKQGSYIRENAGDIAQKAQINITKDKNNPL-QYIAESKAQYE-------IPTENLFL 120
           +  L+  + I     +++    + ++    + + +    +   Y        I       
Sbjct: 324 ELELRAPNSIPNTPQELSGFDGVILSDVPAHQVGETAMVAIRDYVDKLGGGFIMLGGPNS 383

Query: 121 KGLIPSALTNLS--LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
            G+     T +   L          E  + ++ +V+D S SM                  
Sbjct: 384 FGVGGYYRTPIEEVLPVRLKAPDEEEKQSSALALVIDRSGSMSG---------------- 427

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                                         K+++   +A         A  E    +  I
Sbjct: 428 -----------------------------EKLEMAKSAAI--------ATAEVLTRNDSI 450

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           G  A++             + + V  ++  L     TN +PA   A   L   K      
Sbjct: 451 GVYAFDSEAHVVVPMTRLTSSSAVAGQIAGLTSGGGTNLHPAFTEARNALQRTKAKI--- 507

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                  K +I +TDG+        +      +    R  G+ I +VA+        LL+
Sbjct: 508 -------KHMIILTDGQ-------TSGQGYEALASQCRAEGVTISTVAIGDGAH-VGLLQ 552

Query: 359 KCTD-SSGQFFAVNDSRELLESF 380
                  G+ +   D+  ++  F
Sbjct: 553 AIASLGGGKSYTTLDAANIVRIF 575


>gi|189219434|ref|YP_001940075.1| hypothetical protein Minf_1423 [Methylacidiphilum infernorum V4]
 gi|189186292|gb|ACD83477.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Methylacidiphilum infernorum V4]
          Length = 334

 Score = 66.5 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 55/294 (18%), Positives = 97/294 (32%), Gaps = 79/294 (26%)

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
            F+       +  L+       +         I +VLD+S SM                 
Sbjct: 57  FFIYIAFLFFVIALARPQEEKGKVPLRKEGYDIILVLDISGSMLAE-------------- 102

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                                        + +ID    S  ++V  + K   +K+    R
Sbjct: 103 -----------------------------DYEIDQKRVSRLDIVLEVVKTFLDKRTN-DR 132

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKES 294
           IG +A+          PL+ + N +K ++++L      + T    A+  A   L  +KES
Sbjct: 133 IGLVAFAGR--AYTVCPLTFDHNWLKRKIDQLQAGTIEDGTAIGDALGLALSRLEGKKES 190

Query: 295 SHNTIGSTRLKKFVIFITDGENSGAS---------------------AYQNTLNTLQICE 333
                  +    F+I +TDG N+  +                     A  N   T+ + +
Sbjct: 191 GERKKIGS----FLILLTDGANNCGNLTPIEAARLAAHAAVPVFTIGAGINGEVTMPVMD 246

Query: 334 YMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDK 386
             R   +   +V VS   EG  LLR     + G++F   DS  ++ +F  I  +
Sbjct: 247 EERRK-IGSQTV-VSEVDEG--LLRNIAQLTGGEYFRATDSNAIVSAFQAIDAQ 296


>gi|315923825|ref|ZP_07920054.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315622858|gb|EFV02810.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 969

 Score = 66.1 bits (159), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 52/331 (15%), Positives = 91/331 (27%), Gaps = 77/331 (23%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK----------------- 167
                 LSL  TG    +SE+    + +V D+S SM++                      
Sbjct: 49  GDGTYKLSLSVTGTASSTSESSKADVVIVFDISNSMDEETNTYVEYATGRYGSVSSDAPT 108

Query: 168 ---------HNDNNNMTSNKYLLPPPPKKSFWSKNTTKS----KYAPAPAPANRKIDVLI 214
                        NN    +Y        S        +    +Y         ++DV  
Sbjct: 109 GSSTRRRLYRRSTNNWGYYQYTEITNDTTSGTVYYLGDNYQYHEYTGKRYSQKTRLDVAK 168

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC-TPLSNNLNEVKSRLNKLNPY- 272
            +   +++ +  A       SVRI  ++++         +  S NL+ + +         
Sbjct: 169 SATNTMIDQLL-ANNATNPGSVRISLVSFDTFASDATAWSTSSENLHSIVNGYKTPQSSH 227

Query: 273 -----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE--------NSGA 319
                  TN   A+  A             T      +K VIF++DG         N   
Sbjct: 228 LGGHRGGTNWEDALQKA-----------DGTQPRADAQKHVIFVSDGNPTFRISSINGNP 276

Query: 320 SAYQN---------------TLNTLQICEYMRN---AGMKIYSVA-VSAPPEGQDLLRKC 360
               N                 N     +  +     G   Y+V         Q+L  + 
Sbjct: 277 DDQYNDVHGHGDDDYYHSHPNYNYDAAKDDAKKIVDGGAAFYTVGTFGDAARMQNLATE- 335

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             +S  ++  +D   L  +F  I   I    
Sbjct: 336 AGASDNYYKADDEAALKAAFKNIVASITHSM 366


>gi|126730251|ref|ZP_01746062.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
 gi|126708984|gb|EBA08039.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
          Length = 614

 Score = 66.1 bits (159), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSREL 376
           +   A Q   N   IC   +   + I+++ V AP  G + +R C  S+  ++ V  S +L
Sbjct: 538 TTVDASQANTNLATICAKAKQQDVTIFTIGVEAPQAGLNAMRNCASSASHYYNV-SSNQL 596

Query: 377 LESFDKITDKIQE 389
           +++F  I+D + E
Sbjct: 597 VDTFRSISDVVVE 609



 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 67/352 (19%), Positives = 105/352 (29%), Gaps = 81/352 (23%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           V  +F    ID+ H    R+Q+Q+ LD AVL+      +    +DP T  +      K  
Sbjct: 44  VMMVFGGIGIDMMHAELKRSQVQNTLDRAVLAAA----NLSNTRDPQTVVEDYFRAMK-- 97

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
                     + +  GD+        T D     +  AE          N    GLI   
Sbjct: 98  ----------LEDTLGDVQ-------TGDSLGAKRVRAEGNGSI-----NSHFLGLIGVD 135

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSME---------------DLYLQKHNDNN 172
             ++   +T     +     + I +VLDVS SM+               D  L +  DN+
Sbjct: 136 QLDVYGAATAENATA----PLEISLVLDVSGSMQGQKIRDLKEAAKAFVDAVLGEGGDNS 191

Query: 173 NMTSN--KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
            +T +   Y            +         +        D    S        Q A  +
Sbjct: 192 RVTVSLIPYNATVNLGDDLSERFNLDRWQNYSSCAIFESSDYNSLSIDPNAGLEQLAHFD 251

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV---------KSRLNKLNPYENTNTYPAM 281
                   G    N   +        NNL  V            ++      NT     M
Sbjct: 252 P---YDYSG----NSPDLTAPWCAEGNNLAIVPHSSDADYLSDVIDSFEAQGNTAIDLGM 304

Query: 282 HH-------AYRELYNEKESSHNTIGSTRLK---------KFVIFITDGENS 317
                    A R +  + ++      S R +         KFV+ +TDGEN+
Sbjct: 305 KWGLALLDPAARPVIGDMQADGLVPSSARYRPSDYGTQTMKFVVVMTDGENT 356


>gi|315444579|ref|YP_004077458.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
 gi|315262882|gb|ADT99623.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
          Length = 335

 Score = 66.1 bits (159), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 69/185 (37%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ ++KL   + T T   + 
Sbjct: 124 EAAKQFADQLTPGINLGLIAY-AGTATVLVSPTTNR-ESTKTAIDKLQLADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       V+ ++DG+ +  S   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDEPPPARVVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +V+                 P + + L +    S G+ F  +   +L + F  + ++I 
Sbjct: 240 STVSFGTPYGYVEINEQRQPVPVDDEMLKKIADLSGGEAFTASSLEQLKQVFTNLQEQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|169338033|ref|ZP_02621346.2| von Willebrand factor type A domain protein [Clostridium botulinum
           C str. Eklund]
 gi|169295279|gb|EDS77412.1| von Willebrand factor type A domain protein [Clostridium botulinum
           C str. Eklund]
          Length = 1242

 Score = 66.1 bits (159), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 57/374 (15%), Positives = 123/374 (32%), Gaps = 70/374 (18%)

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
           + +      I Q   + I   +N+  +          +P        +  S   N  ++ 
Sbjct: 14  TLLLSTIFTITQLITVPIFAVENDKNENKLLEVTSNLVPNRKNKTYEVGESFDINYEIKP 73

Query: 136 TGIIERS------SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
             I ++       S+     I +V+D S SME L   +  D +N    K       K   
Sbjct: 74  KDINKKEYDEWYKSKEKKKEIVLVMDTSTSMECLVEPESYDIDNCVPTKEGHIVYIKNKS 133

Query: 190 WSKNT---------------TKSKYAPAPAPANRK-----IDVLIESAGNLVNSIQKAIQ 229
           +  NT                 + Y        R+      + L  +  + +  +QK   
Sbjct: 134 YLVNTAFLQGSRHKLFYITIGTTNYYIQGNKCYRQSSYNEKNRLQHAKESAIKFVQKFEN 193

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRE 287
           +K    + IG ++++     N    +++ LNEV+  +N L       TN    +  A + 
Sbjct: 194 DKN---ISIGLVSFD--TTANSQKDITSKLNEVEDSINSLKVADNGATNIEAGLKSAQQL 248

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDG----------------------ENSGASAYQNT 325
           L           G+    K+VI ++DG                      +N+  +     
Sbjct: 249 L---------KKGNKDADKYVILMSDGFPTAFDYAGEKVEKNFNYHEIQDNTFINFGYYD 299

Query: 326 LN------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
            +      ++     ++  G+  + +  S     + L      + G++    ++  L  +
Sbjct: 300 YSGYAMKHSINQANSLKKDGINSFIIGFSEGANSEKLNNIAKAAGGEYEEAKNTDTLNGA 359

Query: 380 FDKITDKIQEQSVR 393
           +DK+  K++   ++
Sbjct: 360 YDKLETKVKAPLIK 373



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 56/152 (36%), Gaps = 20/152 (13%)

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG---IV 248
                +K          ++D + + A + V+  +       + +  I  + Y+     ++
Sbjct: 707 YYVKDNKVYEFNEKDRSRLDSVKKVANDFVDKFK------NDENTEIAIVRYSSKANIVL 760

Query: 249 GNQCTPLSNNLNE--VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
                   N  +   +K R+N L     TN    +  +Y  L    + S         +K
Sbjct: 761 DGSNKIFLNGKDNEIIKKRINSLKADGGTNIGDGIRKSYSILDKCDKDS---------EK 811

Query: 307 FVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
           ++I +TDG  +  + Y NT+     C+Y ++ 
Sbjct: 812 YMILMTDGVPTAYTCYANTIKASNNCKYSKDN 843


>gi|163848731|ref|YP_001636775.1| von Willebrand factor type A [Chloroflexus aurantiacus J-10-fl]
 gi|163670020|gb|ABY36386.1| von Willebrand factor type A [Chloroflexus aurantiacus J-10-fl]
          Length = 845

 Score = 66.1 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 104/297 (35%), Gaps = 35/297 (11%)

Query: 93  ITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIE-------RSSEN 145
           +  D       + E  +  E+P     L       L ++      + +         SE 
Sbjct: 295 VLADALRRADMVIERSSASELPANLDLLTRFDGFVLVDVPATQLSLEQMVALREVVRSEG 354

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             ++   V+  ++S       +    + +       P P +             + +   
Sbjct: 355 KGLT---VIGGNQSFTLGGYAETPLADALPLLMTPPPRPQRAPVSILFIIDRSASMSATF 411

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV-GNQCTPLSNNLN--EV 262
              K D+  E+A   + ++Q           R+G +A++   +       +   ++  E+
Sbjct: 412 GISKFDMAKEAAILSLTTLQ--------PGDRVGVLAFDTETIWTVPFRTVGEGVSLVEL 463

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           + ++  ++    TN   A+      L NE  S+          +  + +TDG +   +  
Sbjct: 464 QDQIATMSLGGGTNIERALSVGLPALANEPYST----------RHAVLLTDGRSYSNNYP 513

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
           +      Q+ E  R A + + ++A+ +  + + L +  +  +G+++ V D+ +L   
Sbjct: 514 R----YQQLVETARAAQITLSTIAIGSDSDTELLNQLASWGNGRYYFVADATDLPRI 566


>gi|318604213|emb|CBY25711.1| protein TadG, associated with Flp pilus assembly [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 457

 Score = 66.1 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 57/432 (13%), Positives = 136/432 (31%), Gaps = 87/432 (20%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           II       I    +++H +  + ++  A++ A L+     + +  I D   +    + +
Sbjct: 31  IIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALT---IENNEIPDEPQQIKN-NAL 86

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY--EIPTENLFLK 121
               +  +L    ++                 D  + L+Y A     Y  +  +++ F  
Sbjct: 87  VLSYVNAYLPSKKFLVPIIN----------INDNTHYLEYNAAVTMAYPAKFLSQSPFTN 136

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN---------- 171
            +    +T+  +        +SE     +  V D S SM   + +    +          
Sbjct: 137 TISDMNITDNGVAIKNKAIEASE--PTDVIFVADYSGSMLYNFNENKPRDHERIDALRSA 194

Query: 172 ---------NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                    +N   N     P    +       + +      P + KI       GN ++
Sbjct: 195 FRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPK---GNYLS 251

Query: 223 SIQKAIQEKKNLSVRIG----------TIAYNIGIVGNQCTPLSNN---LNEVKSR---- 265
              K       L   IG          +I  N   +    + +      L    +     
Sbjct: 252 DEIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGDVCLQGSNAYSLEQ 311

Query: 266 ---------LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
                    + ++ P+  T     +  A     N+ ++ H        KK +I ++DG +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNLFKNKAKNGH--------KKLMIILSDGVD 363

Query: 317 SGASAYQNTLNTLQ------ICEYMRNAGMKIYSVAVS-APPEGQDL-----LRKCTDSS 364
           +        +   +      +CE ++   +++  +A++ +P   ++       +KC    
Sbjct: 364 TDDFPSSKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GE 422

Query: 365 GQFFAVNDSREL 376
             ++  +++ EL
Sbjct: 423 DNYYEAHNAHEL 434


>gi|219683166|ref|YP_002469549.1| FctX [Bifidobacterium animalis subsp. lactis AD011]
 gi|219620816|gb|ACL28973.1| FctX [Bifidobacterium animalis subsp. lactis AD011]
          Length = 879

 Score = 66.1 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/421 (10%), Positives = 113/421 (26%), Gaps = 96/421 (22%)

Query: 46  SDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA 105
           S  +            ++        +  G          A   Q   T D         
Sbjct: 11  SGASDHAGRKGARPLRSVLASLCAVAMSLGMASAS-VAAFADDRQPAATADPQAATASAG 69

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
              A       +        +   ++ +          + + + I +VLDVS SM +L  
Sbjct: 70  NVDAPQHTKRISKNDD---GTYTLSMDVTGKSDESTEQQVVPLDIALVLDVSGSMNELSG 126

Query: 166 Q--------------------------------------KHNDNNNMTSNKYLLPPPPKK 187
           +                                          + +    KY +      
Sbjct: 127 KLVYNEVELLSMNPISTYYVEKDGSYQAVRCSAISWGRCTTWQDQDSAGQKYTVTYNWIG 186

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL------------- 234
              +  +   ++  +      ++D L ++    ++ ++   Q   +              
Sbjct: 187 GPSASVSPDVQFYKSKQSEETRLDALKDAVTYFLDQVEDQNQRINDPGKKVQVALIKYAG 246

Query: 235 --SVRIGTIAYN----IGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAY 285
             S +IG   YN              L+    +L + ++ +N L     T     + HA 
Sbjct: 247 KNSDKIGNDTYNEDGYNYNYSQTVHSLAWTPEDLQKEQAAVNSLKAGGATRADFGLQHAV 306

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ--NTLNTLQICEYMRNAGMKIY 343
           ++L + +  +         +K  +F +DG  + +  ++     N ++    ++N   ++ 
Sbjct: 307 KQLNSGRPGA---------QKLTVFYSDGSPTSSDGFEAKIANNAIKAAAQLKNDHSQVI 357

Query: 344 SVAVS------APPEGQDLLRKCTDS--------------SGQFFAVNDSR-ELLESFDK 382
           S+                 +   + +               G ++    +R +L   F +
Sbjct: 358 SIGAMPGADPSGTDNANKFMNYVSSNYPKAQSMSEPHDRVEGTYYYAVSARTDLQTIFKE 417

Query: 383 I 383
           I
Sbjct: 418 I 418


>gi|284166763|ref|YP_003405042.1| von Willebrand factor A [Haloterrigena turkmenica DSM 5511]
 gi|284016418|gb|ADB62369.1| von Willebrand factor type A [Haloterrigena turkmenica DSM 5511]
          Length = 853

 Score = 66.1 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 48/292 (16%), Positives = 98/292 (33%), Gaps = 68/292 (23%)

Query: 142 SSENLAISICMVLDVSRSME------------DLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
           S     + +  VLD S SM             D  +    +   + +++        KS 
Sbjct: 546 SDTRPPVDVTFVLDRSGSMGPHNPTSWSAYEPDYEIDIGEEWEPIPTDEPFRNTHDWKSI 605

Query: 190 WSKNTTKS-------------------------------KYAPAPAPANRKIDVLIESAG 218
             ++   +                                    P P N   +  +E+  
Sbjct: 606 QVRDDDGTIRTLEHRDFVHPDDWTEIRVHPYHQFGYIPGSIGIYPHPGNDPTNQRVEATR 665

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
           N+++ +     +      R+G   Y+    G    PLS++L   K  +     Y  TN  
Sbjct: 666 NVIDEL-----DPSAD--RVGV--YDFASSGRALHPLSDDLESAKESVVG-TAYGGTNMA 715

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
             +  A           + T G+   ++ VI ++DG+NS  +  +      ++ +   + 
Sbjct: 716 AGLEAALN--------DYATRGTDDRERIVILLSDGKNSNTANDER---MDELADRSDDL 764

Query: 339 GMKIYSVAVSAPPEGQ----DLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
              +++V + A          L    T++ G ++   D  ELL+ F++I D+
Sbjct: 765 DYTLHTVGLDALEHDSIPEDKLEGWATETGGNYYQTADPDELLDLFEEIVDE 816


>gi|86131264|ref|ZP_01049863.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
 gi|85818675|gb|EAQ39835.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
          Length = 334

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 53/324 (16%), Positives = 101/324 (31%), Gaps = 95/324 (29%)

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
           Q   + I+  K          K +  +    L    LI  AL     R+  +  ++    
Sbjct: 33  QTPAVKISSIKGFKTSTSILPKLRPLLFILRLAALSLIIVAL--ARPRNVEVSTKTKTTK 90

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I + +DVS SM                                         A    
Sbjct: 91  GIDIVIAIDVSASML----------------------------------------AKDLR 110

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++ L + A + +N          +   RIG + Y         TP++++ + V S L
Sbjct: 111 PNRLEALKKVASSFIN------GRPND---RIGLVEYAGESFTK--TPITSDKSIVLSAL 159

Query: 267 NKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
             +         T     +      +            S  L K +I +TDGEN+     
Sbjct: 160 KGIQYNSIIEGGTAIGMGLATGVNRI----------KDSKALSKVIILMTDGENNAGQ-- 207

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEG----------------------QDLLRKC 360
              ++     E  +  G+K+Y++ +                            ++LL + 
Sbjct: 208 ---IDPRIAAELAQEFGIKVYTIGMGTNGTALSPYARNPNGTFVYENIQVTIDEELLEEI 264

Query: 361 T-DSSGQFFAVNDSRELLESFDKI 383
              + GQ+F   ++++L E +D+I
Sbjct: 265 AETTGGQYFRATNNKKLQEIYDEI 288


>gi|2811055|sp|O07395|Y335_MYCAV RecName: Full=UPF0353 protein MAV335
 gi|2183263|gb|AAC46199.1| MAV335 [Mycobacterium avium]
          Length = 335

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 79/235 (33%), Gaps = 27/235 (11%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              +N   +P          + ++S  A   AP   ++    E+A    + +   I    
Sbjct: 84  AGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAP--NRMAAAQEAAKQFADELTPGIN--- 138

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                +G IAY  G      +P +N     K+ L+KL   + T T   +  A  ++    
Sbjct: 139 -----LGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEGIFTA-LQVQAIA 190

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS---- 348
                  G       ++  +DG+ +  +   N           ++ G+ I +++      
Sbjct: 191 TVGAVIAGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPISTISFGTPYG 250

Query: 349 ----------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                      P + + L +    S G  +     +EL   +  +  +I  ++++
Sbjct: 251 FVEINDQRQPVPVDDETLKKVAQLSGGNAYNARSLQELKSVYATLQQQIGYETIK 305


>gi|307720603|ref|YP_003891743.1| von Willebrand factor A [Sulfurimonas autotrophica DSM 16294]
 gi|306978696|gb|ADN08731.1| von Willebrand factor type A [Sulfurimonas autotrophica DSM 16294]
          Length = 310

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 39/244 (15%), Positives = 81/244 (33%), Gaps = 64/244 (26%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
                I ++LD S SM                                   K +      
Sbjct: 81  KHGHEIALILDASGSM-----------------------------------KERGFDPVN 105

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           PA  + DV+     + ++          +    +G + +         +PL+ + + +  
Sbjct: 106 PAASRFDVVKSIVKDFISQ------RTNDN---MGLVVFGSYSFI--ASPLTYDKHILSR 154

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            +++L      + T  Y A+      L            S    K  I +TDG    ++A
Sbjct: 155 IVSQLEVGMAGKYTALYEALAQGVNLL----------KMSKAKSKVAILLTDG---YSTA 201

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD--LLRKCTDSSGQFFAVNDSRELLES 379
             + +    + +  +  G+K+Y + +  P E     LL+   ++ G  F  +++ +L E 
Sbjct: 202 GADKIPLDVVLDMAKKEGVKVYPIGIGGPDEYNRAVLLKIAKETGGVAFGASNASQLKEV 261

Query: 380 FDKI 383
           + KI
Sbjct: 262 YKKI 265


>gi|289177626|gb|ADC84872.1| Collagen adhesion protein [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 905

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/421 (10%), Positives = 113/421 (26%), Gaps = 96/421 (22%)

Query: 46  SDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA 105
           S  +            ++        +  G          A   Q   T D         
Sbjct: 37  SGASDHAGRKGARPLRSVLASLCAVAMSLGMASAS-VAAFADDRQPAATADPQAATASAG 95

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
              A       +        +   ++ +          + + + I +VLDVS SM +L  
Sbjct: 96  NVDAPQHTKRISKNDD---GTYTLSMDVTGKSDESTEQQVVPLDIALVLDVSGSMNELSG 152

Query: 166 Q--------------------------------------KHNDNNNMTSNKYLLPPPPKK 187
           +                                          + +    KY +      
Sbjct: 153 KLVYNEVELLSMNPISTYYVEKDGSYQAVRCSAISWGRCTTWQDQDSAGQKYTVTYNWIG 212

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL------------- 234
              +  +   ++  +      ++D L ++    ++ ++   Q   +              
Sbjct: 213 GPSASVSPDVQFYKSKQSEETRLDALKDAVTYFLDQVEDQNQRINDPGKKVQVALIKYAG 272

Query: 235 --SVRIGTIAYN----IGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAY 285
             S +IG   YN              L+    +L + ++ +N L     T     + HA 
Sbjct: 273 KNSDKIGNDTYNEDGYNYNYSQTVHSLAWTPEDLQKEQAAVNSLKAGGATRADFGLQHAV 332

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ--NTLNTLQICEYMRNAGMKIY 343
           ++L + +  +         +K  +F +DG  + +  ++     N ++    ++N   ++ 
Sbjct: 333 KQLNSGRPGA---------QKLTVFYSDGSPTSSDGFEAKIANNAIKAAAQLKNDHSQVI 383

Query: 344 SVAVS------APPEGQDLLRKCTDS--------------SGQFFAVNDSR-ELLESFDK 382
           S+                 +   + +               G ++    +R +L   F +
Sbjct: 384 SIGAMPGADPSGTDNANKFMNYVSSNYPKAQSMSEPHDRVEGTYYYAVSARTDLQTIFKE 443

Query: 383 I 383
           I
Sbjct: 444 I 444


>gi|282863310|ref|ZP_06272369.1| von Willebrand factor type A [Streptomyces sp. ACTE]
 gi|282561645|gb|EFB67188.1| von Willebrand factor type A [Streptomyces sp. ACTE]
          Length = 624

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/276 (13%), Positives = 89/276 (32%), Gaps = 69/276 (25%)

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
           + +        +   +++   S+ MVLD S SM +                         
Sbjct: 7   VLSAGALPVAAVPAVTDDAGGSLVMVLDSSGSMGE------------------------- 41

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI---AYN 244
                              + +++    + G +V+++         +    G        
Sbjct: 42  --------------DDGTGSTRMESARRAVGAVVDALPDGYPTGLRVY---GADRPQGCA 84

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
              +     PL  +   VKS +  + P  +T    ++  A  +L   ++ +  T      
Sbjct: 85  DTRLVRPVRPL--DRAAVKSAVAGVRPTGDTPIGLSLRKAAEDLPAPRDGAART------ 136

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYM-----RNAGMKIYSVAVSAPPEGQDLLRK 359
            + ++ ++DGE        +T  T   CE       + AG++I +V        ++ L  
Sbjct: 137 -RTIVLVSDGE--------DTCGTPPPCEVAARLAGQGAGLRIDTVGFQVKGAAREQLEC 187

Query: 360 CTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             ++  G+++   D+  L     + + ++     R+
Sbjct: 188 VAEAGNGRYYDAPDADALARQLLR-SAQLSASGYRL 222


>gi|90417299|ref|ZP_01225225.1| batB protein, putative [marine gamma proteobacterium HTCC2207]
 gi|90330884|gb|EAS46147.1| batB protein, putative [marine gamma proteobacterium HTCC2207]
          Length = 330

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 44/258 (17%), Positives = 80/258 (31%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            I + +D+S SME   +Q      N                                   
Sbjct: 91  DILLAVDISGSMEREDMQLSGQTVN----------------------------------- 115

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +    GN V               R+G I +         TPL+ +   +++ L +
Sbjct: 116 RLMAVKAVVGNFVTE---------REGDRLGLILFGEKAYLQ--TPLTFDRKTMQTLLYE 164

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T    A+  + + L    E+           + VI +TDG N+        
Sbjct: 165 AQLGFAGNGTAIGDAIGLSVKRLQQRPEN----------HRVVILLTDGANNAG-----E 209

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ L+  E   +A +KIY++ V A                    + Q L      + GQ+
Sbjct: 210 LDPLKAAELASSAKVKIYTIGVGAETQEAWGLFGKRVTNPSADLDEQTLTAIAEATGGQY 269

Query: 368 FAVNDSRELLESFDKITD 385
           F   +  EL+  + ++  
Sbjct: 270 FRARNPEELMAIYQELNR 287


>gi|327193254|gb|EGE60160.1| hypothetical protein RHECNPAF_1700073 [Rhizobium etli CNPAF512]
          Length = 457

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 60/352 (17%), Positives = 117/352 (33%), Gaps = 46/352 (13%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A+ +    + +  + D      +R +MQS LDAA+++    I      +D    K +   
Sbjct: 45  ALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQI---NNSEDTDALKQKVYD 101

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
            F  Q++     G              +I I    +N       + A   +PT       
Sbjct: 102 WFHAQVENSYALG--------------EIEIDTTNHN-----ITATASGTVPT------T 136

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +  A  +    S G   +      +++ +V+D S SM                      
Sbjct: 137 FMKIANIDTVPVSVGSAVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFAC 196

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                    K T  + Y  +     + I +  + AG+ V  +   I E  +   RI    
Sbjct: 197 HTGDAHTVGKKTYANNYDYST---EKNIKLRADVAGDAVREVLDMIDESDSNHERIKVGL 253

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK-----ESSHN 297
           Y++G    +    + + +  + RL+  + Y  T+   +M++ Y ++          +  +
Sbjct: 254 YSLGDTTKEVLAPTLDTSNARKRLSD-DSYGLTSAT-SMNYTYFDVALAALQKIVGTGGD 311

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ--------ICEYMRNAGMK 341
              S    K V+ +TDG  S         + L+         C Y++N    
Sbjct: 312 GTSSANPLKLVLLLTDGVQSQRGWVVKNSSNLKKVAPLNPDWCGYVKNKSAT 363


>gi|302870768|ref|YP_003839404.1| von Willebrand factor type A [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302573627|gb|ADL41418.1| von Willebrand factor type A [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 900

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 80/261 (30%), Gaps = 64/261 (24%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
           L     I+   +   I + +VLD S SM D                              
Sbjct: 391 LPVKMEIKNKEKEKNIDVVLVLDHSGSMADTEDA-------------------------- 424

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
                           K+++   ++  ++  ++ +          +G IA++        
Sbjct: 425 -------------GISKLEIAKSASAKMIEHLESSDG--------VGVIAFDHNYYWAYE 463

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFIT 312
                   +V   ++ +     T   P +  A + L   K  S            ++ +T
Sbjct: 464 FSKLVRKKDVIESISSIEVGGGTAIIPPLSEAVKTLKKSKAKSKL----------IVLLT 513

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           DG                     +   +KI ++ V        L    + +SG+F+ V++
Sbjct: 514 DG-------MGEQGGYEIPANEAKRNNIKITTIGVGKFVNLPVLSWIASFTSGRFYLVSN 566

Query: 373 SRELLESFDKITDKIQEQSVR 393
             EL++ F K T  I+ + ++
Sbjct: 567 PYELVDVFLKETKIIKGKYMK 587


>gi|188578240|ref|YP_001915169.1| von Willebrand factor type A domain protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188522692|gb|ACD60637.1| von Willebrand factor type A domain protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 335

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 43/254 (16%), Positives = 86/254 (33%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 101 MMLAVDLSGSMNE--------------------------------------PDMVLGGKV 122

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L   
Sbjct: 123 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLRDS 174

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 175 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 219

Query: 327 NTLQICEYMRNAGMKIYSVAVSA-----------PPEGQD------LLRKCTDSSGQFFA 369
           + L+  E  +  G++IY++A              P  G D      L +    + G+FF 
Sbjct: 220 DPLKAAELAKAEGVRIYTIAFGGGGGYSLFGVPIPAGGNDDIDEDGLRKIAQQTGGRFFR 279

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 280 ARDTEELAGIYAEL 293


>gi|149911739|ref|ZP_01900346.1| von Willebrand factor type A domain protein [Moritella sp. PE36]
 gi|149805212|gb|EDM65230.1| von Willebrand factor type A domain protein [Moritella sp. PE36]
          Length = 330

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/255 (14%), Positives = 77/255 (30%), Gaps = 82/255 (32%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+SRSM+   +Q +N                                       +
Sbjct: 87  MMLAVDLSRSMQAEDMQINNRMV-----------------------------------DR 111

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           + ++     + +   +           R+G I +          PL+ +L  V   + + 
Sbjct: 112 LSLVKTVVADFIQQRKG---------DRVGLIFFADNAYLQA--PLTFDLKTVSGYMQQA 160

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                 E T     +  A +                  +K +I +TDG+NS        +
Sbjct: 161 VLGLVGEQTAIGEGIGLALKRFDAA----------DNPQKVLILLTDGQNSAG-----EV 205

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLL------------------RKCTDSSGQFF 368
             L   ++ +  G+KIY++ V A    +  L                       + GQ+F
Sbjct: 206 KPLDAAKFAQEQGVKIYTIGVGADAYYKRTLFGNQKVDPSRDLDEVTLKTIAAQTGGQYF 265

Query: 369 AVNDSRELLESFDKI 383
              D+  L   + ++
Sbjct: 266 RARDASSLAAIYAEL 280


>gi|254875972|ref|ZP_05248682.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841993|gb|EET20407.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 339

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 87/260 (33%), Gaps = 81/260 (31%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
                + M +D+S SM    +QK N                                   
Sbjct: 95  QSGRDLMMAIDLSGSMAIQDMQKSN----------------------------------G 120

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
               + D+++  A   +++             R+G I +         TPL+ ++  VK 
Sbjct: 121 KMESRFDLVMRVANEFLDT---------RQGDRVGLILFGTWAYLQ--TPLTFDIPTVKK 169

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K ++ +TDGEN+    
Sbjct: 170 MLDDASIALPGPQTAIGDAIGLAVKKLKRYPGDS----------KALVLLTDGENNSG-- 217

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAV------------------SAPPEGQDLLRKCTDS 363
               L  LQ  E  +   +KIY++ +                  S   + + L +  T +
Sbjct: 218 ---ALQPLQAAELAKQYHIKIYTIGLGGGQMMVKTTFGERLVNTSEDLDTEVLQKIATMT 274

Query: 364 SGQFFAVNDSRELLESFDKI 383
            G+FF   +S +L + ++ I
Sbjct: 275 GGKFFRAQNSTDLKQVYESI 294


>gi|241667423|ref|ZP_04755001.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 333

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 87/260 (33%), Gaps = 81/260 (31%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
                + M +D+S SM    +QK N                                   
Sbjct: 89  QSGRDLMMAIDLSGSMAIQDMQKSN----------------------------------G 114

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
               + D+++  A   +++             R+G I +         TPL+ ++  VK 
Sbjct: 115 KMESRFDLVMRVANEFLDT---------RQGDRVGLILFGTWAYLQ--TPLTFDIPTVKK 163

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K ++ +TDGEN+    
Sbjct: 164 MLDDASIALPGPQTAIGDAIGLAVKKLKRYPGDS----------KALVLLTDGENNSG-- 211

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAV------------------SAPPEGQDLLRKCTDS 363
               L  LQ  E  +   +KIY++ +                  S   + + L +  T +
Sbjct: 212 ---ALQPLQAAELAKQYHIKIYTIGLGGGQMMVKTTFGERLVNTSEDLDTEVLQKIATMT 268

Query: 364 SGQFFAVNDSRELLESFDKI 383
            G+FF   +S +L + ++ I
Sbjct: 269 GGKFFRAQNSTDLKQVYESI 288


>gi|146298482|ref|YP_001193073.1| von Willebrand factor, type A [Flavobacterium johnsoniae UW101]
 gi|146152900|gb|ABQ03754.1| BatA-like protein [Flavobacterium johnsoniae UW101]
          Length = 334

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 40/284 (14%), Positives = 81/284 (28%), Gaps = 93/284 (32%)

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
           I  ++     I I M +DVS SM                                     
Sbjct: 82  ISNQTKTTKGIDIVMAIDVSGSML------------------------------------ 105

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
               A      +++ L   A + V           +   RIG + Y         TP+++
Sbjct: 106 ----AKDLKPNRMEALKRVAADFVEE------RPND---RIGLVLYASEAYTK--TPVTS 150

Query: 258 NLNEVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           +   +   +  +       + T     +  A   L            S    + +I +TD
Sbjct: 151 DKPIILEAIKGIRYDTVLQDGTGIGMGLATAVNRL----------KDSKAKSRVIILLTD 200

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------APPEG--------- 353
           G N+        +      +  +  G+K+Y++ +            AP  G         
Sbjct: 201 GVNNAGF-----IEPETAADIAKQYGIKVYTIGLGTNGMAESPYAYAPNGGFLFKMQKVE 255

Query: 354 --QDLLRKCT-DSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
             + L++     + G +F    + +L E ++ I      +   +
Sbjct: 256 IDERLMKSIAKKTDGTYFRATSNDKLAEIYNSINKLETTEIQEL 299


>gi|167626845|ref|YP_001677345.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167596846|gb|ABZ86844.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 333

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 54/294 (18%), Positives = 101/294 (34%), Gaps = 85/294 (28%)

Query: 115 TENLFLKGLIPSALTNLSLRSTGI----IERSSENLAISICMVLDVSRSMEDLYLQKHND 170
           T+  +LK ++ +    L +  +GI       S       + M +D+S SM    +QK N 
Sbjct: 55  TKANYLKYILSAIWILLIISGSGIQWLGKPVSLPQSGRDLMMAIDLSGSMAIQDMQKSN- 113

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                                                 + D+++  A   +++       
Sbjct: 114 ---------------------------------GKMESRFDLVMRVANEFLDT------- 133

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRE 287
                 R+G I +         TPL+ ++  VK  L+  +   P   T    A+  A ++
Sbjct: 134 --RQGDRVGLILFGTWAYLQ--TPLTFDIPTVKKMLDDASIALPGPQTAIGDAIGLAVKK 189

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
           L      S          K ++ +TDGEN+        L  LQ  E  +   +KIY++ +
Sbjct: 190 LKRYPGDS----------KALVLLTDGENNSG-----ALQPLQAAELAKQYHIKIYTIGL 234

Query: 348 ------------------SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                             S   + + L +  T + G+FF   +S +L + ++ I
Sbjct: 235 GGGQMMVKTTFGERLVNTSEDLDTEVLQKIATMTGGKFFRAQNSADLKQVYESI 288


>gi|332706285|ref|ZP_08426352.1| hypothetical protein LYNGBM3L_16440 [Lyngbya majuscula 3L]
 gi|332354933|gb|EGJ34406.1| hypothetical protein LYNGBM3L_16440 [Lyngbya majuscula 3L]
          Length = 413

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 52/285 (18%), Positives = 105/285 (36%), Gaps = 70/285 (24%)

Query: 107 SKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ 166
            K        +  +    PS+   LS+  + I   SS N+ +++C+VLD S SM      
Sbjct: 1   MKVGLHPALNDTNIDANQPSSQRQLSMAISAIAASSSRNVPLNLCLVLDHSGSM------ 54

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                                                    + ++ + ++A  L+  +Q 
Sbjct: 55  ---------------------------------------HGQPLETVKQAAVGLIERLQ- 74

Query: 227 AIQEKKNLSVRIGTIAYNIGI-VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
                     R+  +A++    V  +  P+  NL+++K ++N+L     T     +    
Sbjct: 75  -------PDDRLSIVAFDHRAKVLVRNQPMG-NLDQIKRKINRLGADGGTAIDEGLKLGV 126

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +EL   K+ + +          V  +TDGEN       N  + +++ E      + I S+
Sbjct: 127 KELIKAKQDTVSQ---------VFLLTDGENEHG----NNESCIKLAELAAENNLTINSL 173

Query: 346 AVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQE 389
              A    QD+L K  D ++G    + +  + L  F ++ +++Q 
Sbjct: 174 GFGANWN-QDILEKIADIATGSLSYIEEPEQALSEFARLFNRMQS 217


>gi|325954650|ref|YP_004238310.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
 gi|323437268|gb|ADX67732.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
          Length = 338

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 66/180 (36%), Gaps = 39/180 (21%)

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
           K+  + R+G ++Y+   +     PL+ +   +   +N L      + T     +  A   
Sbjct: 125 KERQADRLGLVSYSGEALTR--VPLTTDREVLIREINALESGELEDGTAIGIGLATAINH 182

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
           +            S    K +I +TDG E+   +     ++     E   + G+K+Y++ 
Sbjct: 183 I----------KDSKAKSKVIILMTDGVESINPTNDLMYISPQTAAEMATSRGIKVYTIG 232

Query: 347 V---------------------SAPPE-GQDLLRKCTD-SSGQFFAVNDSRELLESFDKI 383
           +                       P +  + LL+   D + G +F   D++ L + + +I
Sbjct: 233 IGTRGLAPFPTAYDMYGNYIFDMMPVDIDEKLLQNIADLTGGLYFRATDNQSLQKIYQEI 292


>gi|297560911|ref|YP_003679885.1| von Willebrand factor type A [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296845359|gb|ADH67379.1| von Willebrand factor type A [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 315

 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 66/199 (33%), Gaps = 34/199 (17%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++   +SA   V ++     ++ N+    G +A++           +++   V   + 
Sbjct: 106 NRLEAAKKSAQGFVETL----PDRFNV----GLVAFSSTATVVSSP--THDHQAVIGSIE 155

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     T     +  +   + +  E +            ++ ++DGEN+      +  +
Sbjct: 156 NLQLGPGTAIGEGVFASLESISSFDEDA----DVDPPPSAIVLLSDGENT------SGRD 205

Query: 328 TLQICEYMRNAGMKIYSVAV------------SAPPE-GQDLLRKCTDS-SGQFFAVNDS 373
             Q         + + ++A               P +  ++ LR       G F+     
Sbjct: 206 ISQAVAMAAEQEVPVSTIAFGTGAAMIEIDGYQVPADIDKEALRGLASDTGGHFYEAESE 265

Query: 374 RELLESFDKITDKIQEQSV 392
            EL E ++ I   +  + V
Sbjct: 266 TELDEVYEDIGSSLGTELV 284


>gi|313139523|ref|ZP_07801716.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132033|gb|EFR49650.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 835

 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 45/341 (13%), Positives = 109/341 (31%), Gaps = 90/341 (26%)

Query: 84  DIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS 143
           D A    +++ +     +     +  +Y    +         +   +L++  T      +
Sbjct: 231 DSATTEPVSVGEVPRITVTNTVVTAPRYRKYIKANND----GTYDLSLNVTGTQSGSSQT 286

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
                 I +V D S SM +                                        P
Sbjct: 287 TVSPADIVVVFDTSGSMSN----------------------------------------P 306

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
              N +++V   +  ++   +  +  + K+ ++R+  + ++  +     +  ++N  ++ 
Sbjct: 307 MGHNSRLEVAKTAVNSMAQHLLTSENQGKDSNIRMALVPFSTTVGN--VSNFTDNAMDIV 364

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS------ 317
           S +N L     TN        +     +  ++  T G   +KK+++F++DG+ +      
Sbjct: 365 SAVNGLRADGGTN--------WEA-ALKAANAKLTSGRKGVKKYIVFMSDGDPTFRTSSV 415

Query: 318 --------------------------GASAYQNTLNTLQICEYMRNAG-MKIYSVAVSAP 350
                                       S+ Q   N           G   ++SV VS+ 
Sbjct: 416 RTGTDWWGRPTYDDDDRRGLPAGVHGSGSSDQYGANLSSAVAEANRRGDATLFSVGVSSD 475

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           P    +      + G +++   + EL ++F  I  +I  +S
Sbjct: 476 PT--KMRGFADQTKGSYYSATSTDELNKAFADIIGQINRKS 514


>gi|301058342|ref|ZP_07199375.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
 gi|300447578|gb|EFK11310.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
          Length = 331

 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 91/273 (33%), Gaps = 86/273 (31%)

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             + I + LD S SM                                   ++        
Sbjct: 85  PGVDIMLCLDTSGSM-----------------------------------QALDFKVEGK 109

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
           +  +++ + +   + +          K  + RIG + +         +PL+ +   +   
Sbjct: 110 SVTRLEAVKKVVADFIG---------KRETDRIGLVVFGEEAFTQ--SPLTIDKGLLLEL 158

Query: 266 LNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           +N++      + T    A+    + L + K  S          K +I +TDG N+     
Sbjct: 159 VNRMKIGMAGDRTAIGSAIAIGGKRLKDLKSKS----------KILILLTDGRNNAG--- 205

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVS----APPEGQDL----------------LRKCT- 361
              ++       +R  G+K+Y++ V     AP   + L                LR    
Sbjct: 206 --EISPQAAARAVREFGIKLYTIGVGGKGPAPFRMKTLFGTRLVPQHVDLDEVTLRNVAK 263

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
              G++F   +S+EL E +D I D+ ++  V++
Sbjct: 264 TGGGKYFRAANSQELQEIYDII-DRAEKTDVKV 295


>gi|254820233|ref|ZP_05225234.1| hypothetical protein MintA_09911 [Mycobacterium intracellulare ATCC
           13950]
          Length = 339

 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 63/200 (31%), Gaps = 26/200 (13%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            ++    E+     + +  AI         +G + +          P + N   VKS ++
Sbjct: 121 NRLAAAKEAGKQFADQLTPAIN--------LGLVEFAANATL--LVPPTTNRGAVKSGID 170

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L P   T T   +  A + +           G       ++  +DG  +          
Sbjct: 171 SLQPAPKTATGEGIFTALQAIATVGSVMGG--GEGPPPARIVLESDGAENVPLDPNAPQG 228

Query: 328 TLQICEYMRNAGMKIYSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDS 373
                   +  G++I +++                 P + Q L + C  + G+ F  +  
Sbjct: 229 AFTAARAAKGQGVQISTISFGTPYGTVDYEGATIPVPVDDQTLQKICEITDGEAFHADSL 288

Query: 374 RELLESFDKITDKIQEQSVR 393
             L   +  +  +I  ++V+
Sbjct: 289 DSLKNVYTTLQRQIGYETVK 308


>gi|42524204|ref|NP_969584.1| hypothetical protein Bd2794 [Bdellovibrio bacteriovorus HD100]
 gi|39576412|emb|CAE80577.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 336

 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 67/202 (33%), Gaps = 46/202 (22%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++   E+    +++           S RIG + +           L  +   +  R+N
Sbjct: 109 NRLEAAKETIAKFISA---------RTSDRIGLVVFAGESFTMVPPTL--DYQMILQRVN 157

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
           +++   +                   ++     S    + +IF+TDGEN+       T++
Sbjct: 158 EISSASSAKIKDGTALG----VAMANAAGRLKDSQARSRVMIFMTDGENNSG-----TID 208

Query: 328 TLQICEYMRNAGMKIYSVAVS-------------------------APPEGQDLL-RKCT 361
                E  +  G+K+YS+ +                               +DLL R  +
Sbjct: 209 PETGLEIAKGYGIKVYSIGIGKDGPTRIPVYSRDIFGQKVKTYQPFESTVNEDLLGRMAS 268

Query: 362 DSSGQFFAVNDSRELLESFDKI 383
           D+ G+++       L + F  I
Sbjct: 269 DTGGKYYRATTEGALQKVFSDI 290


>gi|305665951|ref|YP_003862238.1| BatA protein [Maribacter sp. HTCC2170]
 gi|88710726|gb|EAR02958.1| batA protein [Maribacter sp. HTCC2170]
          Length = 332

 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 53/329 (16%), Positives = 98/329 (29%), Gaps = 99/329 (30%)

Query: 85  IAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG--IIERS 142
             Q A + I+  K      I       +I       + L  +++     R     I  R+
Sbjct: 31  REQTASLKISSLKGFSKSSILP-----KIKPLLFVFRILALASIIVAMARPQTEDISTRT 85

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
                I I M +DVS SM    L+ +                                  
Sbjct: 86  KTTKGIDIVMAIDVSSSMLARDLKPN---------------------------------- 111

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
                 ++  L E A + +           +   RIG +AY         TP++++ + V
Sbjct: 112 ------RLSALKEVAADFIRQ------RPND---RIGLVAYAGEAFTK--TPITSDKSIV 154

Query: 263 KSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            + L ++      + T     +  +   L            S  + K +I +TDG N+  
Sbjct: 155 LNSLREITYGQLNDGTAIGMGLATSVNRL----------KESKAISKIIILLTDGVNNSG 204

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG----------------------QDLL 357
                T   L +       G+K Y++ +                            + LL
Sbjct: 205 FIEPQTAADLAV-----EYGIKSYTIGLGTNGNALSPIAYNADGSYRYGMRQVEIDEKLL 259

Query: 358 RKCT-DSSGQFFAVNDSRELLESFDKITD 385
                 + G++F   D+ +L   +D+I  
Sbjct: 260 EGIAETTGGKYFRATDNEKLEAIYDEINK 288


>gi|224282379|ref|ZP_03645701.1| hypothetical protein BbifN4_00972 [Bifidobacterium bifidum NCIMB
           41171]
          Length = 1153

 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 45/341 (13%), Positives = 109/341 (31%), Gaps = 90/341 (26%)

Query: 84  DIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS 143
           D A    +++ +     +     +  +Y    +         +   +L++  T      +
Sbjct: 549 DSATTEPVSVGEVPRITVTNTVVTAPRYRKYIKANND----GTYDLSLNVTGTQSGSSQT 604

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
                 I +V D S SM +                                        P
Sbjct: 605 TVSPADIVVVFDTSGSMSN----------------------------------------P 624

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
              N +++V   +  ++   +  +  + K+ ++R+  + ++  +     +  ++N  ++ 
Sbjct: 625 MGHNSRLEVAKTAVNSMAQHLLTSENQGKDSNIRMALVPFSTTVGN--VSNFTDNAMDIV 682

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS------ 317
           S +N L     TN        +     +  ++  T G   +KK+++F++DG+ +      
Sbjct: 683 SAVNGLRADGGTN--------WEA-ALKAANAKLTSGRKGVKKYIVFMSDGDPTFRTSSV 733

Query: 318 --------------------------GASAYQNTLNTLQICEYMRNAG-MKIYSVAVSAP 350
                                       S+ Q   N           G   ++SV VS+ 
Sbjct: 734 RTGTDWWGRPTYDDDDRRGLPAGVHGSGSSDQYGANLSSAVAEANRRGDATLFSVGVSSD 793

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           P    +      + G +++   + EL ++F  I  +I  +S
Sbjct: 794 PT--KMRGFADQTKGSYYSATSTDELNKAFADIIGQINRKS 832


>gi|307591433|ref|YP_003900232.1| von Willebrand factor type A [Cyanothece sp. PCC 7822]
 gi|306986287|gb|ADN18166.1| von Willebrand factor type A [Cyanothece sp. PCC 7822]
          Length = 491

 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 37/183 (20%), Positives = 71/183 (38%), Gaps = 19/183 (10%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            K+  +  +A + V       Q +  ++ RI  + +  G+     TPL++++N +++ + 
Sbjct: 67  NKLSEVKTAATSFV-------QRQDLITNRIAVMGFGSGV--QLGTPLTSDVNVLQTAIA 117

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     T    A+  A  +L+N   S  + I S    + ++  TDG         +  N
Sbjct: 118 NLYDGGGTMMDQALTAATDQLHNASASLESAIPSGE-NQHILLFTDG------VAADPYN 170

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           TL   +  +NA + I +VA        + L + T      F  N       +F      I
Sbjct: 171 TLVAGQTAQNAQINIVAVATGDADT--NFLSQLTGDPNLVFYANTGN-FDAAFQAAEKAI 227

Query: 388 QEQ 390
             +
Sbjct: 228 YSK 230


>gi|158425008|ref|YP_001526300.1| von Willebrand factor type A domain-containing protein
           [Azorhizobium caulinodans ORS 571]
 gi|158331897|dbj|BAF89382.1| von Willebrand factor type A domain protein [Azorhizobium
           caulinodans ORS 571]
          Length = 343

 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/252 (16%), Positives = 82/252 (32%), Gaps = 78/252 (30%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM                                   +   +    P +R
Sbjct: 92  DLMLAVDLSGSMS----------------------------------RQDLSYDNIPVDR 117

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-- 266
            + ++   A + +          K    RIG I ++         PL+ + N V+  L  
Sbjct: 118 -LTIIKGVADDFIA---------KRKGDRIGLILFSTRAYVQA--PLTFDRNVVRDLLRT 165

Query: 267 NKLNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           + +      T    A+  A + L    +           ++ ++ +TDG N+        
Sbjct: 166 SSIGMTGQETAIGDAIALAVKTLRTRPQE----------QRVLVLLTDGANNSGM----- 210

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAP--PEGQ------------DLLRKCTDSSGQFFAVN 371
           L+ +   E  +  G+KIY++ V A     GQ             L +    + G++F   
Sbjct: 211 LSPIPAAEIAKANGVKIYTIGVGADAFAVGQRMVNPSFDLDEGALEQIAQMTGGRYFRAR 270

Query: 372 DSRELLESFDKI 383
           D+  L   ++ I
Sbjct: 271 DAAGLAAIYNDI 282


>gi|108799422|ref|YP_639619.1| hypothetical protein Mmcs_2455 [Mycobacterium sp. MCS]
 gi|119868535|ref|YP_938487.1| hypothetical protein Mkms_2500 [Mycobacterium sp. KMS]
 gi|126435076|ref|YP_001070767.1| hypothetical protein Mjls_2492 [Mycobacterium sp. JLS]
 gi|122976988|sp|Q1B971|Y2455_MYCSS RecName: Full=UPF0353 protein Mmcs_2455
 gi|166987492|sp|A3PZE9|Y2492_MYCSJ RecName: Full=UPF0353 protein Mjls_2492
 gi|166987495|sp|A1UFT9|Y2500_MYCSK RecName: Full=UPF0353 protein Mkms_2500
 gi|108769841|gb|ABG08563.1| von Willebrand factor, type A [Mycobacterium sp. MCS]
 gi|119694624|gb|ABL91697.1| von Willebrand factor, type A [Mycobacterium sp. KMS]
 gi|126234876|gb|ABN98276.1| von Willebrand factor, type A [Mycobacterium sp. JLS]
          Length = 335

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 67/185 (36%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ ++KL   + T T   + 
Sbjct: 124 EASKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKTAIDKLQLADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       ++  +DG+ +  S   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + Q L +    S G+ F  +   +L E +  +  +I 
Sbjct: 240 STISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|167759260|ref|ZP_02431387.1| hypothetical protein CLOSCI_01607 [Clostridium scindens ATCC 35704]
 gi|167663134|gb|EDS07264.1| hypothetical protein CLOSCI_01607 [Clostridium scindens ATCC 35704]
          Length = 800

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/280 (15%), Positives = 91/280 (32%), Gaps = 54/280 (19%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
            L+L   G+ +  +    I + +++D S SM            N   +   +  P +   
Sbjct: 161 TLTLNVKGMYDSETTKPMIDVLLIVDKSGSM------------NWKMDTDKVGKPSRMDV 208

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
             +  T +         N +ID  +               +  +         Y+   + 
Sbjct: 209 LKQVVTGTGGLTDSIFGNTQIDAQMAVVTY------SGSNDFLDQR-------YDDAEII 255

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
            + T      + V + +N +     TN    +      L   +E++         KKFVI
Sbjct: 256 QEWTK---QKDTVNNAVNNIQAKGGTNCEAGLRTGATALEGSRENA---------KKFVI 303

Query: 310 FITDGENSG-----------ASAYQNTLNTLQICEYMRNAGMK-IYSVAVSAPPEGQDLL 357
           F++DG+ +             S    T     I +  +  G++  Y++         + L
Sbjct: 304 FLSDGDATFYYGDDGYTKGPGSGSSPTAREKAIAQVQKITGLEGFYTIG-MTSSSSSEFL 362

Query: 358 RKCT----DSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                    S  +F+  N++  L ++F +I  +  E   R
Sbjct: 363 TNLANNSKASEKRFYPANNTEALEKAFQEIVGETTEFICR 402


>gi|94969085|ref|YP_591133.1| von Willebrand factor, type A [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551135|gb|ABF41059.1| von Willebrand factor, type A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 349

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 82/219 (37%), Gaps = 33/219 (15%)

Query: 195 TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP 254
            +S+   +   A        +      +S ++  ++      R+   A++  +   +  P
Sbjct: 117 RESELPLSIVIAIDASGSTKKDLKLETDSAKRFARDILRPQDRLSVYAFSETV--EEIVP 174

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
            +++L  +   ++++     T  Y  +  A + L                +K ++ ITDG
Sbjct: 175 FTSDLRRIDRGISEIIAGSATAMYDTIFLASKALMKHDG-----------RKVMVLITDG 223

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--APPEG------QDLLRKCTDSSGQ 366
            ++ +S      +  Q       +   +YS+ V   A   G        L++   D+ G+
Sbjct: 224 GDTFSST-----SYEQAARAATQSETLLYSIIVVPVANSAGRDTGGEHALIQISQDTGGK 278

Query: 367 FFAVNDSRELLESFDKITDKIQEQSV-------RIAPNR 398
            +   D   L  +F +I+D+++ Q +       R+A + 
Sbjct: 279 HYYATDMGSLDVAFKQISDELRTQYLIGYYPSRRLASSD 317


>gi|326328639|ref|ZP_08194979.1| LigA [Nocardioidaceae bacterium Broad-1]
 gi|325953600|gb|EGD45600.1| LigA [Nocardioidaceae bacterium Broad-1]
          Length = 871

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/248 (13%), Positives = 78/248 (31%), Gaps = 27/248 (10%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP-APANRKIDVL 213
           +   S+++       +   +   +       K S        S       AP   KID +
Sbjct: 616 ERIGSVDEDDTFSQPEAEAIQRIRAEWDGVRKNSQVILLIDNSGSMNDEVAPGAAKIDRV 675

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
             +A   +  +       K+    +    +   +      P+ N +++V++ +  +    
Sbjct: 676 QSAANAAIGLLA-----PKDE---LAVWTFGSSVHKTALAPMGNRISQVRAEIGAIEAGG 727

Query: 274 NTNTYPA-MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS----GASAYQNTLNT 328
            T   PA +  A+  L    +            K V+ +TDG  +    GA   +N    
Sbjct: 728 TTTQLPAAVQAAHDALAQTND------PDNPKTKAVVLLTDGATNLTPDGADEEENKAAN 781

Query: 329 LQICEYMR--NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL-----ESFD 381
             +   +R   + ++IY++      +   L +    S  +++       L+       F 
Sbjct: 782 DALVADIRGSESHVRIYTIPYGNSADKCLLEKVAAASGARYYGAGARESLINDVMLAVFG 841

Query: 382 KITDKIQE 389
               +   
Sbjct: 842 NFGTQAAA 849


>gi|32394600|gb|AAM93998.1| proximal thread matrix protein 1 [Griffithsia japonica]
          Length = 218

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 60/154 (38%), Gaps = 25/154 (16%)

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYP 279
           V++ ++     K+       + +  G+   Q    S  L+   + +N ++P    TN + 
Sbjct: 56  VDAAKEFDDRTKDSYF--SAVGFASGVKLIQAPTQS--LSTFNTAVNTVSPLNGGTNIFR 111

Query: 280 AMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAG 339
            +   Y++L  +  +           + +I +TDG              +  C ++++ G
Sbjct: 112 GLRGCYQQLKTKPMTD----------RVLILVTDG---------FGGQPINYCNFIKSKG 152

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           + + +V +      Q+ L+ C  S   +  V D+
Sbjct: 153 ILLVTVGIGTSIN-QNFLKNCATSEEFYINVKDT 185


>gi|327399949|ref|YP_004340788.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
 gi|327315457|gb|AEA46073.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
          Length = 527

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 77/182 (42%), Gaps = 29/182 (15%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
             +A + V+ +        + + + G ++++  I  +    L+NN + VKS+++ ++   
Sbjct: 93  KTAAKSFVDKL-------NSTTDQAGVVSWDNNI--DFTQTLTNNFSLVKSKIDAVDSSG 143

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T+    ++ A   L   K+++ +          +IF+++G+ + + +            
Sbjct: 144 GTDLNVGLNAAISLLDTGKQANSSW--------VIIFLSNGQGTYSHSTAVV-------- 187

Query: 334 YMRNAGMKIYSVAVSAPPEGQD---LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
              N G  +Y++ ++  P       L      + G++++  ++  L   F+ I  ++   
Sbjct: 188 -AANKGYTVYTIGLAISPGSTAESNLKDIANTTGGKYYSSPNATNLDAVFNDIYKEVVTS 246

Query: 391 SV 392
           ++
Sbjct: 247 TI 248


>gi|293391324|ref|ZP_06635658.1| Flp pilus assembly protein TadG [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951858|gb|EFE01977.1| Flp pilus assembly protein TadG [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 525

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 66/467 (14%), Positives = 144/467 (30%), Gaps = 101/467 (21%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVL----------------SGCASIVSDRTIKDPTTKKD 58
           + +D   I+  + ++  A D A L                      VS + I      K 
Sbjct: 43  FTVDGTGILLDKARLAQATDQAALLLIAEDNKYRKNKDHSDVSRQHVSQQDINREGNSKV 102

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK---------NNPLQYIAESKA 109
           Q     + Q         Y+R +  +  + +   I KD            P      +K+
Sbjct: 103 QAQWKKRNQELVQGLVKLYLRSDDKNGQKNSSPAIIKDPFLAECLEEKTQPKNKNGTAKS 162

Query: 110 QYEIPTENLFLKGLIPSALTNLSLR------------STGIIERSSENLAISICMVLDVS 157
              +   ++  K  +P   T +S               T  ++     + I + MV D+S
Sbjct: 163 IACVVQGSVQRKFWLPWGQTLVSSSRLHDGRVGINSGKTYAVKDKQITIPIDLMMVTDLS 222

Query: 158 RSM---------EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN--------------- 193
            SM                   +        LLP   +      N               
Sbjct: 223 GSMVSPIDKRIPSSSIRIDALRDVVKDIEGILLPKDSRDDTSPYNRMGFVAFAGGARQKT 282

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI--------GT-IAYN 244
                  P  A  ++K ++      N ++   K + ++     R         G+ I+Y+
Sbjct: 283 EKNDCVLPYYAQQSKKEEISNLYRNNKLDQASKLL-DQYMDIERTINQIDQFNGSNISYD 341

Query: 245 IGIVGNQCTPLSNNLN-----------EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
                 +C   S                V + LN+++P   T     M      + +  +
Sbjct: 342 FINTTKKCLGKSEGKETTRAWFDKKNLGVSNALNEIDPDGGTAVTSGMFIGTNLMTDTNK 401

Query: 294 S--SHNTIGSTRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMRNA------------ 338
              +  +  +T  ++ ++ ++DGE++  +      L +  +C  ++              
Sbjct: 402 DPEAAPSKLNTNTRRILLVLSDGEDNRPTEGTLVKLMSAGLCNKIKRKIDSLQDTKYPKV 461

Query: 339 --GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
              +   ++  + P +  ++ ++C     Q++ V   + LL++F +I
Sbjct: 462 EARVAFVALGYNPPQDQVNVWKQCV--GKQYYTVFSKQGLLDAFRQI 506


>gi|32452632|gb|AAP43994.1| TadG [Aggregatibacter actinomycetemcomitans]
          Length = 525

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 66/467 (14%), Positives = 144/467 (30%), Gaps = 101/467 (21%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVL----------------SGCASIVSDRTIKDPTTKKD 58
           + +D   I+  + ++  A D A L                      VS + I      K 
Sbjct: 43  FTVDGTGILLDKARLAQATDQAALLLIAEDNKYRKNKDHSDVSRQHVSQQDINREGNSKV 102

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK---------NNPLQYIAESKA 109
           Q     + Q         Y+R +  +  + +   I KD            P      +K+
Sbjct: 103 QAQWKKRNQELVQGLVKLYLRSDDKNGQKNSSPAIIKDPFLAECLEEKTQPKNKNGTAKS 162

Query: 110 QYEIPTENLFLKGLIPSALTNLSLR------------STGIIERSSENLAISICMVLDVS 157
              +   ++  K  +P   T +S               T  ++     + I + MV D+S
Sbjct: 163 IACVVQGSVQRKFWLPWGQTLVSSSRLHDGRVGINSGKTYAVKDKQITIPIDLMMVTDLS 222

Query: 158 RSM---------EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN--------------- 193
            SM                   +        LLP   +      N               
Sbjct: 223 GSMVSPIDKRIPSSSIRIDALRDVVKDIEGILLPKDSRDDTSPYNRMGFVAFAGGARQKT 282

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI--------GT-IAYN 244
                  P  A  ++K ++      N ++   K + ++     R         G+ I+Y+
Sbjct: 283 EKNDCVLPYYAQQSKKEEISNLYRNNKLDQASKLL-DQYMDIERTINQIDQFNGSNISYD 341

Query: 245 IGIVGNQCTPLSNNLN-----------EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
                 +C   S                V + LN+++P   T     M      + +  +
Sbjct: 342 FINTTKKCLGKSEGKETTRAWFDKKNLGVSNALNEIDPDGGTAVTSGMFIGTNLMTDTNK 401

Query: 294 S--SHNTIGSTRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMRNA------------ 338
              +  +  +T  ++ ++ ++DGE++  +      L +  +C  ++              
Sbjct: 402 DPEAAPSKLNTNTRRILLVLSDGEDNRPTEGTLVKLMSAGLCNKIKRKIDSLQDTKYPKV 461

Query: 339 --GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
              +   ++  + P +  ++ ++C     Q++ V   + LL++F +I
Sbjct: 462 EARVAFVALGYNPPQDQVNVWKQCV--GKQYYTVFSKQGLLDAFRQI 506


>gi|183602734|ref|ZP_02964097.1| hypothetical protein BIFLAC_00845 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|183217972|gb|EDT88620.1| hypothetical protein BIFLAC_00845 [Bifidobacterium animalis subsp.
           lactis HN019]
          Length = 839

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 39/342 (11%), Positives = 101/342 (29%), Gaps = 92/342 (26%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ------------------ 166
            +   ++ +          + + + I +VLDVS SM +L  +                  
Sbjct: 46  GTYTLSMDVTGKSDESTEQQVVPLDIALVLDVSGSMNELSGKLVYNEVELLSMNPISTYY 105

Query: 167 --------------------KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
                                   + +    KY +         +  +   ++  +    
Sbjct: 106 VEKDGSYQAVRCSAISWGRCTTWQDQDSAGQKYTVTYNWIGGPSASVSPDVQFYKSKQSE 165

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNL---------------SVRIGTIAYN----IGI 247
             ++D L ++    ++ ++   Q   +                S +IG   YN       
Sbjct: 166 ETRLDALKDAVTYFLDQVEDQNQRINDPGKKVQVALIKYAGKNSDKIGNDTYNEDGYNYN 225

Query: 248 VGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                  L+    +L + ++ +N L     T     + HA ++L + +  +         
Sbjct: 226 YSQTVHSLAWTPEDLQKEQAAVNSLKAGGATRADFGLQHAVKQLNSGRPGA--------- 276

Query: 305 KKFVIFITDGENSGASAYQ--NTLNTLQICEYMRNAGMKIYSVAVS------APPEGQDL 356
           +K  +F +DG  + +  ++     N ++    ++N   ++ S+                 
Sbjct: 277 QKLTVFYSDGSPTSSDGFEAKIANNAIKAAAQLKNDHSQVISIGAMPGADPSGTDNANKF 336

Query: 357 LRKCTDS--------------SGQFFAVNDSR-ELLESFDKI 383
           +   + +               G ++    +R +L   F +I
Sbjct: 337 MNYVSSNYPKAQSMSEPHDRVEGTYYYAVSARTDLQTIFKEI 378


>gi|170746808|ref|YP_001753068.1| hypothetical protein Mrad2831_0362 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653330|gb|ACB22385.1| conserved hypothetical protein; putative vWFA domain protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 437

 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 69/414 (16%), Positives = 134/414 (32%), Gaps = 64/414 (15%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           + + V F     A+D       + Q+ +ALD AVL+    ++S +T   PTT      T 
Sbjct: 34  VTLPVMFATAA-AVDYGRRNAAKTQLDAALDGAVLA----VMSQKTNTIPTTTLQNMETQ 88

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
           F+ +  K                  A +N +K  +    Y A  K       +   +   
Sbjct: 89  FRTEAAK------VPGVTVTSFTPGAPVNTSKTLSLTASYTATVKTSLASMMQIPAM--- 139

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                    +  T    R++    I+  ++LD S SM          N  + +N      
Sbjct: 140 --------PVSGTSSATRNTSQY-INYYLLLDNSPSMGLAATDADVQNMKIATNGCAFAC 190

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                    N T          A R     +I VL E+   LV+    ++   +    ++
Sbjct: 191 HQHTFDKKGNITGDDQNDNYHIALRNNIKLRIQVLREAVSALVDQANVSMLLPQQ--FQM 248

Query: 239 GTIAYNIGIVGNQCTPLS---NNLNEVKSRLN-KLNPYENTNTYPAMHHAYRELYNEKES 294
               +N  +   +   ++   NN+      ++     Y  ++       A   +     +
Sbjct: 249 EMWTFNDSVTQTKLQAMTPTLNNIKNAAPNIDIAYAYYNQSDNQTDFERAIARMNTTIPA 308

Query: 295 SHNTIGSTRLKKFVIFITDG-ENSGASAYQNTLN------------TLQICEYMRNAGMK 341
           S + +   +  +F+  +TDG E++G S    +              +   C  ++N  +K
Sbjct: 309 SGDGLTPDKPIRFLFLVTDGVEDTGGSVTNQSAGFQIQSNRFIGPLSPSTCSALKNKNVK 368

Query: 342 IYSVAVS-APPEGQDL---------------LRKCTDSSGQFFAVNDSRELLES 379
           I  +     P    D                L+ C    G +F V  + ++  +
Sbjct: 369 IGIIYTQYLPIYDNDFYNRYVRPYESQIGPSLQACASD-GMYFPVTTNGDITAA 421


>gi|323499301|ref|ZP_08104278.1| hypothetical protein VISI1226_03745 [Vibrio sinaloensis DSM 21326]
 gi|323315689|gb|EGA68723.1| hypothetical protein VISI1226_03745 [Vibrio sinaloensis DSM 21326]
          Length = 322

 Score = 64.5 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 81/256 (31%), Gaps = 82/256 (32%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +VLD+S SM    +   +D                                      
Sbjct: 86  DLMLVLDLSYSMSQEDMSDGSD-----------------------------------YVD 110

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  + +   +            K    R+G + +         TPL+ +   V  ++N+
Sbjct: 111 RLTAVKKVVSDFA---------IKREGDRLGVVLFADHAYLQ--TPLTLDRTTVADQVNQ 159

Query: 269 LNP---YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           L      + T     +  A +   +          S   ++ +I ++DG N+        
Sbjct: 160 LVLRLIGDKTAIGEGIGLATKTFID----------SDAPQRVMILLSDGSNTSG-----V 204

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           ++ ++  +  +     IY++ V A                    + + L++    + GQ+
Sbjct: 205 IDPIEAAKIAKKYDATIYTIGVGAGEMMVKEFFMTRKVNTAQDLDEKALMQIAQITGGQY 264

Query: 368 FAVNDSRELLESFDKI 383
           F   D++EL   +D I
Sbjct: 265 FRARDAKELATIYDTI 280


>gi|312196063|ref|YP_004016124.1| von Willebrand factor type A [Frankia sp. EuI1c]
 gi|311227399|gb|ADP80254.1| von Willebrand factor type A [Frankia sp. EuI1c]
          Length = 560

 Score = 64.5 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 75/230 (32%), Gaps = 20/230 (8%)

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
           E  +       + + +        P ++ +  +T+ S   P  A   + +  L  +  +L
Sbjct: 340 ELPFPATEQVADQLLAAYLDQYRRPTRAIYVLDTSGSMEGPRLAALQQALTGLTGADDSL 399

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ------CTPLSNNLNEVKSRLNKLNPYEN 274
                +    +     ++  I +N  +   +       TP S +L  +      L    N
Sbjct: 400 SGRFARFRARE-----QVTIITFNDKVTATRQFTVSDPTPGSADLKAISDYGAALRAGGN 454

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T  Y A+  AY       ++  + + S      ++ +TDGEN+                 
Sbjct: 455 TAIYSALDAAYTTAAAGMKADPSALTS------IVLMTDGENNRG-LDSAGFLARYNTRP 507

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR-ELLESFDKI 383
               G++ ++V          L +  T + G  F        L + F +I
Sbjct: 508 PDVRGVRTFAVDFGDADRA-ALTQIATSTGGAVFDATAPGVSLSDVFREI 556


>gi|89069885|ref|ZP_01157219.1| hypothetical protein OG2516_06272 [Oceanicola granulosus HTCC2516]
 gi|89044561|gb|EAR50680.1| hypothetical protein OG2516_06272 [Oceanicola granulosus HTCC2516]
          Length = 536

 Score = 64.5 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 32/77 (41%)

Query: 313 DGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
           D  +   S          IC   +N G+++++V      +   ++  C  S   FF V+ 
Sbjct: 455 DFLDMSLSTSAKNARLEAICTAAKNQGVQVFTVGFEVEDDEAIIMEDCASSRAHFFRVSG 514

Query: 373 SRELLESFDKITDKIQE 389
             +L  +F+ I  +I E
Sbjct: 515 GGDLTTAFESIARQITE 531



 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 60/362 (16%), Positives = 109/362 (30%), Gaps = 69/362 (19%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
             A+D       R ++Q+ LD AVL+            D    KD    + +  + K   
Sbjct: 35  GMAVDFMRTETARGRLQATLDGAVLAAA----------DLDQDKDPV-EVVRDYVAKAGL 83

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
               I  +  +IA                  A +K+   +    +     +P+       
Sbjct: 84  DPFLIDVDVTEIA------------GQRIVTASAKSDVTMHFMKMVGIDFLPA-----PA 126

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
           RST     S+    + + +VLD+S SME   L +                  +K   +  
Sbjct: 127 RSTASEAVSN----LDVSLVLDMSGSMEGDKLDQLQAAAKNFVGIVYDTMGAEKILLNVV 182

Query: 194 TTKSKYAPAPAPANRKIDVLIE----------SAGNLVNSIQKAIQEKK----NLSVRIG 239
              ++ A      +     L E          +A     SI +A    +    +     G
Sbjct: 183 PYATQVAAPAGLLDMLGAFLREHSYSNCVSFSAADFTETSILEAAALPQGGHFDPFYTWG 242

Query: 240 TIAYNIGIVGNQCTP------LSNNLNEVKSRLNKLNPYENTNTYPAMHHA--------- 284
            + Y+         P      L++   E++  ++ L    NT+    M            
Sbjct: 243 PLRYDDVTFVCNPDPSTEVLTLASTQREIEDYIDGLVAEGNTSIDVGMKWGAALIDPDLG 302

Query: 285 --YRELYNEKESSHNTI----GSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMR 336
               E  N   ++        G     K ++ +TDG+N+       TL T      +  R
Sbjct: 303 STLNEFANGPSAAGINPVALWGDRSTDKVIVLMTDGKNTTEYRLPATLGTWSDVYIDDAR 362

Query: 337 NA 338
           + 
Sbjct: 363 DE 364


>gi|88798929|ref|ZP_01114511.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
 gi|88778409|gb|EAR09602.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
          Length = 322

 Score = 64.5 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 82/258 (31%), Gaps = 79/258 (30%)

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
           +    S+ + +D+S SM +  +                                 +   P
Sbjct: 80  DQRGRSLYLAVDLSESMLEQDMI--------------------------------WNQRP 107

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                 +  +          I + +++++     IG + +  G   +   PL+ +LN ++
Sbjct: 108 VSRYEAMQAV----------ISEFVEDRRGDF--IGLVVF--GSFADVQAPLTPDLNAIQ 153

Query: 264 SRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           S L  L P      T     +  A R+L            ST   + V+ ++DGEN+   
Sbjct: 154 SLLADLRPGMADSRTAIGDGLALAVRQL----------RESTTEDRVVVLLSDGENNSGE 203

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG---------------QDLLRKCTDSSG 365
              +    +   E      +++Y++   +                   Q L      + G
Sbjct: 204 IRPDEATAVAAAEN-----IRVYTIGFGSAGRDSLLQSFGLRSSSLDEQTLREIAEQTQG 258

Query: 366 QFFAVNDSRELLESFDKI 383
           +++    S EL E F  I
Sbjct: 259 RYYRATSSAELAEVFRDI 276


>gi|297581617|ref|ZP_06943539.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
 gi|297534024|gb|EFH72863.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
          Length = 467

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 58/147 (39%), Gaps = 14/147 (9%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN------EKESSHNTIGSTRL 304
           Q  PL +        L+ L P  NTN    +  A+R L        +K  S         
Sbjct: 322 QIQPLLSTRRAFIKALDTLYPEFNTNNAEGVMWAWRLLSPHWRGYWDKGKSELPRDYQHP 381

Query: 305 --KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
             +K ++  TDG N      +     + +C  M+  G++I S+  +       +++ C  
Sbjct: 382 NNRKVMLLFTDG-NHLVDVAKRDRKQVALCREMKKQGIEIISIDFNNRS---QVMKSCA- 436

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQE 389
           S+GQ++  ++ R +     ++   + +
Sbjct: 437 SAGQYYIADN-RTIRSVLKQVATTLSK 462


>gi|294508603|ref|YP_003572662.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
 gi|294344932|emb|CBH25710.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
          Length = 317

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 76/260 (29%), Gaps = 89/260 (34%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I MVLD S SM                                         A    
Sbjct: 78  GIDIMMVLDASTSM----------------------------------------QAEDFQ 97

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             + +   E+AG  V            +S R+G I +          PL+ + + ++  L
Sbjct: 98  PTRFEAAREAAGAFVE---------GRVSDRVGLIVFAAEAYTQA--PLTLDYSFLQRML 146

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
             +      + T    A+  A   L            S    K  I +TDG N+      
Sbjct: 147 EDVEVGAVEDGTAVGTALATAVNRL----------KDSEAESKVAILLTDGRNNRGQIDP 196

Query: 324 NTLNTLQICEYMRNAGMKIYSVAV--------------------SAPPEGQDLLRKCTDS 363
            T       E  +  G+++Y++ V                    SA  + + L    T +
Sbjct: 197 RT-----AAEVAQTMGVRVYAIGVGSSEDRDTWEEPLPQGQRDESAGVDAEMLRSVSTST 251

Query: 364 SGQFFAVNDSRELLESFDKI 383
            GQ+F+  +   L   + +I
Sbjct: 252 GGQYFSATNRDALERIYAEI 271


>gi|78776847|ref|YP_393162.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497387|gb|ABB43927.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 307

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 54/130 (41%), Gaps = 17/130 (13%)

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           S LN+    +NT    A+  + R              S    K V+ +TDGE++      
Sbjct: 160 SYLNQGMAGQNTAIGEAIAMSLRAF----------KHSKAKSKIVVLLTDGEHNSGDISP 209

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEG-QDLLRKCTD-SSGQFFAVNDSRELLESFD 381
                L      +   +KIY++ +    E  + LL+K  D S G+FF   +++EL E ++
Sbjct: 210 KDALVL-----AKEENIKIYTIGMGNRGEADEALLKKIADESGGEFFYATNAKELKEIYE 264

Query: 382 KITDKIQEQS 391
            I +    + 
Sbjct: 265 HIDELESSKI 274


>gi|41407305|ref|NP_960141.1| hypothetical protein MAP1207 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118463234|ref|YP_882479.1| hypothetical protein MAV_3297 [Mycobacterium avium 104]
 gi|81414471|sp|Q740Y5|Y1207_MYCPA RecName: Full=UPF0353 protein MAP_1207
 gi|41395657|gb|AAS03524.1| hypothetical protein MAP_1207 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118164521|gb|ABK65418.1| protein Nfa34780 [Mycobacterium avium 104]
          Length = 335

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 80/235 (34%), Gaps = 28/235 (11%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              +N   +P          + ++S  A   AP   ++    E+A    + +   I    
Sbjct: 84  AGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAP--NRMAAAQEAAKQFADELTPGIN--- 138

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                +G IAY  G      +P +N     K+ L+KL   + T T   +  A + +    
Sbjct: 139 -----LGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEGIFTALQAIATVG 191

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS---- 348
             +    G       ++  +DG+ +  +   N           ++ G+ I +++      
Sbjct: 192 --AVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPISTISFGTPYG 249

Query: 349 ----------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                      P + + L +    S G  +     +EL   +  +  +I  ++++
Sbjct: 250 FVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGYETIK 304


>gi|83816834|ref|YP_446668.1| von Willebrand factor type A domain-containing protein
           [Salinibacter ruber DSM 13855]
 gi|83758228|gb|ABC46341.1| von Willebrand factor type A domain protein [Salinibacter ruber DSM
           13855]
          Length = 289

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 75/260 (28%), Gaps = 89/260 (34%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I MVLD S SM                                         A    
Sbjct: 50  GIDIMMVLDASTSM----------------------------------------QAEDFQ 69

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             + +   E+AG  V            +S R+G I +          PL+ + + ++  L
Sbjct: 70  PTRFEAAREAAGAFVE---------GRVSDRVGLIVFAAEAYTQA--PLTLDYSFLQRML 118

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
             +      + T    A+  A   L            S    K  I +TDG N+      
Sbjct: 119 EDVEVGAVEDGTAVGTALATAVNRL----------KDSEAESKVAILLTDGRNNRGQIDP 168

Query: 324 NTLNTLQICEYMRNAGMKIYSVAV--------------------SAPPEGQDLLRKCTDS 363
            T       E  R  G+++Y++ V                    SA  + + L      +
Sbjct: 169 RT-----AAEVARTMGVRVYAIGVGSSEDRDTWEEPLPQGQRDESAGVDAEMLRSVSVST 223

Query: 364 SGQFFAVNDSRELLESFDKI 383
            GQ+F+  +   L   + +I
Sbjct: 224 GGQYFSATNRDALERIYAEI 243


>gi|163786711|ref|ZP_02181159.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
 gi|159878571|gb|EDP72627.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
          Length = 335

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 52/326 (15%), Positives = 108/326 (33%), Gaps = 95/326 (29%)

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
           Q A++ I+  +   +     SK ++ +    L   GL+ +AL  +  R+  +  ++    
Sbjct: 34  QTAELKISSIQGFKVTSSIWSKLRHLLFALRLIALGLLITAL--VRPRTVDVSTKTKTTR 91

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I M +DVS SM                                         A    
Sbjct: 92  GIDIVMSIDVSASML----------------------------------------AKDLL 111

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++ L + A + +           +   RIG + Y         TP++++ + V   +
Sbjct: 112 PNRLEALKKVAADFIE------GRPND---RIGLVEYAGEAYTK--TPITSDKSIVLRSM 160

Query: 267 NKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
             +         T     +  +   L            S    K +I +TDG N+G    
Sbjct: 161 RDIKYNTIIEGGTAIGMGLATSVNRL----------KDSRAKSKVIILLTDGVNNGGFID 210

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEG----------------------QDLLRKC 360
               + L +       G+K+Y++ +                            +DLL++ 
Sbjct: 211 PKIASELAV-----EYGIKVYTIGLGTNGTALSPVRINPNGSFQYGRQKVEIDEDLLKEI 265

Query: 361 TD-SSGQFFAVNDSRELLESFDKITD 385
            D + G++F   ++++L + +D+I  
Sbjct: 266 ADVTGGKYFRATNNKKLAQIYDEINK 291


>gi|87121300|ref|ZP_01077190.1| batB protein, putative [Marinomonas sp. MED121]
 gi|86163457|gb|EAQ64732.1| batB protein, putative [Marinomonas sp. MED121]
          Length = 333

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 84/264 (31%), Gaps = 82/264 (31%)

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
           +S       + + LD+S SM+   ++ +    N                           
Sbjct: 84  KSVTPSGRDLLIALDLSGSMQTADMKINQQAAN--------------------------- 116

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
                   ++D   +     +               RIG I +          PLS +L+
Sbjct: 117 --------RLDAAKQVLNRFITE---------RQGDRIGIIVFGSKAYLQA--PLSYDLD 157

Query: 261 EVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            +   +N+       ENT    A+    + L N              K+ +I +TDG N+
Sbjct: 158 TIAQLVNETQIGFAGENTAIGDAIGLGIKRLANIDAD----------KRVMILMTDGANT 207

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-----------------GQDLLRKC 360
                   +   Q  ++    G+KI+++ + A                     ++LL+K 
Sbjct: 208 AGR-----VKPDQAAQFAAKQGVKIHTIGIGAEQMVSQGFFGPRVINPSTDLDEELLQKV 262

Query: 361 TD-SSGQFFAVNDSRELLESFDKI 383
            D + GQ+F    ++EL   +  +
Sbjct: 263 ADLTQGQYFRAKSTQELASIYATL 286


>gi|240172225|ref|ZP_04750884.1| hypothetical protein MkanA1_23119 [Mycobacterium kansasii ATCC
           12478]
          Length = 335

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 67/185 (36%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N  +  K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-DATKNALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + L +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINGQRQPVPVDDETLKKVAQLSGGNAYNAATLAELKSVYASLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|257469959|ref|ZP_05634051.1| hypothetical protein FulcA4_11506 [Fusobacterium ulcerans ATCC
           49185]
 gi|317064188|ref|ZP_07928673.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689864|gb|EFS26699.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
          Length = 319

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 68/201 (33%), Gaps = 45/201 (22%)

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS-----RLN 267
           L ++   L   I K   +      R+  I +  G       PL+ + N +K       ++
Sbjct: 104 LEKAKEVLSEFIDKRTDD------RLALIVF--GGDAYTKVPLTFDHNVIKEMTGKLTVD 155

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            +     T     +  A   L            S    K +I +TDGEN+      +   
Sbjct: 156 DITSNTRTAIGMGIGVALNRL----------KDSEAKSKVIILLTDGENNSGEMSPS--- 202

Query: 328 TLQICEYMRNAGMKIYSVAVSAPP-----------------EGQDLLRKCTDSSGQFFAV 370
                +  +  G+KIY++ + A                   +   L      + G++F  
Sbjct: 203 --AAADIAKELGIKIYTIGIGAKEIKVPSFFGYTTVKNTELDENMLKSIAETTGGEYFRA 260

Query: 371 NDSRELLESFDKITDKIQEQS 391
           +DS+E  E F+KI    + Q 
Sbjct: 261 SDSKEFKEIFNKIDALEKTQI 281


>gi|254819550|ref|ZP_05224551.1| hypothetical protein MintA_06484 [Mycobacterium intracellulare ATCC
           13950]
          Length = 335

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N  +  K+ L+KL   + T T   + 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-DSTKAALDKLQFADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + L +    S G  +     +EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKAVYATLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|311030436|ref|ZP_07708526.1| hypothetical protein Bm3-1_07816 [Bacillus sp. m3-13]
          Length = 921

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 43/300 (14%), Positives = 89/300 (29%), Gaps = 75/300 (25%)

Query: 83  GDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERS 142
           G +    Q+ + +                E      + +  I        L     ++  
Sbjct: 346 GHLLSATQMELIETAVKDFGVGFTMTGGNESYGLGGYFQTPIEKI-----LPVDMDVKGK 400

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
            E  ++ + +VLD S SM                                          
Sbjct: 401 KEIPSLGLIIVLDRSGSM------------------------------------------ 418

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
                 K D+  E+A   V  +++            G IA++        T    N +EV
Sbjct: 419 ---MGEKFDLAKEAAARSVELLKEEDT--------FGFIAFDTEAWTVVETEPIKNKDEV 467

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
              +        T+ +PA++ AY++L                +K +I +TDG+++     
Sbjct: 468 IETIRSTALGGGTDIFPALNQAYQQLNEMDLK----------RKHIILLTDGQSNDGP-- 515

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
                  +I E      + + +VA+    +   L       +G+F+ V ++  +     +
Sbjct: 516 -----YEEIIEEGLTNNVTLSTVAIGGDADTSLLEELAEIGTGRFYEVYEASAVPSILSR 570


>gi|71278376|ref|YP_269691.1| von Willebrand factor type A domain-containing protein [Colwellia
           psychrerythraea 34H]
 gi|71144116|gb|AAZ24589.1| von Willebrand factor type A domain protein [Colwellia
           psychrerythraea 34H]
          Length = 364

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 42/268 (15%), Positives = 92/268 (34%), Gaps = 44/268 (16%)

Query: 127 ALTNLSLRSTGIIE-RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
            +     +   I    + E  A  + + +D+S SM         ++  +      L    
Sbjct: 72  CIVTAIAKPEMIGAPINQEKSARDLMIAVDLSGSMA-------VEDFTLPIATNELTNRA 124

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
           K    S  T  S           ++  +       V S             R+G I +  
Sbjct: 125 KNDTDSSATKSSTNDTGKGEKVNRLVAVKHVLNAFVKS---------REHDRLGLILFGD 175

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
                   P ++++   ++ LN+ +     ++T    A+  A                S 
Sbjct: 176 APYLQ--APFTDDIATWQALLNESDIGMAGQSTAFGDAIGLAISVFQQ----------SD 223

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-GQ-----DL 356
              + +I +TDG  +  ++    +   ++        +KIY++A+  P   G+     ++
Sbjct: 224 TQNRVLIVLTDG--NDTASKVPPVEAAKV---AAARDIKIYTIAIGDPSAVGEEKVDLEV 278

Query: 357 LRKCTD-SSGQFFAVNDSRELLESFDKI 383
           L+   + + G+ F   +S ELL+ + +I
Sbjct: 279 LQAMAEITQGKSFQALNSEELLKVYAEI 306


>gi|307292639|ref|ZP_07572485.1| hypothetical protein SphchDRAFT_0111 [Sphingobium chlorophenolicum
           L-1]
 gi|306880705|gb|EFN11921.1| hypothetical protein SphchDRAFT_0111 [Sphingobium chlorophenolicum
           L-1]
          Length = 540

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 77/274 (28%), Gaps = 44/274 (16%)

Query: 158 RSMEDLYLQKHNDNNNMTSNKYL----LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
            S       +H+D  N T   Y        P     W  NT               +   
Sbjct: 260 GSAGTTLYSRHSDWFNRTGKYYNSGYIYDNPTHSDTWLANTWDGCVEERRTSNAITLTSG 319

Query: 214 IESAGNLVNSIQ--KAIQEKKNLSVR------IGTIA-YNIGIVGNQCTPLS-NNLNEVK 263
                NL N+    K      + + R            Y       +   ++  + N   
Sbjct: 320 HSIPNNLPNTADDLKFDSTPTDSNTRWTVADPTRASGQYACPKAMRELQQMTATDFNNYF 379

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG---STRLKKFVIFITDGENSGAS 320
           +  N   P   T     +  A R L  +   S        +  + ++VIF+TDG  S  S
Sbjct: 380 TFNNGFIPNGGTWLDVGLLWAARLLSRDGLWSTENDELYHTYPVSRYVIFMTDGYMSIGS 439

Query: 321 A----------------------YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
           +                        +    L  C  ++N   KIY+++  A       L 
Sbjct: 440 SNYAAYAQEDYWRRVAAAGASKNDNHYARMLMTCTAIKNMDTKIYTISFGAGSTLDSNLI 499

Query: 359 KCTDS-----SGQFFAVNDSRELLESFDKITDKI 387
            C+ S         +  + S +L   F  I + I
Sbjct: 500 NCSSSTNTTNPEFAYKADSSSDLNRVFRDIGENI 533



 Score = 58.4 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/279 (13%), Positives = 88/279 (31%), Gaps = 33/279 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  +    A+D++     + ++Q A DA VL+G   + S   + D   + +  
Sbjct: 27  VAAAMLPLAGMVGG-ALDISRGYLAKTRLQQACDAGVLAGRKVMGSSGVLSDSV-RDEVR 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +       +L       +    +    QI ++     P   +                
Sbjct: 85  KYVSFNYPSGYLGSTLATTDINPTLGSNDQIALSLTTAIPTAVM---------------- 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L      +++   T   + S+    I I +VLD + SM     +  +D +    ++Y+
Sbjct: 129 -RLFGRNNMSITASCTARNDYSN----IDIVLVLDTTGSMACKPERNDSDCSTWAGSRYV 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK------AIQEKKNL 234
                  +   ++ T             ++  L  +  NL + +          +E K  
Sbjct: 184 TQWV---AGLGRDATFVPEEMNSGVNVSRMQGLRTALANLQSQMATIETQFNMTEESKRK 240

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            VR   + ++  +        +          +  N   
Sbjct: 241 RVRWAIVPFSQMVNAGFSQGSA-GTTLYSRHSDWFNRTG 278


>gi|85708696|ref|ZP_01039762.1| hypothetical protein NAP1_05635 [Erythrobacter sp. NAP1]
 gi|85690230|gb|EAQ30233.1| hypothetical protein NAP1_05635 [Erythrobacter sp. NAP1]
          Length = 640

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 40/255 (15%), Positives = 86/255 (33%), Gaps = 43/255 (16%)

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
           D  +++ N     T + +       K   + +     + P    A  K +   +S+GN++
Sbjct: 397 DGCIEEANTVATDTFDPFPQDAHDLKINLTPSNVNEYWKPVLRNATWKRE---DSSGNVL 453

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAM 281
             I +   E +          Y+      + T +S    ++++ ++ L P  NT     M
Sbjct: 454 GHITQTGNENRP--------GYSCPAAAFKLTDISR--TDLETYVDGLTPRSNTYHDFGM 503

Query: 282 HHAYRELYNEKESSHNTI---GSTRLKKFVIFITDGE--------NSGASAYQNTLNTLQ 330
               R +      + +         + + ++F+TDG         +     + +   T  
Sbjct: 504 IWGARFISPNGIFAASNATAPNGDAISRHIVFMTDGLLVPNQEIYSMYGIEWWDRRITND 563

Query: 331 ----------------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
                            C   R   + ++ +A       Q+L+  C    G+ F  ND+ 
Sbjct: 564 GSGGQARDRHATRFQVACRAARQENISVWVIAFGTTLT-QNLI-DCAT-PGRAFQANDTA 620

Query: 375 ELLESFDKITDKIQE 389
            L   F++I  +I  
Sbjct: 621 ALETRFEQIAQEIAA 635



 Score = 39.1 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 35/246 (14%), Positives = 74/246 (30%), Gaps = 56/246 (22%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A ++ +  +     +D +       ++Q+A DA  L+   S+  D   +      +   
Sbjct: 14  AASLVPLMAMVGG-GVDASRYYMAETRLQAACDAGALAARRSMADDNFSRADRITGE--- 69

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               K   ++   G++  E+        + + T  ++         +A   +PT      
Sbjct: 70  ----KFFDENYPDGTFGLEDL-------ERSFTATQSG----QVNGEASGTLPT-----A 109

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            + P      SL  T   + +  N    +  V+DV+ SM                     
Sbjct: 110 IMAPFGYDEFSLSVTCEADVNISNT--DVLFVVDVTGSMNCAPD---------------- 151

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                      N           P   KI  L  +     ++++ +     +  VR G +
Sbjct: 152 -----------NPGGGSCGNTEDPG-AKIKGLRSAVLKFYDTVETSTS--PSAQVRYGMV 197

Query: 242 AYNIGI 247
            Y   +
Sbjct: 198 PYASNV 203


>gi|320352592|ref|YP_004193931.1| von Willebrand factor type A [Desulfobulbus propionicus DSM 2032]
 gi|320121094|gb|ADW16640.1| von Willebrand factor type A [Desulfobulbus propionicus DSM 2032]
          Length = 798

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 65/187 (34%), Gaps = 18/187 (9%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
           ++I+ L  +A N V+  +   +           +A   G       PL  N     + ++
Sbjct: 345 KRIERLKVAAKNFVSLAENGTELGIVSYASDAAVA--SGRTEVAIAPLGANRAAWNNAID 402

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L P   TN    +  A   +           G      +++ ++DG N+  +   N   
Sbjct: 403 GLGPSTRTNIGAGLQKARDLITAA--------GGVTANTYIVLMSDGLNNEPAPQANADA 454

Query: 328 TLQICEYM-RNAGMKIYSVAVSAPPEGQDLLRKCTD----SSGQFFAVNDSRELLESFDK 382
            L     M    G+ +Y   V+       L  +C++    + G +    DS  L E+F  
Sbjct: 455 DLNGKIAMLLADGIPVY---VTCTGSDLGLASQCSEIGTGTGGHYVDSADSARLPEAFAD 511

Query: 383 ITDKIQE 389
             ++I  
Sbjct: 512 FHERIVA 518


>gi|256822867|ref|YP_003146830.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
 gi|256796406|gb|ACV27062.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
          Length = 986

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 98/293 (33%), Gaps = 68/293 (23%)

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
            ++  +++ +VLDVS SM         +           P   +KS         +    
Sbjct: 32  GQSQPVNLLLVLDVSGSMAWTTDACRLNRWGQPYPS-CYPGNGEKSRLDIMKEALELFLD 90

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
             P N K+ +L  SAGN ++ + +  Q   N                       N+   +
Sbjct: 91  DLPDNVKVGILTYSAGNNIDLLHEVKQLSDN-----------------------NHKATL 127

Query: 263 KSRLNKLNPYENTNTYPAMHHA-------YRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
            + ++ L     T T  A++ A       Y  L +      +   +      ++F+TDG+
Sbjct: 128 LTTIDGLEANGGTLTAGALYEAGSYFRGQYDNLPSPITPGCSNASN------IVFLTDGQ 181

Query: 316 NSGASAYQNTL-----------------------------NTLQICEYMRNAGMKIYSVA 346
            +  S    +                              +T+   E +  + +K +++A
Sbjct: 182 PNSMSYNGYSYRNSIINMTGSSCARSDDGKECSEKLAGFLSTVDQIEDLTPSKVKTHTIA 241

Query: 347 VS-APPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            +      +  L    D+  GQ +  + +  L+++F        EQS+ + P+
Sbjct: 242 FALEDNNARTFLENVADAGNGQSYTADSTDGLVDAFKSSIQTDIEQSMMVTPS 294


>gi|261409634|ref|YP_003245875.1| von Willebrand factor type A [Paenibacillus sp. Y412MC10]
 gi|261286097|gb|ACX68068.1| von Willebrand factor type A [Paenibacillus sp. Y412MC10]
          Length = 968

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 71/192 (36%), Gaps = 26/192 (13%)

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
           P     K+    E+A   V+ +            R+  +            P + + +  
Sbjct: 89  PNNGEDKMTNAKEAAKGFVDLMDMTK-------HRVAVV---DFSSSASSFPFTVDKDAA 138

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           KS +N +N    T T  A+  A   L + +         T  +  ++ +TDG  + +   
Sbjct: 139 KSYINTINSGGGTATGNAIDAAVALLADHR---------TEAQPVIVLMTDGAATESPKN 189

Query: 323 QNTLNT-LQICEYMRNAGMKIYSVAVSAPPEG------QDLLRKCTDSSGQFFAVNDSRE 375
            +  +  LQ  +  ++AG+  Y++A+  P E         L++    ++     V  S+ 
Sbjct: 190 TDPFDYALQRAQAAKDAGVIFYTIALLNPNEDPITSAPNVLMKNMATTATHHHFVLGSKG 249

Query: 376 LLESFDKITDKI 387
           L + +  I  +I
Sbjct: 250 LNQIYAAIVKEI 261


>gi|190894968|ref|YP_001985261.1| hypothetical protein RHECIAT_PC0000634 [Rhizobium etli CIAT 652]
 gi|190700629|gb|ACE94711.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 444

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 118/352 (33%), Gaps = 46/352 (13%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A+ +    + +  + D      +R +MQS LDAA+++    I      +D    K + S 
Sbjct: 32  ALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQI---NNSEDTDALKQKVSD 88

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
            F  Q++     G              +I I    +N       + A   +PT       
Sbjct: 89  WFHAQVENSYALG--------------EIEIDTTNHN-----ITATASGTVPT------T 123

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +  A  +    S G   +      +++ +V+D S SM                      
Sbjct: 124 FMKIANIDTVPVSVGSAVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFAC 183

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                    K T  + Y  +     + I +  + AG+ V  +   I E  +   RI    
Sbjct: 184 HTGDAHTVGKKTYANNYDYST---EKNIKLRADVAGDAVREVLDMIDESDSNHERIKVGL 240

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK-----ESSHN 297
           Y++G    +    + + +  + RL+  + Y  T+   +M++ Y ++          +  +
Sbjct: 241 YSLGDTTKEVLAPTLDTSNARKRLSD-DSYGLTSAT-SMNYTYFDVALAALQKIVGTGGD 298

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ--------ICEYMRNAGMK 341
              S    K V+ +TDG  S         + L+         C Y++N    
Sbjct: 299 GTSSANPLKLVLLLTDGVQSQRGWVVKNSSNLKKVAPLNPDWCGYVKNKSAT 350


>gi|149202124|ref|ZP_01879097.1| hypothetical protein RTM1035_12393 [Roseovarius sp. TM1035]
 gi|149144222|gb|EDM32253.1| hypothetical protein RTM1035_12393 [Roseovarius sp. TM1035]
          Length = 584

 Score = 64.5 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 58/385 (15%), Positives = 100/385 (25%), Gaps = 93/385 (24%)

Query: 3   AIIISVCFLF-ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           A  I V FL      ID+      R  +Q+ LD AVL+G  ++       + T +     
Sbjct: 26  AFAIFVMFLVMGGIGIDMMRQEMARASLQATLDRAVLAGATAV------NNATARAVIED 79

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
              K     +L       + AGDI  +          N  +  A +       T + +L 
Sbjct: 80  YFAKSGQSDYLA-----AQEAGDIDIRL---------NSSKVTARAT-----QTLDTYLM 120

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM-------EDLYLQKHNDNNNM 174
            L        +  ST  +        + I M LDVS SM             +  D+   
Sbjct: 121 RLAGVDTLTSAGNSTAEVTIPK----LEIAMALDVSGSMIGARIDALKPAAIEFVDSILD 176

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           ++             W    +K  Y         K    +E   +          +    
Sbjct: 177 STEPNDAVISVVPFSWGVTPSKEIYEALTVNETHKYSSCLELNDSHFTD---TTIDPNTA 233

Query: 235 S------VRIGTI--------------AYNIGIVGNQCT---PLSNNLNEVKSRLNKLNP 271
                   R G                 YN            P +     +  ++N L  
Sbjct: 234 YNQLIYTSREGVTFGDLTTTPLGDFLDTYNQTCYTQDYFNILPYATTKTALHDKINGLQA 293

Query: 272 YENTNTYPAMHHA------------------------------YRELYNEKESSHNTIGS 301
             +T+    +  A                              Y  +             
Sbjct: 294 GGSTSNDEGVKWAAALLDPAFQPVVTSLQQPIQVPQDDGTILTYSLVEPALSDMPAVFNE 353

Query: 302 TRLKKFVIFITDGENSGASAYQNTL 326
           +   K ++ + DG N  + ++ +T 
Sbjct: 354 SETLKVIVLMGDGANDNSYSFSSTY 378



 Score = 51.4 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAV--SAPPEGQDLLRKCTDSSGQFFAVND 372
           N+  +  +       IC   ++ G+ IY++A    + P G D ++KC  S    +    
Sbjct: 505 NNPINRSKKDERLDDICREAKSEGIVIYTIAFEMGSQPTGADKIKKCASSVNHHYNATT 563


>gi|317055486|ref|YP_004103953.1| von Willebrand factor type A [Ruminococcus albus 7]
 gi|315447755|gb|ADU21319.1| von Willebrand factor type A [Ruminococcus albus 7]
          Length = 1311

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 81/239 (33%), Gaps = 32/239 (13%)

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG--- 218
           D             S   LL     +  W K+   +    +       I ++I+S+G   
Sbjct: 597 DPVTCTVTAKTTHFSRYILLNKTAFEKIWDKDFAGTSVDNSGKTVAMDIALVIDSSGSMT 656

Query: 219 -----NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
                NL     K   +K +       I ++     N+   L++N   + S ++ ++   
Sbjct: 657 WNDPKNLRKDAAKEFVDKLSSIDEAAIIDFDSSSKINRN--LTSNRTLLYSAIDDIDSSG 714

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T+    +      L    +           KK +I +TDG+     +            
Sbjct: 715 GTSLTAGVSKGLEALSKSND-----------KKIMILLTDGKGPYDKSLT---------T 754

Query: 334 YMRNAGMKIYSVAVSAPPE-GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQ 390
              NAG+ IY++ +    +  Q LL      + G+++      ++  SFD ++  +  +
Sbjct: 755 QAINAGVTIYTIGLGTNNDIDQPLLNSIATETGGKYYHAKKDIDIQGSFDNVSGDLGNK 813


>gi|183982301|ref|YP_001850592.1| membrane protein [Mycobacterium marinum M]
 gi|226701243|sp|B2HPD3|Y2288_MYCMM RecName: Full=UPF0353 protein MMAR_2288
 gi|183175627|gb|ACC40737.1| membrane protein [Mycobacterium marinum M]
          Length = 335

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKAALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYASLQQQIG 299

Query: 389 EQSVR 393
            +++R
Sbjct: 300 YETIR 304


>gi|109009638|ref|XP_001105446.1| PREDICTED: epithelial chloride channel protein-like [Macaca
           mulatta]
          Length = 829

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 98/252 (38%), Gaps = 42/252 (16%)

Query: 158 RSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL---- 213
           RS  D+ +   +  +     +   PP P  S               + +  + D L    
Sbjct: 271 RSTWDVIMSSEDFQHLSPMTEINSPPHPTFSLLQSKQRVVCLVLDKSGSMNREDRLFRMN 330

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI-VGNQCTPL--SNNLNEVKSRLNKLN 270
             +   L+  I+K           +G + ++    + N  T +   N   ++ + L    
Sbjct: 331 QAAELYLIQIIEKGSL--------VGMVTFDSSAEIQNNLTKIIDENTYQKITANL-PQK 381

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P   T+    +   ++ +    +S+  +         +I +TDGE++  S+         
Sbjct: 382 PSGGTSICGGLKAGFQAISQSNQSTSGSE--------IILLTDGEDNQMSS--------- 424

Query: 331 IC-EYMRNAGMKIYSVAVSAPPEGQDL--LRKCTDSSGQFFAVNDSRELLESFDKITDK- 386
            C E ++ +G  I+++A+  P   ++L  L   T    +F+A  D   L+++F +I+ + 
Sbjct: 425 -CFEEVKQSGAIIHTIALG-PSADRELETLSNMTRGR-RFYAHKDINGLIDAFSRISSRS 481

Query: 387 --IQEQSVRIAP 396
             I +Q+V++  
Sbjct: 482 GNISQQAVQLES 493


>gi|171741586|ref|ZP_02917393.1| hypothetical protein BIFDEN_00672 [Bifidobacterium dentium ATCC
           27678]
 gi|171277200|gb|EDT44861.1| hypothetical protein BIFDEN_00672 [Bifidobacterium dentium ATCC
           27678]
          Length = 1256

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 54/388 (13%), Positives = 121/388 (31%), Gaps = 93/388 (23%)

Query: 44  IVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY 103
            V+D  I + +   D  +   +      L     + ++ G     A  + T D+ N +  
Sbjct: 481 AVNDPNITNVSCGTDTLAANQQTTCSGTLTLTEDMVDSEGHFTNTATASGTDDEGNAVNS 540

Query: 104 IAESKAQYEIPTENL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVS 157
              S     I             K    +   N+ +         +   ++   +VLDVS
Sbjct: 541 PQASVTIKAIKPLGAPEKHKRIKKNSDNTYTVNVDVTGAANSSTITTTQSVDFTLVLDVS 600

Query: 158 RSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA 217
            SM D                                             +K+  L  + 
Sbjct: 601 SSMSDEMDSDQGSI------------------------------------KKMTALKSAV 624

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYN-----------------IGIVGNQCTPLSNNLN 260
            N +    +  ++  +  +R+G + +                  +       +PL+ +++
Sbjct: 625 NNFLGEAAEINEQSGSELIRVGLVKFAGKESSKVGNETYTEGRFVYNYSQIVSPLTADMS 684

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++K++++ L     T       HA   +   +  +         K+ VIF TDG  +  S
Sbjct: 685 DLKNKVSALRHNGATRADLGFKHASTVMSGARTDA---------KRVVIFFTDGTPTKVS 735

Query: 321 AYQNTL--NTLQICEYMRNAGMKIYSVAV-------SAPPEGQDLLRKCTDS-------- 363
            +   +  + +   + ++++G  +YS+ V       S   + ++       S        
Sbjct: 736 DFDKDVANSAVTYAKSLKDSGATVYSIGVFDGANPSSIEEDQKNQFMNAVSSNYPHATAY 795

Query: 364 --------SGQFFAVNDSRELLESFDKI 383
                   +G +  V++  +L   F+KI
Sbjct: 796 DKLGTGSNAGYYKVVSNVSDLKSIFEKI 823


>gi|283778313|ref|YP_003369068.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
 gi|283436766|gb|ADB15208.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
          Length = 591

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 76/215 (35%), Gaps = 17/215 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            TA+++ V    I +A+D+ ++  ++ Q+Q ++DAA L+G  S+V    I      +   
Sbjct: 29  FTAVLMVVMLGMIAFAVDVGYMYTMQTQLQRSVDAAALAGAGSLVEGTDIAQAKATEYLV 88

Query: 61  ST---IFKKQIKKH---LKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEI- 113
                     + +     K   ++ E+  D   +A       ++        S     + 
Sbjct: 89  RNPVGSSMTFVNEEEVPAKIAQFVAEHGDDFEVEAGEWNASTRSFETTNTLPSTLSVSME 148

Query: 114 -PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK---HN 169
            PT   F   ++     ++   S  + +         I +VLD S SM D    +     
Sbjct: 149 YPTMPTFFGKILGKDSFSIRASSVAMYQ------PRDIMVVLDFSGSMNDDSTFEAFGKL 202

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
             + + SN            +   T + K+A    
Sbjct: 203 GRSWVESNLQQCWADIGNPTYGSLTFEPKWANCKG 237



 Score = 42.6 bits (98), Expect = 0.100,   Method: Composition-based stats.
 Identities = 42/251 (16%), Positives = 80/251 (31%), Gaps = 34/251 (13%)

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
           D   Q  N N N               +     + ++         + +  L +S    +
Sbjct: 356 DYCEQSSNSNKNAGYRYKYGYLNLMNYWLESRRSYAQTPVLWKTHAQPVRALKDSLAIFM 415

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGI-VGNQCTPLSNNLNEVKSRLNKLNPY---ENTNT 277
           + I +       +  R+G   YN     G    PL+  + +V +  N+       E TN 
Sbjct: 416 DFITEV-----EVQDRVGLAVYNAPNGEGMVEVPLTLEVEQVATIANQRQAGHYHEYTNI 470

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI------ 331
              ++ A   L       H    +    K ++ ITDG+ +  +   +  N          
Sbjct: 471 GGGLNAARLHL-----DQHGRPNAF---KMIVLITDGQANWRNGSYSIANAENYLISEAN 522

Query: 332 -CE-YMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS-------RELLESFDK 382
            C    R   +   S+  +A  +  +  +  T ++   F V           +L E+F K
Sbjct: 523 LCAHDSRKYPVVTLSLGTNADTDIME--QVATITNSTHFNVPGGSTIEQYHDQLSETFRK 580

Query: 383 ITDKIQEQSVR 393
           I      + V+
Sbjct: 581 IAKARPLKLVK 591


>gi|86741605|ref|YP_482005.1| von Willebrand factor, type A [Frankia sp. CcI3]
 gi|86568467|gb|ABD12276.1| von Willebrand factor, type A [Frankia sp. CcI3]
          Length = 534

 Score = 64.2 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 64/184 (34%), Gaps = 17/184 (9%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVR--IGTIAY----NIGI--VGNQCTPLSNNL 259
            +I  L  +   L  +             R  I  I +    N  +    N   P S +L
Sbjct: 356 SRIAALQAALRGLTGADDTLSGRFARFRGREKITMITFAGRANDPVDFAVNDPRPGSADL 415

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
             V + ++ L   + T  Y A+   YR      E+    + S      ++ +TDGEN+  
Sbjct: 416 AGVNTFVDGLRLQDGTAIYSALEAGYRAAGAAVEADPGYLTS------IVLMTDGENNSG 469

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
            +  +  ++ Q         ++ +++A         L     D+ G  F    +  L ++
Sbjct: 470 ISAADFRSSYQRLPAA-ARAVRTFTIAFGEADPA-ALRDISADTGGAVFDAR-TSSLADA 526

Query: 380 FDKI 383
           F  I
Sbjct: 527 FKDI 530


>gi|189465623|ref|ZP_03014408.1| hypothetical protein BACINT_01981 [Bacteroides intestinalis DSM
           17393]
 gi|189437897|gb|EDV06882.1| hypothetical protein BACINT_01981 [Bacteroides intestinalis DSM
           17393]
          Length = 327

 Score = 64.2 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 98/326 (30%), Gaps = 84/326 (25%)

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
           +  +  +         +  +S   Y +    +     +   +  L+   T    ++SE  
Sbjct: 27  RNNEATLQISDARVYAHTPKSYKNYLLHVPFMLRIIALALIIVVLARPQTTNSWQNSEIE 86

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I M +DVS SM                                         A    
Sbjct: 87  GIDIMMAIDVSTSML----------------------------------------AEDLK 106

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++   + A      I     +   +++  G       +  +    L N    +K  +
Sbjct: 107 PNRLEAAKDVAAEF---INGRPNDNIGITLFAGESFTQCPLTVDHAVLL-NLFQGIKCGI 162

Query: 267 NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
            +    + T     + +A   L            S    K +I +TDG N+     +  +
Sbjct: 163 IE----DGTAVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNN-----KGDI 203

Query: 327 NTLQICEYMRNAGMKIYSVAV----SAP-----------------PEGQDLLRKCTDSSG 365
           + L   E  ++ G+++Y++ V     AP                  + + L +    + G
Sbjct: 204 SPLTAAEIAKSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVNMPVEIDEKTLTQIAATTEG 263

Query: 366 QFFAVNDSRELLESFDKITDKIQEQS 391
            +F    + +L E +++I    + + 
Sbjct: 264 NYFRATSNSKLKEVYEEIDKLEKTKL 289


>gi|254775742|ref|ZP_05217258.1| hypothetical protein MaviaA2_13890 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 335

 Score = 64.2 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 73/211 (34%), Gaps = 26/211 (12%)

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS 256
           S+   A   A  ++    E+A    + +   I         +G IAY  G      +P +
Sbjct: 106 SQSMRATDVAPNRMAAAQEAAKQFADELTPGIN--------LGLIAY-AGTATVLVSPTT 156

Query: 257 NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
           N     K+ L+KL   + T T   +  A + +      +    G       ++  +DG+ 
Sbjct: 157 NR-EATKNALDKLQFADRTATGEGIFTALQAIATVG--AVIGGGDKPPPARIVLFSDGKE 213

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--------------APPEGQDLLRKCTD 362
           +  +   N           ++ G+ I +++                 P + + L +    
Sbjct: 214 TMPTNPDNPKGAFTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQL 273

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           S G  +     +EL   +  +  +I  ++++
Sbjct: 274 SGGNAYNAASLQELKSVYATLQQQIGYETIK 304


>gi|283455087|ref|YP_003359651.1| fimbriae protein with LPXTG motif and von Willebrand factor typeA
           domain [Bifidobacterium dentium Bd1]
 gi|283101721|gb|ADB08827.1| Fimbriae protein with LPXTG motif and von Willebrand factor typeA
           domain [Bifidobacterium dentium Bd1]
          Length = 1256

 Score = 64.2 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 54/388 (13%), Positives = 120/388 (30%), Gaps = 93/388 (23%)

Query: 44  IVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY 103
            V+D  I + +   D  +   +      L     + ++ G     A  + T D+ N +  
Sbjct: 481 AVNDPNITNVSCGTDTLAANQQTTCSGTLTLTEDMVDSEGHFTNTATASGTDDEGNAVNS 540

Query: 104 IAESKAQYEIPTENL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVS 157
              S     I             K    +   N+ +         +   ++   +VLDVS
Sbjct: 541 PQASVTIKAIKPLGAPEKHKRIKKNSDNTYTVNVDVTGAANSSTITTTQSVDFTLVLDVS 600

Query: 158 RSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA 217
            SM D                                             +K+  L  + 
Sbjct: 601 SSMSDEMDSDQGSI------------------------------------KKMTALKSAV 624

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYN-----------------IGIVGNQCTPLSNNLN 260
            N +    +  ++  +  +R+G + +                  +       +PL+ +++
Sbjct: 625 NNFLGEAAEINEQSGSELIRVGLVKFAGKESSKVGNETYTEGRFVYNYSQIVSPLTADMS 684

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++K++++ L     T       HA   +   +  +         K+ VIF TDG  +  S
Sbjct: 685 DLKNKVSALRHNGATRADLGFKHASTVMSGARTDA---------KRVVIFFTDGTPTKVS 735

Query: 321 AYQNTL--NTLQICEYMRNAGMKIYSVAV-------SAPPEGQDLLRKCTDS-------- 363
            +   +  + +   + ++++G  +YS+ V       S     ++       S        
Sbjct: 736 DFDKDVANSAVTYAKSLKDSGATVYSIGVFDGANPSSIEENQKNQFMNAVSSNYPHATAY 795

Query: 364 --------SGQFFAVNDSRELLESFDKI 383
                   +G +  V++  +L   F+KI
Sbjct: 796 DKLGTGSNAGYYKVVSNVSDLKSIFEKI 823


>gi|72162840|ref|YP_290497.1| von Willebrand factor, type A [Thermobifida fusca YX]
 gi|71916572|gb|AAZ56474.1| von Willebrand factor, type A [Thermobifida fusca YX]
          Length = 609

 Score = 64.2 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 77/225 (34%), Gaps = 30/225 (13%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
           N     +     P       +T+ S     P   + ++++  E+A   ++          
Sbjct: 397 NAMLENWAELRKPANVLLVIDTSGSMQESVPGTGSTRLELAKEAAITSLDEF-------- 448

Query: 233 NLSVRIGTIAYNIGIVGN-----QCTPLS------NNL---NEVKSRLNKLNPYENTNTY 278
           + S R+G   ++  +  N     +  PL       N      E+  R++ L P   T  Y
Sbjct: 449 SDSDRVGLWMFSTDLEDNGQDWRELVPLGPLGASVNGTPRREELAERISNLPPGGGTGLY 508

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
                A+  +                   V+F+TDG+N   +          I       
Sbjct: 509 DTALAAHTLVAEHSRPDAINA--------VVFLTDGKNEDLNGISLEKLLDSITPEPGQQ 560

Query: 339 GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           G++I++++     + + + +    ++   +  +D + + E F+ +
Sbjct: 561 GVRIFTISYGEDADLKTMTQIAEATNAAAYDASDPQSIDEVFEAV 605


>gi|88858061|ref|ZP_01132703.1| hypothetical protein PTD2_11764 [Pseudoalteromonas tunicata D2]
 gi|88819678|gb|EAR29491.1| hypothetical protein PTD2_11764 [Pseudoalteromonas tunicata D2]
          Length = 328

 Score = 64.2 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 40/257 (15%), Positives = 79/257 (30%), Gaps = 79/257 (30%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
           N    I + +D+S SM +  +                                       
Sbjct: 84  NEGRDIMLAVDLSGSMVEQDMA-----------------------------------YQG 108

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
               ++ ++     N +               R+G I +         TPL+ +LN V  
Sbjct: 109 RYVDRLSMVKAVLKNFIAQ---------RQGDRLGLILFGDTAFLQ--TPLTRDLNTVSK 157

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L +         T    A+  A +    +++S+          + ++ +TDGEN+  + 
Sbjct: 158 MLEEAQIGLVGRATAIGDALGLAVKRFSQKQDSN----------RILVLLTDGENTAGNL 207

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ--------------DLLRKCTD-SSGQ 366
                  L      R  G+K+Y+V V +    +               LL+K    + G 
Sbjct: 208 APEEALLL-----AREEGIKVYTVGVGSQGGNRFNLFSMSGSSSLDESLLQKIATETGGL 262

Query: 367 FFAVNDSRELLESFDKI 383
           +F   D   L + + ++
Sbjct: 263 YFRATDVASLQQIYQEL 279


>gi|224539999|ref|ZP_03680538.1| hypothetical protein BACCELL_04911 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518389|gb|EEF87494.1| hypothetical protein BACCELL_04911 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 327

 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 98/326 (30%), Gaps = 84/326 (25%)

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
           +  +  +         +  +S   Y +    +     +   +  L+   T    ++SE  
Sbjct: 27  RNNEATLQISDARVYAHTPKSYKNYLLHVPFMLRIIALALIIVVLARPQTTNSWQNSEIE 86

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I M +DVS SM                                         A    
Sbjct: 87  GIDIMMAIDVSTSML----------------------------------------AEDLK 106

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++   + A      I     +   +++  G       +  +    L N    +K  +
Sbjct: 107 PNRLEAAKDVAAEF---INGRPNDNIGITLFAGESFTQCPLTVDHAVLL-NLFQGIKCGI 162

Query: 267 NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
            +    + T     + +A   L            S    K +I +TDG N+     +  +
Sbjct: 163 IE----DGTAVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNN-----KGDI 203

Query: 327 NTLQICEYMRNAGMKIYSVAV----SAP-----------------PEGQDLLRKCTDSSG 365
           + L   E  ++ G+++Y++ V     AP                  + + L +    + G
Sbjct: 204 SPLTAAEIAKSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVNMPVEIDEKTLTQIAATTEG 263

Query: 366 QFFAVNDSRELLESFDKITDKIQEQS 391
            +F    + +L E +++I    + + 
Sbjct: 264 NYFRATSNSKLKEVYEEIDKLEKTKL 289


>gi|162454179|ref|YP_001616546.1| hypothetical protein sce5902 [Sorangium cellulosum 'So ce 56']
 gi|161164761|emb|CAN96066.1| hypothetical protein sce5902 [Sorangium cellulosum 'So ce 56']
          Length = 940

 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 54/144 (37%), Gaps = 19/144 (13%)

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
            IA++           + N + +   + ++ P   T  + A+  AY+++           
Sbjct: 513 VIAFDSAPTRYVKMQPARNRSRIAGEIARIQPGGGTEIFSALDAAYQDMTV--------- 563

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
            +   KK VI +TDG         +T     +   M    + + +V +    + Q LL+ 
Sbjct: 564 -TQARKKHVILLTDG-------KASTGGIRDLVSAMIAESITVTTVGLGNDLDEQ-LLKM 614

Query: 360 CTD-SSGQFFAVNDSRELLESFDK 382
             D   G+F AV D   L   F K
Sbjct: 615 IADVGGGRFHAVPDPNNLPRIFTK 638


>gi|254281808|ref|ZP_04956776.1| von Willebrand factor, type A [gamma proteobacterium NOR51-B]
 gi|219678011|gb|EED34360.1| von Willebrand factor, type A [gamma proteobacterium NOR51-B]
          Length = 328

 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 37/246 (15%), Positives = 82/246 (33%), Gaps = 74/246 (30%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + +D+S SM+   +Q                                     A    
Sbjct: 92  DLMLAIDLSGSMQIEDMQVG-----------------------------------ARLVS 116

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           +I+ +   A +  +           +  R+G I +          PL+ +   V   + +
Sbjct: 117 RIEAVKAIASDFTSQ---------RVGDRVGLILFGTRAYVQA--PLTFDTATVTRFIRE 165

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  E+T    A+  A + L      S          + +I +TDG+++      +T
Sbjct: 166 AQLGFAGEDTAIGDALGLAIKRLRERPAES----------RVLILLTDGQDTA-----ST 210

Query: 326 LNTLQICEYMRNAGMKIYSVAVS----APPEG-----QDLLRKCTD-SSGQFFAVNDSRE 375
           ++ ++       +G+K+Y++ +S    A   G     + LL    + + G++F   +  E
Sbjct: 211 VDPMEATALAAESGIKVYTIGISRRIGARAGGSGEVDEALLNAIAEATGGEYFRARNPAE 270

Query: 376 LLESFD 381
           L   + 
Sbjct: 271 LQSIYG 276


>gi|152995759|ref|YP_001340594.1| von Willebrand factor type A [Marinomonas sp. MWYL1]
 gi|150836683|gb|ABR70659.1| von Willebrand factor type A [Marinomonas sp. MWYL1]
          Length = 342

 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/256 (12%), Positives = 72/256 (28%), Gaps = 82/256 (32%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + + LD+S SM+   +  +    N                                   
Sbjct: 89  DLLIALDLSGSMQVTDMALNGQPAN----------------------------------- 113

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           +++       + +   +           RIG I +          PLS +   +   + +
Sbjct: 114 RLEAAKSVLSDFIQERRG---------DRIGIIVFGSKAYLQA--PLSFDTKTINQLVQE 162

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  E T    A+    + L ++             KK +I +TDG N+        
Sbjct: 163 AQIGFAGEQTAIGDAIGLGIKRLEDKPSD----------KKVLILMTDGANTAGRVQPQQ 212

Query: 326 LNTLQICEYMRNAGMKIYSVAVSA-----------------PPEGQDLLRK-CTDSSGQF 367
             T        +  +KI+++ + A                     + LL+     + G++
Sbjct: 213 AATF-----AASQNVKIHTIGIGADSMIVQSFFGPKAINPSSDLDETLLKNIAAQTGGEY 267

Query: 368 FAVNDSRELLESFDKI 383
           F    + +L   +  +
Sbjct: 268 FRAKSTEDLQAIYQTL 283


>gi|300782091|ref|YP_003762382.1| von Willebrand factor type A [Amycolatopsis mediterranei U32]
 gi|299791605|gb|ADJ41980.1| von Willebrand factor type A [Amycolatopsis mediterranei U32]
          Length = 602

 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 67/235 (28%), Gaps = 48/235 (20%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + +V+DVS SM D                                              K
Sbjct: 411 VLLVVDVSGSMGDEVK--------------------------------------GTGKSK 432

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL-SNNLNEVKSRLNK 268
           ID+  ++A + +       Q                        PL SN    + SRL+ 
Sbjct: 433 IDLAKQAAIDSLGQFVPRDQVGLWQFA-THLDGDKDYQELLPVQPLGSNGKETLASRLSG 491

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L P   T  Y +   AY  L    + S            V+ +TDG N            
Sbjct: 492 LTPQSGTGLYDSSLAAYEYLKAHLDPSAINA--------VVVLTDGRNEDPGGVDLDHLV 543

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
            Q+        ++++++A     +   L +    ++G  +  +    + + F  +
Sbjct: 544 PQLRPEGNAESVRLFTIAYGGDADQNVLKQIAEATAGSEYDSSKPDSINQVFTSV 598


>gi|312881786|ref|ZP_07741560.1| hypothetical protein VIBC2010_06474 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370537|gb|EFP98015.1| hypothetical protein VIBC2010_06474 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 323

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 86/256 (33%), Gaps = 81/256 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +VLD+S SM    +Q  + N                                     
Sbjct: 86  DLMLVLDLSYSMSQEDMQDSSGNY------------------------------------ 109

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
            ID L  +  N+V+    A Q K +   R+G + +         TPL+ + N +  ++N 
Sbjct: 110 -IDRL-TAVKNVVSQF--AQQRKGD---RLGLVLFADHAYLQ--TPLTLDRNTISEQVNS 160

Query: 269 LNP---YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           L      + T     +  A +   +          S   ++ +I ++DG N+        
Sbjct: 161 LVLQLIGQKTAIGEGIGLATKTFID----------SDAPQRVMILLSDGSNTSG-----V 205

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ ++     +     IY++ V A                    + + L+     + GQ+
Sbjct: 206 LDPIEAANIAKKYNATIYTIGVGAGEMMVKDFFMTRKVNTAQDLDEKTLMSIAKITGGQY 265

Query: 368 FAVNDSRELLESFDKI 383
           F   +++EL   +D I
Sbjct: 266 FRARNAQELATIYDTI 281


>gi|163754426|ref|ZP_02161548.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
 gi|161325367|gb|EDP96694.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
          Length = 335

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 53/334 (15%), Positives = 100/334 (29%), Gaps = 96/334 (28%)

Query: 82  AGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG--II 139
           A  I +K +   T   ++   + A      ++      L+ L   AL     R     + 
Sbjct: 24  AWYIWKKPKQLATVKMSSLQGFKATPSILPKLKPILFVLRMLAIMALITALARPQTKEVS 83

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
            R   N  I I M +DVS SM                              SK+   ++ 
Sbjct: 84  TRIKTNKGIDIVMAIDVSASML-----------------------------SKDLRPNR- 113

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                     +  L + A   +             S RIG + Y         TP++ + 
Sbjct: 114 ----------LTALKKVAAEFIE---------GRPSDRIGLVVYAGESFTK--TPITTDK 152

Query: 260 NEVKSRLNKLNPY-----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
           + +++ L  +          T     +  A   L            S    K +I +TDG
Sbjct: 153 SIIQNALKDIKYKHGELIGGTAIGMGLATAVNRL----------KDSKAKSKVIILLTDG 202

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV-----------------------SAPP 351
            N+         + L +       G+K Y++ +                           
Sbjct: 203 VNNAGFIEPQIASELAV-----EYGIKTYTIGIGTNGMASTPVALNPDGTILFRNMQVEI 257

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           + + L +    + G++F   ++++L E +D+I  
Sbjct: 258 DEKLLQQIAKTTGGKYFRATNTKKLAEIYDEINK 291


>gi|219847012|ref|YP_002461445.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
 gi|219541271|gb|ACL23009.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
          Length = 847

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 51/292 (17%), Positives = 96/292 (32%), Gaps = 67/292 (22%)

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
           +E   +   ++LDVS SM   ++ +   N  +T      P  P      ++  + +YA  
Sbjct: 404 NERRPVQYVVILDVSGSMNANFIGQGIVNGRVTQCTNGPPGSPPA----QSCGQPQYAWN 459

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQ---EKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
           P    R+I V  ++   L+           +       +  + +   +      P  +N 
Sbjct: 460 PVQ-ERRIYVAKKALELLIRQTNMPGNPGYDPTQPIDSMALVWFTHNVPSTNVVPFKSNP 518

Query: 260 NEVKSRLNKLNPYEN--------TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFI 311
           NE+   +N    Y+         TN    ++ A + L N   +++        ++ +IF+
Sbjct: 519 NELIQAVNSAGAYQGDPYKTSGGTNGTGGLYRASQLLANAPRTTNQLGKEWIYRRAIIFV 578

Query: 312 TDG-EN----------SGASAYQNTLNTLQICEYM---------------RNAGM----- 340
           TDG  N          +G S+ Q T  T  +C                  +  GM     
Sbjct: 579 TDGVTNTFFNANNSNVNGGSSNQTTYPTGHVCRKAEVLEDALCQTTEVGGKYNGMDRPIT 638

Query: 341 -----------------KIYSVAVSA-PPEGQDLLRKCTDSSGQFFAVNDSR 374
                             IY++A+S+ P  G  L      +   F+      
Sbjct: 639 QMVNMTNTIKSNQSIQTDIYALALSSIPATG--LRDGVASTPRHFYTAETLE 688


>gi|110598614|ref|ZP_01386881.1| von Willebrand factor, type A [Chlorobium ferrooxidans DSM 13031]
 gi|110339783|gb|EAT58291.1| von Willebrand factor, type A [Chlorobium ferrooxidans DSM 13031]
          Length = 336

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 50/274 (18%), Positives = 81/274 (29%), Gaps = 86/274 (31%)

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
           + +  +E   I + + LD+S SM                                     
Sbjct: 89  VRQTEAEARGIDVMLALDISESML------------------------------------ 112

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                      ++D   E A   V          +  S RIG + +     G    PL+ 
Sbjct: 113 ---QKDGSGKSRLDAAREVARKFV---------LRRSSDRIGLVVF--RGKGYTQCPLTI 158

Query: 258 NLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           + + +   ++ ++P     E T    A+  A               GST L+K +I ITD
Sbjct: 159 DHDVLAMLIDHISPQVIQDEGTAIGSAILIATNRF----------KGSTSLQKVIILITD 208

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSV--AVSAPPEGQDL--------------L 357
           GEN+       T  TL         G++IY V     +     +L              L
Sbjct: 209 GENNTGDVGPATAATL-----AAQNGIRIYVVNAGFKSGGSAGNLSAESSAHAAMDEASL 263

Query: 358 RKCT-DSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           R     + G +F   D   L  +   I      +
Sbjct: 264 RGIARTTGGGYFRAEDPSVLDNTIKTIGRLETAR 297


>gi|134100328|ref|YP_001105989.1| hypothetical protein SACE_3793 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133912951|emb|CAM03064.1| von Willebrand factor, type A [Saccharopolyspora erythraea NRRL
           2338]
          Length = 327

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 74/229 (32%), Gaps = 28/229 (12%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              + +  +P        + + + S  A    P   +++    +A    + +   I    
Sbjct: 77  AGPTAEQRIPRNRATVMLTVDVSLSMKATDVEP--NRLEAAKVAAKEFADQLTPGIN--- 131

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                +G +++  G       P + +   VK  ++ L   E T T   ++ A   + +  
Sbjct: 132 -----LGLVSF-AGTATVLVMP-TTDRASVKQAIDNLKLSEATATGDGINAAMSAIDSFG 184

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS---- 348
           +      G+   +  ++ + DG  +               +  + A + I +++      
Sbjct: 185 KMVGGPSGAPPAR--IVLMADGGQTIPRELDAPRGAYTKAQEAKKANIPISTISFGTKHG 242

Query: 349 ----------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
                        + + +      S G+F     + +L E +  + ++I
Sbjct: 243 SIEIEGEQEFVEVDDEAMQEIARLSGGEFHKAASAEQLREVYATLGEQI 291


>gi|332664649|ref|YP_004447437.1| von Willebrand factor type A [Haliscomenobacter hydrossis DSM 1100]
 gi|332333463|gb|AEE50564.1| von Willebrand factor type A [Haliscomenobacter hydrossis DSM 1100]
          Length = 328

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 67/189 (35%), Gaps = 45/189 (23%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYN 290
              RIG + +          PL+ +   +++ L +L      + T     +  A   L  
Sbjct: 124 PHDRIGLVVFAGEAFTQ--CPLTTDHKILETFLEQLECGNLEDGTAIGMGLAGAVNRL-- 179

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     S    K +I +TDG N+       T   L      +  G+K+YS+ V   
Sbjct: 180 --------KKSPAKSKVIILLTDGVNNVGYFKPLTAGEL-----AKELGIKVYSIGVGTI 226

Query: 351 PEG----------------------QDLLRKCTD-SSGQFFAVNDSRELLESFDKITD-- 385
            E                       ++LLR+    + GQ+F   ++++L + ++ I    
Sbjct: 227 GEALTPVSRLSDGSFFLDYAQVEIDEELLREIARMTGGQYFRAKNNQDLRQIYNTIDRLE 286

Query: 386 KIQEQSVRI 394
           K + Q  RI
Sbjct: 287 KTEIQVTRI 295


>gi|291008772|ref|ZP_06566745.1| hypothetical protein SeryN2_29978 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 324

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 74/229 (32%), Gaps = 28/229 (12%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              + +  +P        + + + S  A    P   +++    +A    + +   I    
Sbjct: 74  AGPTAEQRIPRNRATVMLTVDVSLSMKATDVEP--NRLEAAKVAAKEFADQLTPGIN--- 128

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                +G +++  G       P + +   VK  ++ L   E T T   ++ A   + +  
Sbjct: 129 -----LGLVSF-AGTATVLVMP-TTDRASVKQAIDNLKLSEATATGDGINAAMSAIDSFG 181

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS---- 348
           +      G+   +  ++ + DG  +               +  + A + I +++      
Sbjct: 182 KMVGGPSGAPPAR--IVLMADGGQTIPRELDAPRGAYTKAQEAKKANIPISTISFGTKHG 239

Query: 349 ----------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
                        + + +      S G+F     + +L E +  + ++I
Sbjct: 240 SIEIEGEQEFVEVDDEAMQEIARLSGGEFHKAASAEQLREVYATLGEQI 288


>gi|146337718|ref|YP_001202766.1| hypothetical protein BRADO0587 [Bradyrhizobium sp. ORS278]
 gi|146190524|emb|CAL74523.1| conserved hypothetical protein; putative vWFA domain
           [Bradyrhizobium sp. ORS278]
          Length = 442

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 72/450 (16%), Positives = 147/450 (32%), Gaps = 87/450 (19%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAA----------VLSGCASIVSDRTIK 51
            AI+       +   +D +    +R ++Q+A+DAA                ++ +D  I 
Sbjct: 23  FAIVCVPVITAVGCGVDYSRTNQMRAKLQAAVDAASVGAVSRTSPAFIAAGAMTTDGVIA 82

Query: 52  DPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY 111
                 D    IF   +        Y  ++     +K    +T   +             
Sbjct: 83  AGN---DDARKIFNGNMSG---TTGYTLDSLTPEVKKTGSVLTATVSFSATV-------- 128

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
                      ++     +L   ST    ++S    I   ++LD S SM         D 
Sbjct: 129 -----PTLFMSIVGYKTMSLQGSSTA---KASMPKYIDFYLLLDNSPSMG--VAATPADV 178

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
             M S            +   N   +           +IDVL  +   L+++ Q+     
Sbjct: 179 TKMVSATSDKCAFACHDYNDANNYYNLAKTLGVT--TRIDVLRSATQQLMDTAQQTQTYS 236

Query: 232 KNLSVRIGTIAY---NIGIVGNQCTPLSNNLNEVKSR---LNKLNPYENTNTYPAMH-HA 284
                R+    +   +  I       LS++L   KS    ++ +  Y N +++ A     
Sbjct: 237 NQ--FRMAIYDFGASSKTIGLRALFALSSSLTSAKSAAGNIDLMGVYGNNDSFTADKDTP 294

Query: 285 YRE---LYNEKESSHNTIGSTRLKKFVIFITDG---ENS--------GASAYQNTLNTLQ 330
           Y       N + ++     S    K++ F++DG   E++          +  Q+ +N   
Sbjct: 295 YTTALPAINNEIATPGDGTSGSPLKYLFFVSDGVADESNAACLKPKASGNRCQSPINP-A 353

Query: 331 ICEYMRNAGMKI---YSVAVSAPPEGQDL----------------------LRKCTDSSG 365
           +C  ++N G+KI   Y+  +  P     +                      ++ C    G
Sbjct: 354 LCTALKNRGIKIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQACASD-G 412

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +F V+ ++ + ++ + +  K    + RIA
Sbjct: 413 FYFEVSPTQGIADAMNALFKKAVADA-RIA 441


>gi|260914303|ref|ZP_05920772.1| Flp pilus assembly protein TadG [Pasteurella dagmatis ATCC 43325]
 gi|260631404|gb|EEX49586.1| Flp pilus assembly protein TadG [Pasteurella dagmatis ATCC 43325]
          Length = 584

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 79/249 (31%), Gaps = 41/249 (16%)

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL-------------- 220
           + N    P   K +    +    +   A        D L  +  +               
Sbjct: 320 SFNYRGSPWDCKDTNVLDDRGNPRPVNACLIKGNPEDALRTALNDRHLSTSMKLIFEDVL 379

Query: 221 -VNSIQKAIQEKKNLSVRIGTIAYNIG---IVGNQ--CTPLSNNLN---EVKSRLNKLNP 271
            V+   K ++      V    + YN     + GN+   T  +       +V   L+K+ P
Sbjct: 380 DVDKTIKQVENFDGNRVNDYKLTYNNPDHCLGGNEGVETSQAWFTKSKPKVAEALSKIKP 439

Query: 272 YENTNTYPAMHHAYRELYNEK--ESSHNTIGSTRLKKFVIFITDGENSGASAYQ-NTLNT 328
             +T            L ++     +      T  ++ ++ ++DGE++  +     TL  
Sbjct: 440 TGSTAASSGFIIGANLLMDKNTVPEAQPAKLGTNTQRILMVLSDGEDNRPTFDTLTTLLN 499

Query: 329 LQICEYMRNA--------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
             +C+ +R                 +   +     PPE +   +KC      ++  +   
Sbjct: 500 AGLCDNIRKKADSLQDPKFNTLPTKIAFAAFGFQPPPEQKAAWQKCV-GENNYYEPSSKE 558

Query: 375 ELLESFDKI 383
            LL++F +I
Sbjct: 559 ALLDAFKQI 567



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 40/282 (14%), Positives = 86/282 (30%), Gaps = 73/282 (25%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL---SGCASIVSDRTIKDPTTK- 56
           MTA++     + I + +D   I+  + ++  A D A L   +   +   +    D T + 
Sbjct: 38  MTALLSFPLLVLIAFTVDGTGIILDKVRLAQATDQAALLLVAENNAYRKNPMHDDVTKQS 97

Query: 57  --KDQTSTIFKKQIKKH-----------LKQGSYIRENAGDIAQKAQINITK-------- 95
             K++ S     ++              L +     EN         + I +        
Sbjct: 98  VSKEELSKFSGDKLSAQKDKRNQELIQGLAKMYLRSENKAQKDNHLPVTIDQPFDYKCEE 157

Query: 96  ----DKNNPLQ--------YIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS 143
               +  N                  ++ IP     +K    +    ++   +  ++  +
Sbjct: 158 LDLINPKNQYSRRKPVTCYVQGSVNREFWIPLSADLVKTHTKNGRLPINSGISYAVKEKA 217

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
             + + + +V D S SM                             W     ++   P  
Sbjct: 218 IVIPVDLMLVSDFSGSML----------------------------WDLKNNENAQYP-- 247

Query: 204 APANRKIDVLIESAGNLVNSI--QKAIQEKKNLSVRIGTIAY 243
              NRKID+L     ++ N +   K  ++  +   R+G  A+
Sbjct: 248 ---NRKIDILRSVVSDIQNILFPTKLSEDA-SPYNRMGFAAF 285


>gi|219847249|ref|YP_002461682.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
 gi|219541508|gb|ACL23246.1| von Willebrand factor type A [Chloroflexus aggregans DSM 9485]
          Length = 842

 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 81/239 (33%), Gaps = 66/239 (27%)

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
           +   IS+ +++D S SM   +                                       
Sbjct: 391 QRAPISLLLIIDRSASMSASF--------------------------------------- 411

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN---IGIVGNQCTPLSNNLN 260
                K D+  E+A   + ++Q           RIG +A++   I ++  Q       + 
Sbjct: 412 --GVSKFDLAKEAAILALTALQAGD--------RIGVLAFDTDTIWVIPFQAVGEGAAVA 461

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           E+++R+  +     TN   A+      L  E  S           +  + +TDG +   +
Sbjct: 462 ELQTRIATMAIGGGTNIERALAVGLPALAAEPHS----------VRHAVLLTDGRSYSNN 511

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
             +      Q+ E  R A + + ++A+    +   L +     +G+++ V D+ +L   
Sbjct: 512 YPR----YQQLVETARAAQITLSTIAIGTDADTDLLEQLARWGNGRYYFVPDAADLPRI 566


>gi|301165481|emb|CBW25052.1| putative membrane protein (von Willebrand factor type A)
           [Bacteriovorax marinus SJ]
          Length = 329

 Score = 63.4 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 44/279 (15%), Positives = 89/279 (31%), Gaps = 60/279 (21%)

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
           L    +++ S+    + + +V     ++  L +                       F+  
Sbjct: 36  LLPASMVKNSNSAKRLLVWLV----GAVGWLLIAYSLTQPRSPQGFAKNKIEVNDIFFVI 91

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
           + ++S  A    P   +++V  +   + V             + RIG I ++        
Sbjct: 92  DVSRSMLADDFRP--NRLEVAKDKISDFVA---------LRPTDRIGLIMFSERAF--TL 138

Query: 253 TPLSNNLNEVKSRLNKLNPYE----NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
            PLS +L  +K  + ++N        TN   A+  A                S    K +
Sbjct: 139 LPLSTDLKLIKQMVGEINVGGMLGSGTNIGDALGLAV----------ARGAQSLAKNKVI 188

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG--------------- 353
           I +TDG ++        L  +Q  E  +  G+K+Y++ +    +                
Sbjct: 189 ILLTDGVSNVGF-----LTPIQAAEEAKKQGIKVYTIGIGGRGDAKIPYGKNIFGRQRYQ 243

Query: 354 ---------QDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
                    + L      ++GQ F   D + L E   +I
Sbjct: 244 NIPGGSIDFKTLKEIADKTNGQTFEAQDEKALAEVLSEI 282


>gi|251779520|ref|ZP_04822440.1| von Willebrand factor, type A domain protein [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243083835|gb|EES49725.1| von Willebrand factor, type A domain protein [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 815

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 71/213 (33%), Gaps = 41/213 (19%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA--- 206
           I +VLD S SM +   +   +N       +       +     +   + Y          
Sbjct: 95  IVLVLDTSGSMNEKVGKVCTNNRGWYCKTHNSSDLYHRESLFYHNWINDYCEEHGKVGQH 154

Query: 207 ------NRKIDVLIESAGNLVNSIQKAIQEKK------NLSVRIGTIAYNIGIVGNQCTP 254
                 + K++ L ++A N ++ + K + + K      +    I    YN          
Sbjct: 155 YASYSKSTKMEELKKAANNFIDKM-KDVPDLKICIVNYSSEATINPCGYNGDKNSASVEE 213

Query: 255 ----------------LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
                           L++N N + S +N L     TNT   +  A   L    + +   
Sbjct: 214 DRHHTIPNYKSLGTKFLNSNDNTLHSMINGLKALGGTNTGEGLRKAEYMLEQGDKDA--- 270

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQI 331
                 KK ++F++DG  +  S Y+N  N  + 
Sbjct: 271 ------KKTIVFMSDGLPTYYSVYKNHQNVQKY 297


>gi|116623283|ref|YP_825439.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226445|gb|ABJ85154.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 299

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 65/150 (43%), Gaps = 26/150 (17%)

Query: 253 TPLSNNLNEVKSRL--------NKLNP--YENTNTYPAMHHAYRELYNEKESSHNTIGST 302
            PL+N+L ++   L        N+L       T  Y A+  A +E+   +          
Sbjct: 126 QPLTNSLRQLSDSLPYVDTPTFNQLRAQSGGGTLLYDAVVTASQEVMLNRTG-------- 177

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-LLRKCT 361
             +K +I +TDGE+     Y +  +     E  + A   IYS+  +   +G+  L R   
Sbjct: 178 --RKALILLTDGED-----YGSDASVGDAIEAAQRADTLIYSILFADQGDGRRPLQRMSK 230

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           ++ G FF V+  +++ + F  I ++++ Q 
Sbjct: 231 ETGGSFFEVSKKQDIDQIFTAIQEELRSQY 260


>gi|311063719|ref|YP_003970444.1| cell surface protein [Bifidobacterium bifidum PRL2010]
 gi|310866038|gb|ADP35407.1| Cell surface protein with gram positive anchor domain
           [Bifidobacterium bifidum PRL2010]
          Length = 1176

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 45/341 (13%), Positives = 108/341 (31%), Gaps = 90/341 (26%)

Query: 84  DIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS 143
           D A    +++ +     +     +  +Y    +         +   +L++  T      +
Sbjct: 572 DSATTEPVSVGEVPRTTVTNTVVTAPRYRKYIKANND----GTYDLSLNVTGTQSGSSQT 627

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
                 I +V D S SM +                                        P
Sbjct: 628 TVSPADIVVVFDTSGSMSN----------------------------------------P 647

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
              N +++V   +  ++   +  +  + K+ ++R+  + ++        +  ++N  ++ 
Sbjct: 648 MGHNSRLEVAKTAVNSMAQHLLTSENQGKDSNIRMALVPFS--TTAGNVSNFTDNAMDIV 705

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS------ 317
           S +N L     TN        +     +  ++  T G   +KK+++F++DG+ +      
Sbjct: 706 SAVNGLGADGGTN--------WEA-ALKAANAKLTSGRKGVKKYIVFMSDGDPTFRTSSV 756

Query: 318 --------------------------GASAYQNTLNTLQICEYMRNAG-MKIYSVAVSAP 350
                                       S+ Q   N           G   ++SV VS+ 
Sbjct: 757 RTGTDWWGRPTYDDDDRRGLPAGVHGSGSSDQYGANLSSAVAEANRRGDATLFSVGVSSD 816

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           P    +      + G +++   + EL ++F  I  +I  +S
Sbjct: 817 PT--KMRGFADQTKGSYYSATSTDELNKAFADIIGQINRKS 855


>gi|223558081|gb|ACM91085.1| aerotolerance protein BatA [uncultured bacterium Rlip1]
          Length = 332

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 79/269 (29%), Gaps = 90/269 (33%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I M +DVS SM    L+                                        
Sbjct: 91  GIDIVMAMDVSGSMLARDLKP--------------------------------------- 111

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             ++      A + V               R+G + ++         PL+ +   + + L
Sbjct: 112 -DRLTAAKNVASDFVK---------GRPGDRMGLVIFSGETFTQ--VPLTTDHGVMLNML 159

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            ++      + T     +  A   L            S  + K VI +TDG N+  S   
Sbjct: 160 AEMKNGLIDDGTAIGDGLATAISRL----------KDSEAISKVVILLTDGMNNAGSVDP 209

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVS---------------------APPEGQDLLRKCTD 362
            T   +      +  G+++Y++ V                         + + L    + 
Sbjct: 210 YTAAEI-----AKLYGIRVYTIGVGSYGTAPYPVQTPFGTQIQQMKVEIDEKLLASVASM 264

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQS 391
           + G++F    +++L E +++I    + + 
Sbjct: 265 TGGKYFRATSNQKLDEIYEEIDKLERSKI 293


>gi|149371021|ref|ZP_01890616.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
 gi|149355807|gb|EDM44365.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
          Length = 334

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 69/205 (33%), Gaps = 53/205 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            ++  L + A   +N          +   RIG + Y         TPL+++   V S LN
Sbjct: 112 DRLQALKQVAARFIN------GRPND---RIGLVEYAGESYTK--TPLTSDKTVVLSSLN 160

Query: 268 KLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            +         T     +  A   L            ST   K +I +TDGEN+      
Sbjct: 161 SIEYNSIIEGGTAIGMGLATAVNRL----------KESTAKSKVIILLTDGENNSGFIDP 210

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEG----------------------QDLLRKCT 361
              + L +       G+K+Y++ +                            + LL++  
Sbjct: 211 KIASELAV-----EFGIKVYTIGLGTNGMASSPIGILPNGRFQYGNQPVKIDETLLKEIA 265

Query: 362 -DSSGQFFAVNDSRELLESFDKITD 385
             + GQ+F    + +L E +++I  
Sbjct: 266 KTTGGQYFRATSNTKLNEIYEEINK 290


>gi|296170658|ref|ZP_06852233.1| von Willebrand factor [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894647|gb|EFG74381.1| von Willebrand factor [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 335

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 65/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N  +  K  L+KL   + T T   + 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-DSTKRALDKLQFADRTATGEGIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G       ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDAPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + L +    S G  +     +EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAATLQELKSVYATLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|78776855|ref|YP_393170.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497395|gb|ABB43935.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 309

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 44/250 (17%), Positives = 93/250 (37%), Gaps = 36/250 (14%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I + +V  +S   ++ Y  +  D   +            + F  +N   S++       
Sbjct: 59  GIFMMIVALMSPIKDEPYELEPKDGYEIALILDASESMKAQGFDVQNQHLSRF------- 111

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
               DV+ E   + ++      +      V  G  ++         +PL+ ++N +   L
Sbjct: 112 ----DVVKEIVSDFISQ----RKNDNMGLVVFGAYSF-------IASPLTYDVNILNKIL 156

Query: 267 NKLNPYENTNTYPAMHHAYREL-YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           ++L           M   Y  L  +  + ++    S    K  I +TDG    ++   +T
Sbjct: 157 SQLQ--------IGMAGKYTALNTSLAQGANLLKQSKSKTKIAILLTDG---YSTPQVDT 205

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPE--GQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           +      + ++  G+K+Y + +  P E   + LL+   +S G  F  + + EL E + KI
Sbjct: 206 ITLDIALDMIKKEGIKVYPIGIGMPHEYNTEALLKIANESGGVAFGASSAAELQEVYKKI 265

Query: 384 TDKIQEQSVR 393
               + +  R
Sbjct: 266 DSLEKSKIKR 275


>gi|257058175|ref|YP_003136063.1| von Willebrand factor type A [Cyanothece sp. PCC 8802]
 gi|256588341|gb|ACU99227.1| von Willebrand factor type A [Cyanothece sp. PCC 8802]
          Length = 418

 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 78/260 (30%), Gaps = 66/260 (25%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
            L++      E S   L I++ ++LD S SM                             
Sbjct: 24  QLAISLWATGEDSDRTLPINLGLILDRSGSM----------------------------- 54

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
                             + ++ + E+A  LV        +      R+  I +N     
Sbjct: 55  ----------------RAQAMETVKEAANYLV--------DGLGPDDRLSVITFNHHAEV 90

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                   +L  VK+++N+L     T     M    +E    KE+  +          + 
Sbjct: 91  ILPNQSVEDLQGVKNKINRLTASGGTCIDEGMKLGIKEAALGKENRVSQ---------IF 141

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
            +TDGEN       +    L++ +      + + ++   +      L +    + G    
Sbjct: 142 LLTDGENEHG----DNERCLKLAKVAAEYNITLNTLGFGSNWNQDILEQIADSAGGMLCY 197

Query: 370 VNDSRELLESFDKITDKIQE 389
           +    + L  F ++  + Q 
Sbjct: 198 IEHPEQALTEFSRLFTRAQS 217


>gi|121637412|ref|YP_977635.1| hypothetical protein BCG_1543 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224989887|ref|YP_002644574.1| hypothetical protein JTY_1518 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|166979775|sp|A1KIS1|Y1543_MYCBP RecName: Full=UPF0353 protein BCG_1543
 gi|254800546|sp|C1ANC7|Y1518_MYCBT RecName: Full=UPF0353 protein JTY_1518
 gi|121493059|emb|CAL71530.1| Probable membrane protein [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224773000|dbj|BAH25806.1| hypothetical protein JTY_1518 [Mycobacterium bovis BCG str. Tokyo
           172]
          Length = 335

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|94970371|ref|YP_592419.1| von Willebrand factor, type A [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552421|gb|ABF42345.1| von Willebrand factor, type A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 356

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 76/181 (41%), Gaps = 23/181 (12%)

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
           ESA   +N I +   +     V    I ++           +++ + +   +  L P   
Sbjct: 155 ESAIEFLNQIIR--PKFDKAFV----IGFD--TTAEVTQDFTDDTDLLGKGVRMLRPGGG 206

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T  Y A+++A       ++      G+T ++K +I ++DGE++     Q+ +   +  E 
Sbjct: 207 TAMYDAIYYA------CRDKLLKENGNTAMRKAMILLSDGEDN-----QSRVTREEAVEM 255

Query: 335 MRNAGMKIYSVAVSAPP----EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            + A + IY+++ +         + L R    + G+ F      ++  +F +I D+++ Q
Sbjct: 256 AQRAEVIIYAISTNTSGLKLRGDKVLERFAEATGGRAFFPFKISDVANAFSEIQDELRSQ 315

Query: 391 S 391
            
Sbjct: 316 Y 316


>gi|15608619|ref|NP_215997.1| hypothetical protein Rv1481 [Mycobacterium tuberculosis H37Rv]
 gi|31792676|ref|NP_855169.1| hypothetical protein Mb1517 [Mycobacterium bovis AF2122/97]
 gi|148661274|ref|YP_001282797.1| hypothetical protein MRA_1491 [Mycobacterium tuberculosis H37Ra]
 gi|148822701|ref|YP_001287455.1| hypothetical protein TBFG_11510 [Mycobacterium tuberculosis F11]
 gi|167968028|ref|ZP_02550305.1| hypothetical membrane protein [Mycobacterium tuberculosis H37Ra]
 gi|215403336|ref|ZP_03415517.1| hypothetical protein Mtub0_06533 [Mycobacterium tuberculosis
           02_1987]
 gi|215411140|ref|ZP_03419948.1| hypothetical protein Mtub9_07385 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215426820|ref|ZP_03424739.1| hypothetical protein MtubT9_10680 [Mycobacterium tuberculosis T92]
 gi|215430374|ref|ZP_03428293.1| hypothetical protein MtubE_06801 [Mycobacterium tuberculosis
           EAS054]
 gi|215445676|ref|ZP_03432428.1| hypothetical protein MtubT_06934 [Mycobacterium tuberculosis T85]
 gi|218753198|ref|ZP_03531994.1| hypothetical protein MtubG1_07054 [Mycobacterium tuberculosis GM
           1503]
 gi|219557390|ref|ZP_03536466.1| hypothetical protein MtubT1_08827 [Mycobacterium tuberculosis T17]
 gi|253799469|ref|YP_003032470.1| hypothetical protein TBMG_02500 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231712|ref|ZP_04925039.1| hypothetical protein TBCG_01457 [Mycobacterium tuberculosis C]
 gi|254364352|ref|ZP_04980398.1| hypothetical membrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550498|ref|ZP_05140945.1| hypothetical protein Mtube_08557 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260186427|ref|ZP_05763901.1| hypothetical protein MtubCP_10429 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260204765|ref|ZP_05772256.1| hypothetical protein MtubK8_10713 [Mycobacterium tuberculosis K85]
 gi|289447084|ref|ZP_06436828.1| membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289554729|ref|ZP_06443939.1| membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289569506|ref|ZP_06449733.1| membrane protein [Mycobacterium tuberculosis T17]
 gi|289574162|ref|ZP_06454389.1| membrane protein [Mycobacterium tuberculosis K85]
 gi|289745232|ref|ZP_06504610.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289750042|ref|ZP_06509420.1| membrane protein [Mycobacterium tuberculosis T92]
 gi|289753564|ref|ZP_06512942.1| hypothetical protein TBGG_00680 [Mycobacterium tuberculosis EAS054]
 gi|289757593|ref|ZP_06516971.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289761639|ref|ZP_06521017.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294993225|ref|ZP_06798916.1| hypothetical protein Mtub2_01637 [Mycobacterium tuberculosis 210]
 gi|297634047|ref|ZP_06951827.1| hypothetical protein MtubK4_07987 [Mycobacterium tuberculosis KZN
           4207]
 gi|297731033|ref|ZP_06960151.1| hypothetical protein MtubKR_08072 [Mycobacterium tuberculosis KZN
           R506]
 gi|298524990|ref|ZP_07012399.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306775670|ref|ZP_07414007.1| membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|306779490|ref|ZP_07417827.1| membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|306784220|ref|ZP_07422542.1| membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|306788587|ref|ZP_07426909.1| membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|306792930|ref|ZP_07431232.1| membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306797308|ref|ZP_07435610.1| membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|306803189|ref|ZP_07439857.1| membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|306967588|ref|ZP_07480249.1| membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|306971779|ref|ZP_07484440.1| membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|307079498|ref|ZP_07488668.1| membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|307084057|ref|ZP_07493170.1| membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|313658366|ref|ZP_07815246.1| hypothetical protein MtubKV_08092 [Mycobacterium tuberculosis KZN
           V2475]
 gi|54040185|sp|P64856|Y1517_MYCBO RecName: Full=UPF0353 protein Mb1517
 gi|54042534|sp|P64855|Y1481_MYCTU RecName: Full=UPF0353 protein Rv1481/MT1528
 gi|166979870|sp|A5U2I5|Y1491_MYCTA RecName: Full=UPF0353 protein MRA_1491
 gi|3261503|emb|CAA16011.1| PROBABLE MEMBRANE PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|31618266|emb|CAD96184.1| PROBABLE MEMBRANE PROTEIN [Mycobacterium bovis AF2122/97]
 gi|124600771|gb|EAY59781.1| hypothetical protein TBCG_01457 [Mycobacterium tuberculosis C]
 gi|134149866|gb|EBA41911.1| hypothetical membrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505426|gb|ABQ73235.1| putative membrane protein [Mycobacterium tuberculosis H37Ra]
 gi|148721228|gb|ABR05853.1| hypothetical membrane protein [Mycobacterium tuberculosis F11]
 gi|253320972|gb|ACT25575.1| membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289420042|gb|EFD17243.1| membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289439361|gb|EFD21854.1| membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289538593|gb|EFD43171.1| membrane protein [Mycobacterium tuberculosis K85]
 gi|289543260|gb|EFD46908.1| membrane protein [Mycobacterium tuberculosis T17]
 gi|289685760|gb|EFD53248.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289690629|gb|EFD58058.1| membrane protein [Mycobacterium tuberculosis T92]
 gi|289694151|gb|EFD61580.1| hypothetical protein TBGG_00680 [Mycobacterium tuberculosis EAS054]
 gi|289709145|gb|EFD73161.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289713157|gb|EFD77169.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298494784|gb|EFI30078.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215767|gb|EFO75166.1| membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308327531|gb|EFP16382.1| membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308330994|gb|EFP19845.1| membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308334816|gb|EFP23667.1| membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308338604|gb|EFP27455.1| membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308342306|gb|EFP31157.1| membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308350100|gb|EFP38951.1| membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308354737|gb|EFP43588.1| membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308358644|gb|EFP47495.1| membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308362622|gb|EFP51473.1| membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308366304|gb|EFP55155.1| membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323719929|gb|EGB29041.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326903107|gb|EGE50040.1| membrane protein [Mycobacterium tuberculosis W-148]
 gi|328459217|gb|AEB04640.1| membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 335

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|262193845|ref|YP_003265054.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
 gi|262077192|gb|ACY13161.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
          Length = 346

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 46/290 (15%), Positives = 90/290 (31%), Gaps = 89/290 (30%)

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
            + E +     I+I MV+D S SM                                   +
Sbjct: 80  AVGENTIRREGIAIMMVVDTSGSM-----------------------------------R 104

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS 256
           +           +++V+ +     V           +    IG +++      +   PL+
Sbjct: 105 ALDLADGGLDQTRLEVVKDVFRAFVAGEDGLDGRSNDT---IGLVSF--AGFADTRCPLT 159

Query: 257 NNLNEVKSRLNKL-----NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFI 311
            N   + + L+ L        + T     +  A   L            S    + +I +
Sbjct: 160 LNHGSLLTILDDLEIVRERAEDGTAIGDGLGLAVERL----------RESEASSRVIILL 209

Query: 312 TDGENSGASAYQNTLNT-LQICEYMRNAGMKIYSVA----------VSAPPEGQDLLR-- 358
           TDG N+        + T L+  E     G+K+Y++           V+ P  G + LR  
Sbjct: 210 TDGVNNA------GIETPLEAAELASRLGIKVYTIGAGTDGVAPVRVTNPLTGAEELRPM 263

Query: 359 -----------KCTDSSGQFFAVNDSRELLESFDKITD----KIQEQSVR 393
                          + G++F   D   L + +++I      +I E+ +R
Sbjct: 264 PVEIDEATLEAIAEHTGGRYFRATDGDGLRQVYEQIDRLERTEISERRLR 313


>gi|261415414|ref|YP_003249097.1| von Willebrand factor type A [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261371870|gb|ACX74615.1| von Willebrand factor type A [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302325633|gb|ADL24834.1| BatA protein [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 367

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 46/290 (15%), Positives = 90/290 (31%), Gaps = 73/290 (25%)

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
            +    + I + LDVS SM  L +    +   +           +  +W           
Sbjct: 87  YTSTDGVDIMLALDVSGSMGTLDMLTRTEQAKLGVMN-AEKILKRGEYW----------- 134

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN-LN 260
                  ++    +     +          K  S RIG  A+           +    L 
Sbjct: 135 ----KYSRLGYAQDVIAEFIG---------KRHSDRIGLSAFGARSFTQCPLTMDYGSLL 181

Query: 261 EVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
           E+    + L         T     + +A   L            S    + VI +TDG +
Sbjct: 182 EILKASDDLARDTLVNNRTAIGDGLMNALARL----------KMSDAKSRVVILLTDGRD 231

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVS-------------------------APP 351
           +      + +  ++  E  ++ G+K+Y+V V                           P 
Sbjct: 232 NA-----SVVPPVRAAEVAKSLGVKVYTVGVGKKSGKILAFQQNPWTGEISWGERDITPE 286

Query: 352 EG--QDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           EG  +D+L+     + G+F+   +  EL + + +I +  + +   IA  R
Sbjct: 287 EGIDEDVLKAIASKTGGRFYRAENKAELEKIYSEIDELEKTEIETIAYAR 336


>gi|86361153|ref|YP_473040.1| hypothetical protein RHE_PF00423 [Rhizobium etli CFN 42]
 gi|86285255|gb|ABC94313.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 545

 Score = 63.4 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 49/326 (15%), Positives = 103/326 (31%), Gaps = 32/326 (9%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A+ +    + +  + D      +R +MQS LDAA+++    I      +D    K++ S 
Sbjct: 123 ALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQI---NNTEDTDALKEKVSD 179

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
            F  Q+      G               I+I    +N       + A   +PT       
Sbjct: 180 WFHAQVDNSYTLGD--------------IDIDTVNHN-----ITATANGTVPT------T 214

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
            +  A       S     +      +++ +V+D S SM                      
Sbjct: 215 FMKIANIETVPVSVASAVKGPATSYLNVYVVIDTSPSMLLAATTSGQSTMYSGIGCQFAC 274

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANR-KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                    K    + YA + A   + + DV  ++   +++ I ++  ++ +  +++G  
Sbjct: 275 HTGDAHTVGKTKYANNYAYSTAKKIKLRADVAGDAVREVLDMIDES--DENHERIKVGLY 332

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT-NTYPAMHHAYRELYNEKESSHNTIG 300
           +    +       LS +    +           T         +   L  +  +  +   
Sbjct: 333 SLGDTLSEVLAPTLSTDTARTRLADASYGLTSATSKAATYFDVSLATLKQKVGAGGDGTS 392

Query: 301 STRLKKFVIFITDGENSGASAYQNTL 326
           S    K V+ +TDG  S      + +
Sbjct: 393 SGSPLKLVLLLTDGVQSKREWVTDGV 418


>gi|262202333|ref|YP_003273541.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
 gi|262085680|gb|ACY21648.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
          Length = 325

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 76/236 (32%), Gaps = 30/236 (12%)

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                   +P          + ++S  A   AP   +I     +A    + + + I    
Sbjct: 75  AGPQADRQVPRNKATVILVMDVSRSMNATDVAP--SRIRAAQSAAKKFADDLTEGIN--- 129

Query: 233 NLSVRIGTIAY-NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
                +G I++          TP   +    K  ++KL   + T T   +  A  ++   
Sbjct: 130 -----LGLISFAGTPSTLVSPTP---DHTATKKAVDKLVLADKTATGEGIFAALDQI--R 179

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--- 348
             ++            ++ ++DG+ +      +           +  G+ + +++     
Sbjct: 180 TLNAVLGGPEAAPPAHIVLLSDGKQTVPDEPTDPRGAFTAARKAKEEGIPVSTISFGTAY 239

Query: 349 -----------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                       P +   L +    S G FF  +   EL E ++K+  +I  ++ R
Sbjct: 240 GTVELDGDRVPVPVDDPSLKQIANLSGGNFFTASSLDELNEVYEKLQSEIGYETRR 295


>gi|218245149|ref|YP_002370520.1| von Willebrand factor type A [Cyanothece sp. PCC 8801]
 gi|218165627|gb|ACK64364.1| von Willebrand factor type A [Cyanothece sp. PCC 8801]
          Length = 418

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 78/260 (30%), Gaps = 66/260 (25%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
            L++      E S   L I++ ++LD S SM                             
Sbjct: 24  QLAISLWATGEDSDRTLPINLGLILDRSGSM----------------------------- 54

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
                             + ++ + E+A  LV        +      R+  I +N     
Sbjct: 55  ----------------RAQAMETVKEAANYLV--------DGLGPDDRLSVITFNHHAEV 90

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                   +L  VK+++N+L     T     M    +E    KE+  +          + 
Sbjct: 91  ILPNQSVEDLQGVKNKINRLTASGGTCIDEGMKLGIKEAALGKENRVSQ---------IF 141

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
            +TDGEN       +    L++ +      + + ++   +      L +    + G    
Sbjct: 142 LLTDGENEHG----DNERCLKLAKVAAEYNITLNTLGFGSNWNQDILEQIADSAGGMLCY 197

Query: 370 VNDSRELLESFDKITDKIQE 389
           +    + L  F ++  + Q 
Sbjct: 198 IEHPEQALTEFSRLFTRAQS 217


>gi|52548946|gb|AAU82795.1| conserved hypothetical protein [uncultured archaeon GZfos1C11]
          Length = 438

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 89/245 (36%), Gaps = 44/245 (17%)

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
           TGIIE   +   +++ +VLD+S SM   + +            Y           +++  
Sbjct: 165 TGIIESDFQRKKLNLALVLDISGSMGSSFDE----------YYYDRFGNHVAVNDTEDAE 214

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
           KSK   A A     +D L                       R+G + +N G    +   L
Sbjct: 215 KSKIEIAAAAIVALLDHL-------------------EDDDRLGLVLFNTGAELAEPVSL 255

Query: 256 --SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
             + N+ ++K  + +++    T     M  A  ELY         +  +  +  +IF+TD
Sbjct: 256 VGAKNMQKLKGDVLEISATGGTRLSAGMQMA-TELY----DEFLEVNQSEYENRIIFLTD 310

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYS--VAVSAPPEGQDLLRKCTDSSG-QFFAV 370
              +  ++ Q +  +L            +Y+  + +       +L+   T   G  +++V
Sbjct: 311 ---AMPNSGQTSEESLLGMIEANANK-NVYTTFIGIGVDFN-TELVEYITKIRGANYYSV 365

Query: 371 NDSRE 375
           + + +
Sbjct: 366 HSATQ 370


>gi|237737388|ref|ZP_04567869.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421250|gb|EEO36297.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
          Length = 319

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 69/198 (34%), Gaps = 47/198 (23%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIG------TIAYNIGIVGNQCTPLSNNLNEV 262
           K + L  +   L   I K I ++ +L V  G       + ++  +V +  + L+      
Sbjct: 100 KPNRLETAKKLLEEFIDKRINDRISLVVFGGDAYTKVPLTFDHNVVKDITSKLTT----- 154

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
               + +     T     +  +   L            S    K +I +TDGEN+     
Sbjct: 155 ----DDITSNNRTAIGMGLGVSLNRL----------KDSEAKSKVIILMTDGENNSGEMS 200

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAP------PEGQD----------LLRKCTD-SSG 365
               + +      +  G+KIY++ + A       P G            LL+     + G
Sbjct: 201 PMGASEI-----AKELGIKIYTIGIGAREIQIRVPFGHTTVKNTELDENLLKNIASTTGG 255

Query: 366 QFFAVNDSRELLESFDKI 383
           ++F     +E  E F++I
Sbjct: 256 EYFRAGSEKEFQEIFNRI 273


>gi|300120207|emb|CBK19761.2| unnamed protein product [Blastocystis hominis]
          Length = 474

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 60/155 (38%), Gaps = 18/155 (11%)

Query: 252 CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFI 311
              L+ +  +V+  ++       TN   A+  A+R L N +    +          ++ I
Sbjct: 167 LQELTYDACDVRKAIDSDRMSGLTNIAKAIEEAHRILKNSRSDIPDQ---------IVLI 217

Query: 312 TDG-------ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
           TDG        N     +      ++     +   ++IY++ V A    +D LR+   S 
Sbjct: 218 TDGFQTVHSSINCNDHPHDCNAYAIEKARAAKADDIQIYTIGVGAASYYEDDLRQIASSP 277

Query: 365 -GQFFA-VNDSRELLESFDKITDKIQEQSVRIAPN 397
             Q+F+ V+D   +    +K+ +       +I P+
Sbjct: 278 SDQYFSLVDDYSSIQTVREKLQNSTCPLVTQILPD 312


>gi|170750695|ref|YP_001756955.1| von Willebrand factor type A [Methylobacterium radiotolerans JCM
           2831]
 gi|170657217|gb|ACB26272.1| von Willebrand factor type A [Methylobacterium radiotolerans JCM
           2831]
          Length = 345

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 58/165 (35%), Gaps = 24/165 (14%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELY--- 289
            RIG + +              +   V   L++        +T     +  A R L    
Sbjct: 147 DRIGLVIFADQAYVAAAPSF--DTAAVARALDEATIGISGRSTGIGDGLGLALRRLDPRD 204

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV-- 347
              E++  +    +  K VI ++DG N+        +  L      R  G+K+Y++A+  
Sbjct: 205 AGGEAASGSKPGEKPAKAVILLSDGANNAGQTAPKDVAEL-----ARELGIKVYTIALGP 259

Query: 348 --SAPPEG-------QDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
              A  +G       + L      S G+ F V  + +L+   D I
Sbjct: 260 RDMADADGEQDVVDTETLRDMARASGGEAFRVRTTEDLVRVADAI 304


>gi|218192066|gb|EEC74493.1| hypothetical protein OsI_09963 [Oryza sativa Indica Group]
          Length = 641

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 38/305 (12%), Positives = 87/305 (28%), Gaps = 70/305 (22%)

Query: 33  LDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI-RENAGDIAQKAQI 91
            D A      S V+    +   +   + S  +   +++ L            D       
Sbjct: 135 ADTAYGRARVSPVNWPQDEGQMSVVRRLSRGYSGNLQQQLAVFRTPEASIFNDDENIDPQ 194

Query: 92  NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
           + T D +N +    E K   E P      +  + + L +L    +      S    + + 
Sbjct: 195 SETVDDHNAVTKSVEIKTYSEFPAIQKSERRKVFAILIHLKAPKSLDS--VSSRAPLDLV 252

Query: 152 MVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
            VLDVS SM  +                                             K+ 
Sbjct: 253 TVLDVSGSMSGI---------------------------------------------KLS 267

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN----NLNEVKSRLN 267
           +L  +   ++ ++        +   R+  +A++      +  PL         +    ++
Sbjct: 268 LLKRAMSFVIQTL-----GPND---RLSVVAFSS--TAQRLFPLRRMTLTGRQQALQAIS 317

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     TN   A+    + + + +               +I ++DG+++ +    +  +
Sbjct: 318 SLVASGGTNIADALKKGAKVVKDRRR--------KNPVSSIILLSDGQDTHSFLSGSIQD 369

Query: 328 TLQIC 332
               C
Sbjct: 370 AFAQC 374


>gi|156976371|ref|YP_001447277.1| hypothetical protein VIBHAR_05144 [Vibrio harveyi ATCC BAA-1116]
 gi|156527965|gb|ABU73050.1| hypothetical protein VIBHAR_05144 [Vibrio harveyi ATCC BAA-1116]
          Length = 334

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 37/258 (14%), Positives = 77/258 (29%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM+   +  +                                        
Sbjct: 98  DMMLVVDLSGSMQKEDMNDN-----------------------------------GEYID 122

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + V          K    R+G + +         TPL+ +   V  ++N+
Sbjct: 123 RLTAVKRVLSDFVE---------KRQGDRLGVVLFGDHAYLQ--TPLTADRKTVMQQINQ 171

Query: 269 LNPY--EN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +    +   +          S   ++ +I ++DG N+        
Sbjct: 172 TVIGLVGQRTAIGDGIGLGTKTFVD----------SDAPQRVMILLSDGSNTAG-----V 216

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ L+  E  +     IY+V V A                    + Q L +    + G++
Sbjct: 217 LDPLEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTRKVNTASELDEQTLTKIAEMTGGKY 276

Query: 368 FAVNDSRELLESFDKITD 385
           F   D++EL   +D I  
Sbjct: 277 FRARDAKELETIYDTINQ 294


>gi|153831781|ref|ZP_01984448.1| von Willebrand factor, type A [Vibrio harveyi HY01]
 gi|148872291|gb|EDL71108.1| von Willebrand factor, type A [Vibrio harveyi HY01]
          Length = 334

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 37/258 (14%), Positives = 77/258 (29%), Gaps = 82/258 (31%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +V+D+S SM+   +  +                                        
Sbjct: 98  DMMLVVDLSGSMQKEDMNDN-----------------------------------GEYID 122

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++  +     + V          K    R+G + +         TPL+ +   V  ++N+
Sbjct: 123 RLTAVKRVLSDFVE---------KRQGDRLGVVLFGDHAYLQ--TPLTADRKTVMQQINQ 171

Query: 269 LNPY--EN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                    T     +    +   +          S   ++ +I ++DG N+        
Sbjct: 172 TVIGLVGQRTAIGDGIGLGTKTFVD----------SDAPQRVMILLSDGSNTAG-----V 216

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPP------------------EGQDLLRKCTDSSGQF 367
           L+ L+  E  +     IY+V V A                    + Q L +    + G++
Sbjct: 217 LDPLEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTRKVNTASDLDEQTLTKIAEMTGGKY 276

Query: 368 FAVNDSRELLESFDKITD 385
           F   D++EL   +D I  
Sbjct: 277 FRARDAKELETIYDTINQ 294


>gi|59713412|ref|YP_206187.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59481660|gb|AAW87299.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 423

 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 55/419 (13%), Positives = 120/419 (28%), Gaps = 63/419 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F     A D A  +  + +++ A + A L+  A    D+      T   + 
Sbjct: 15  LFAMMIPALFGIFALASDGARAIQTKARIEDASEVAALAISAHNDPDQPDNGSYTPSTRN 74

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA-QYEIPTENLF 119
             I    +  ++     + +      +   I+          Y  +++  ++EI      
Sbjct: 75  RQIVVDYVNAYISDIDAVTDIKVAKRRCELISGCV----AGLYKGDARYLEHEIDVTTRQ 130

Query: 120 LKGLIPSALT-----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                 +          S R   +  +     A+ +    D S SM D +    N     
Sbjct: 131 NSWFPGNEAIEGMGETFSTRGKSLARKYQSE-AVDVMFAADFSGSMLDTWSGSSNPKYID 189

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL----------------IESAG 218
                       + F      + K     +  +   +                      G
Sbjct: 190 LIEIIRNISVELQKFNDLPENRDKSTMGISAFSTFTNSFTSDTGIQCSLSQGVNSKNKPG 249

Query: 219 NLVNSIQKAI------QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
           N    ++ A        EK     + G  A      G     L++N N +  ++      
Sbjct: 250 NWFRPVKPANTVANIWNEKTEDYCKSGAYA------GFHDVNLTSNFNSLNGQVGSFYAG 303

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T +Y A+    + L                ++ +I ++DG ++  +   N L +  +C
Sbjct: 304 GGTASYQALIRGAQLL----------DRGRNSRRLLIVLSDGMDNDRNLA-NGLVSNGMC 352

Query: 333 EYMRNA------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
             ++                K+  +     P     L+ C       +   D+ E+ + 
Sbjct: 353 REIQAGLESDRTPDGRPIAAKMAVIGFDYDPFANKALKDCV-GEKNVYKAEDADEVEDI 410


>gi|51244490|ref|YP_064374.1| hypothetical protein DP0638 [Desulfotalea psychrophila LSv54]
 gi|50875527|emb|CAG35367.1| conserved hypothetical membrane protein (BatA) [Desulfotalea
           psychrophila LSv54]
          Length = 328

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 33/271 (12%), Positives = 76/271 (28%), Gaps = 84/271 (30%)

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
           G   R  ++  I I + +DVS SM+ +    +                            
Sbjct: 76  GNTTREIKSSGIDILLAVDVSGSMQAMDFTLN---------------------------- 107

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS 256
                       +++V+ +     ++          +    IG +A+           L 
Sbjct: 108 -------GKRTNRLEVVKDVMAKFISQ------RPNDS---IGLVAFAGRPYVVCPPTLD 151

Query: 257 --NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG 314
                  + S    +   + T    A+      L  +K             + +I +TDG
Sbjct: 152 HNWLTLRLHSLSIGMIE-DGTAIGSAIGTGVNRLREKK----------SPSQIIILLTDG 200

Query: 315 ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS----------------------APPE 352
            N+        +  L   E  ++  +K+Y++                            +
Sbjct: 201 INNAGK-----VPPLIAAEAAKSFKVKVYTIGAGTRGEAPIPITDAFGRRQLVRARVDID 255

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
            + L +    +  ++F   D+  L + + +I
Sbjct: 256 DKTLSKVAQITGARYFRATDTESLEKVYAEI 286


>gi|313674519|ref|YP_004052515.1| von willebrand factor type a [Marivirga tractuosa DSM 4126]
 gi|312941217|gb|ADR20407.1| von Willebrand factor type A [Marivirga tractuosa DSM 4126]
          Length = 345

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 85/272 (31%), Gaps = 91/272 (33%)

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
            I I +VLD+S SM+      +                                      
Sbjct: 104 GIDIMLVLDISESMKIQDFTPN-------------------------------------- 125

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++   + A + ++              RIG   ++        +PL+ +   +K+++
Sbjct: 126 --RLEAAKQVANDFID---------GRFQDRIGLTIFSGE--AYSLSPLTTDYKMLKNQI 172

Query: 267 N----KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
                K+     T    A+      +      S          K +I ++DG+N+  +  
Sbjct: 173 TDIDFKMMEASGTAIGSALAVGTNRMRESDSKS----------KVLILLSDGDNNAGNID 222

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPE---GQDL---------------LRKCTD-S 363
             T   L         G+KIY++A+    +   G+D                L+      
Sbjct: 223 PETSAKL-----ANAYGIKIYTIAIGKEGKVPYGKDFFGRTRYIENSMDVTGLKNIAKIG 277

Query: 364 SGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
            GQF+   D++ L E F  I    K + +  R
Sbjct: 278 EGQFYRATDNQALEEVFSIIDQYEKAEIKETR 309


>gi|118617151|ref|YP_905483.1| hypothetical protein MUL_1490 [Mycobacterium ulcerans Agy99]
 gi|166979868|sp|A0PNU3|Y1490_MYCUA RecName: Full=UPF0353 protein MUL_1490
 gi|118569261|gb|ABL04012.1| membrane protein [Mycobacterium ulcerans Agy99]
          Length = 335

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKAALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYVSLQQQIG 299

Query: 389 EQSVR 393
            +++R
Sbjct: 300 YETIR 304


>gi|307352559|ref|YP_003893610.1| von Willebrand factor type A [Methanoplanus petrolearius DSM 11571]
 gi|307155792|gb|ADN35172.1| von Willebrand factor type A [Methanoplanus petrolearius DSM 11571]
          Length = 1022

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 37/270 (13%), Positives = 84/270 (31%), Gaps = 44/270 (16%)

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             I + +  D S SM   Y  +     +   +  +            +      A     
Sbjct: 525 DPIDVMLTADRSGSMLRDYPDRMVSLMDALEDFGIEMKEGWDRLGLASFGTYGNADIIDY 584

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
            NR       S  +    I +                YN     +    L+ + ++  + 
Sbjct: 585 GNRYWAGYDNSYYDDWEYISEHYAGNDK--------NYNDYATID--LNLTEDFSDYNTE 634

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS-------- 317
           +  L P   T     ++++ + L +               K V+ ++DG+ +        
Sbjct: 635 VKALVPDGGTPMRKGLYYSIKHLRDNGRDDAV--------KAVVVLSDGDYNYYGDPLAR 686

Query: 318 -------GASAYQNTLNTLQICEY--------MRNAGMKIYSVAVSA--PPEGQDLLRKC 360
                    S  Q    T               ++  +KI+S+A +     EG+ +L+  
Sbjct: 687 GSGGTKWDWSDMQEKYYTFSDLNSSEQDMRIFAKDNDIKIFSIAYADGISSEGKAVLQAL 746

Query: 361 TD-SSGQFFAVNDSRELLESFDKITDKIQE 389
            + + G+++      +L E ++ I  +++E
Sbjct: 747 AEGTGGKYYYAPSGEDLEEIYEDIAGELKE 776


>gi|319956032|ref|YP_004167295.1| von willebrand factor type a [Nitratifractor salsuginis DSM 16511]
 gi|319418436|gb|ADV45546.1| von Willebrand factor type A [Nitratifractor salsuginis DSM 16511]
          Length = 306

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 86/256 (33%), Gaps = 66/256 (25%)

Query: 141 RSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYA 200
           +  +     I +V+D S SM                             W  +       
Sbjct: 76  KEIKKKGRDIMLVIDSSDSMNQ---------------------------WGFDPGD---- 104

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
               P   K DV+ E  G+ ++         K  + RIG I +    V    +PL+   +
Sbjct: 105 ----PNKSKFDVVKEVVGDFID---------KRKNDRIGLINFAS--VAFVASPLTFEKD 149

Query: 261 EVKSRLNKLNPYEN---TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            ++  L    P      T    A+   Y  L      S          K  I +TDG ++
Sbjct: 150 FLRKILQMQEPGIAGKRTAINDALLQTYNILSKSDAKS----------KIAILLTDGIDN 199

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-LLRKCTDSS-GQFFAVNDSRE 375
            +    + +  L     + ++ +K+Y++ + +  +     L+    +  G+FFA +D R 
Sbjct: 200 ASRISFDEIRRL-----ISDSDIKLYTIGIGSYRDFDAPYLKALAQAGHGRFFAASDRRS 254

Query: 376 LLESFDKITDKIQEQS 391
           L + ++ I      + 
Sbjct: 255 LQKIYEAIDRLETSKI 270


>gi|6469599|gb|AAF13350.1|AF121336_1 unknown [Eufolliculina uhligi]
          Length = 494

 Score = 63.0 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 57/333 (17%), Positives = 100/333 (30%), Gaps = 86/333 (25%)

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINIT---KDKNNPLQYIAESKAQYEIPTENLFLK 121
            KQ   + +    I+  AGD A    I I    ++        A   A Y +   N    
Sbjct: 2   SKQRHSNPESFGSIQSGAGDFADDDPIQIIRGQEESKGEPTVGAVDIAAYGVFAFNYLQ- 60

Query: 122 GLIPSALTNLSLRSTGII---ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
            L P     +              +    + I  V+DVS SM+                 
Sbjct: 61  -LSPEKAQEIPCTINLESPAQTSEASRSGVDIVCVIDVSGSMQG---------------- 103

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                                         KI ++  +   +V  +  A         RI
Sbjct: 104 -----------------------------EKIQLVQTTLNFMVERLSPAD--------RI 126

Query: 239 GTIAY-NIGIVGNQCTPLS-NNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
             I++ N     ++   +S     ++KS + +L     TN    + +  + L   +  + 
Sbjct: 127 CLISFSNDATKISRLVQMSPKGKKQLKSMIPRLVASGGTNIVGGLEYGLQALRQRRTINQ 186

Query: 297 NTIGSTRLKKFVIFITDG-ENSGASAYQNTLNTLQICEYMRNAGMKI---YSVAVSAPPE 352
            +         +I ++DG +N+G +  Q    T+          + I   YSV       
Sbjct: 187 LSS--------IILLSDGQDNNGTTVLQRAKATM--------DSIVIRDDYSVHTFGYGH 230

Query: 353 GQD--LLRKCTDSS-GQFFAVNDSRELLESFDK 382
           G D  LL    +   G F+ V D   +  +F  
Sbjct: 231 GHDSTLLNALAEPKNGAFYYVKDEETIATAFAN 263


>gi|126731914|ref|ZP_01747718.1| BatB protein, putative [Sagittula stellata E-37]
 gi|126707741|gb|EBA06803.1| BatB protein, putative [Sagittula stellata E-37]
          Length = 323

 Score = 63.0 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 84/243 (34%), Gaps = 70/243 (28%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            I M +D+S SME+                                              
Sbjct: 92  DIMMAIDLSGSMEERDFAVG-----------------------------------GRPAT 116

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++ E+A + ++         +    R+G + ++         PL+ +   V+  L++
Sbjct: 117 RLSIVKETADDFIS---------RRDGDRLGLVLFSDRAYLQA--PLTFDREAVRKLLDQ 165

Query: 269 LN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  + T    A+  + + L +  E            + ++ +TDG N+     +  
Sbjct: 166 AQVGLTGQKTAIGDAIAVSVKRLKDRPEDG----------RVLVLLTDGANN-----EGV 210

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDL----LRKCTD-SSGQFFAVNDSRELLESF 380
           ++  +  +     G++IY++ V      +DL    LR+  D + G +F   D + L + +
Sbjct: 211 MSPDKAADLAAKLGIRIYTIGVG-SARSRDLDERTLRQIADATGGAYFRATDVQGLAQIY 269

Query: 381 DKI 383
             I
Sbjct: 270 RAI 272


>gi|188994393|ref|YP_001928645.1| aerotolerance-related membrane protein BatA [Porphyromonas
           gingivalis ATCC 33277]
 gi|188594073|dbj|BAG33048.1| aerotolerance-related membrane protein BatA [Porphyromonas
           gingivalis ATCC 33277]
          Length = 327

 Score = 63.0 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 43/322 (13%), Positives = 90/322 (27%), Gaps = 90/322 (27%)

Query: 86  AQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSEN 145
           A+K    +T     P +        Y   +  +     +   +  L+        +    
Sbjct: 26  ARKTSATMTISSLKPFEGGRRGLRVYLRHSLPILRALSVGFLIIALARPQNTNSWQKDSI 85

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             I I + +DVS SM+ +  + +                                     
Sbjct: 86  EGIDIMLAMDVSGSMQAMDFKPN------------------------------------- 108

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
              +++   + A + +N            +  IG + +          PL+ +   + + 
Sbjct: 109 ---RLEAAKDVAISFIN---------NRPNDNIGMVTFAGESFTQ--CPLTTDHTVLLNM 154

Query: 266 LNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           +  L      + T     +  A   L            S    + VI +TDG N+     
Sbjct: 155 VQDLQMGVLDDGTAIGMGLATAVNRL----------KDSKAKSRVVILLTDGSNNMG--- 201

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK---------------------CT 361
              +      +  R  G+++Y+V V    E    ++                        
Sbjct: 202 --DITPRMAADIARTFGIRVYTVGVGTRGEAPFPIQTEFGVRIQNVPVDIDEPTLDGIAE 259

Query: 362 DSSGQFFAVNDSRELLESFDKI 383
            S G++F   D+  L E + +I
Sbjct: 260 VSGGKYFRAVDNETLNEIYKEI 281


>gi|307721534|ref|YP_003892674.1| von Willebrand factor A [Sulfurimonas autotrophica DSM 16294]
 gi|306979627|gb|ADN09662.1| von Willebrand factor type A [Sulfurimonas autotrophica DSM 16294]
          Length = 303

 Score = 63.0 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 46/271 (16%), Positives = 90/271 (33%), Gaps = 67/271 (24%)

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
           + +L+       + SS+     +   LD S SM +      N                  
Sbjct: 61  IFSLASPIIYDQKTSSKRKGRDLVFALDTSGSMAESGFNPENVQ---------------- 104

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
                              NRK D L E   +    I K   +   +S+  GT AY    
Sbjct: 105 -------------------NRKFDALKELLRSF---ITKRYNDNVGVSI-FGTYAY---- 137

Query: 248 VGNQCTPLSNNLNEVK---SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                 PLS ++  V       +     ++T     +  A + L                
Sbjct: 138 ---PAIPLSYDMGSVAFLLDFFDVGIAGDSTAIGEGLAMALKIL----------KKGEAK 184

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-GQDLLRKCT-D 362
           +K +I ITDG  +        ++  +  +  +   +KIY++ +        +LL+    +
Sbjct: 185 EKVIILITDGYQNSG-----AVSVKEAVQKAKKQHVKIYTIGIGDRSAFDANLLQLIAKN 239

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +  + F   + + L + + +I DK++  ++R
Sbjct: 240 TDAKMFEAKNVKMLQDIYKEI-DKLEPSAIR 269


>gi|325927915|ref|ZP_08189139.1| Mg-chelatase subunit ChlD [Xanthomonas perforans 91-118]
 gi|325541755|gb|EGD13273.1| Mg-chelatase subunit ChlD [Xanthomonas perforans 91-118]
          Length = 338

 Score = 63.0 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 87/254 (34%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 101 MMLAVDLSGSMSE--------------------------------------PDMVLGGKV 122

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L+  
Sbjct: 123 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLSDS 174

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 175 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----AL 219

Query: 327 NTLQICEYMRNAGMKIYSVAVS-----------APPEGQD------LLRKCTDSSGQFFA 369
           N L+  E  +  G++++++A              P  G D      L +    + G+FF 
Sbjct: 220 NPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPAGGNDDIDEDGLRKIAQQTGGRFFR 279

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 280 ARDTEELAGIYAEL 293


>gi|150024244|ref|YP_001295070.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
 gi|149770785|emb|CAL42250.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
          Length = 333

 Score = 63.0 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 70/205 (34%), Gaps = 53/205 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++ L E A + V +           S RIG + Y         TP++++   V   +N
Sbjct: 111 NRMEALKEVAASFVEA---------RQSDRIGVVVYTAEAYTK--TPVTSDKAVVLDAIN 159

Query: 268 KLNP----YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            +       + T     +  A   L            S    K +I +TDG N+      
Sbjct: 160 TIKYDNVLQDGTGIGMGLATAVNRL----------KDSKAKSKVIILMTDGVNNAGF--- 206

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVS-----------APPEG-----------QDLLRKCT 361
             +  +   E+ +  G+K+Y++ +            AP  G           + L++   
Sbjct: 207 --IEPVTAAEFAKEFGIKVYTIGIGTNGNAPFPYAIAPNGGFLYKMLPVEIDEQLMKDIA 264

Query: 362 -DSSGQFFAVNDSRELLESFDKITD 385
             + G++F    +  L   + +I  
Sbjct: 265 KKTGGKYFRAQSNSSLESIYSEINK 289


>gi|308375589|ref|ZP_07444436.2| membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308345800|gb|EFP34651.1| membrane protein [Mycobacterium tuberculosis SUMu007]
          Length = 327

 Score = 62.6 bits (150), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 116 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEAIF 173

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 174 TALQAIATVG--AVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 231

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 232 STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIG 291

Query: 389 EQSVR 393
            ++++
Sbjct: 292 YETIK 296


>gi|225872598|ref|YP_002754053.1| von Willebrand factor type A domain protein [Acidobacterium
           capsulatum ATCC 51196]
 gi|225793914|gb|ACO34004.1| von Willebrand factor type A domain protein [Acidobacterium
           capsulatum ATCC 51196]
          Length = 313

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 76/192 (39%), Gaps = 34/192 (17%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
           + +D    +A   +    +A    ++   R+  + +N  +  ++  P +NNL ++   LN
Sbjct: 85  KDLDEEKRAAREFL----RATLRPED---RVEIVNFNTRV--HEVVPFTNNLKKIDRGLN 135

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
           +L+    T  Y A+ +   EL                +K ++ I+DG+N+ A++     +
Sbjct: 136 RLSEGPATALYAAIAYGSEELAQRPG-----------RKVLVVISDGDNTVANS-----S 179

Query: 328 TLQICEYMRNAGMKIYSV--------AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
             Q  +    A   I+SV        A         ++     + G+++   D   L   
Sbjct: 180 YQQALDRAVRAETMIFSVIDLPVINDAGRDVGGEHAMIALSEATGGEYYYEADGN-LQGV 238

Query: 380 FDKITDKIQEQS 391
           F +++  ++ + 
Sbjct: 239 FKRLSTALRTEY 250


>gi|156308416|ref|XP_001617662.1| hypothetical protein NEMVEDRAFT_v1g225902 [Nematostella vectensis]
 gi|156195093|gb|EDO25562.1| predicted protein [Nematostella vectensis]
          Length = 273

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/287 (14%), Positives = 82/287 (28%), Gaps = 95/287 (33%)

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
           RS  +  +S     I I M +DVS SM                                 
Sbjct: 15  RSVDVTAKSRTTKGIDIVMAIDVSGSML-------------------------------- 42

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                   A      ++D L   A   +            ++ RIG + Y         T
Sbjct: 43  --------AKDFKPNRLDALKRVASTFIE---------DRINDRIGLVVYAGESYTR--T 83

Query: 254 PLSNNLNEVKSRLNKLNP-----YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           P++++   +   L  +        + T     +  A   +            S    + +
Sbjct: 84  PITSDKTVILQSLKTVEYDDSIIADGTGIGVGLATAINRI----------KDSKAKSRVI 133

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------APPEGQDLL 357
           I +TDG N+       T++     +  +  G+K+Y++ +                G+ L 
Sbjct: 134 ILLTDGVNNAG-----TIDPRMAADIAKQYGIKVYTIGIGTNGMALFPYAKDQETGKFLF 188

Query: 358 RK-------------CTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           R                 + G++F   D ++L   + +I      + 
Sbjct: 189 RNMQVEIDEKLMKEIAEMTDGKYFRATDDKKLKAIYAEINKLETTEV 235


>gi|83951473|ref|ZP_00960205.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
 gi|83836479|gb|EAP75776.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
          Length = 550

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 53/375 (14%), Positives = 112/375 (29%), Gaps = 82/375 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  +   +       A+D+      R Q+QS LD+AVL+   +        D     +  
Sbjct: 1   MALVFFLIMIAAGGIAVDMMRYEMKRAQIQSTLDSAVLASAGA----PYGSDHRAIIEDY 56

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +         ++   I       +  A  ++T D      Y+ +     E+       
Sbjct: 57  FRVANMTDYLAAEKEGEIVVTVNSASVTANADMTMD-----TYLMKLSGIKEL------- 104

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                        R+TG      +   + + +VLDVS SM       +           L
Sbjct: 105 -------------RTTGGSTAVRKVPKLEVVLVLDVSGSMGSNSKLVNLKKAAKEFVTSL 151

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS-IQKAIQEKKNLSVRIG 239
           L         +   +   ++ + +P+    + L     +  ++ I+    +  + S+  G
Sbjct: 152 LNGSEPG---NTVISIVPFSWSVSPSVATFEALAVDRKHEFSTCIRFKANDHSHASLATG 208

Query: 240 TIAYNIGIVGNQCT--------------------------------PLSNNLNEVKSRLN 267
              ++ G   +Q                                  P S +  E+ ++++
Sbjct: 209 NSGFSSGQPLDQMIYTALYGNFDEFSGSESSSDYRSCYANDYMEILPFSVSETELHAKID 268

Query: 268 KLNPYENTNTYPAMHHA-----------YRELYNEKESSH------NTIGSTRLKKFVIF 310
            L    NT+    M                +L    E +       +  G+    K  + 
Sbjct: 269 SLQASGNTSGNQGMIWGAALLDPSFRQITDDLIAAGEVASSQAAIPSNYGTAETLKVAVV 328

Query: 311 ITDGENSGASAYQNT 325
           + DG+N+ +  + N 
Sbjct: 329 MGDGQNTTSYFFSNG 343



 Score = 54.5 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 25/72 (34%), Gaps = 3/72 (4%)

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFAVNDSRELL 377
              +        C   +N G+ ++S+       G  + +L+ C  S   +F       + 
Sbjct: 475 DGSEKDTRMKASCTATKNEGVVVFSIGFEIDQGGTAEQVLKNCASSENHYFRAE-GININ 533

Query: 378 ESFDKITDKIQE 389
           ++F  I   +  
Sbjct: 534 DAFSAIASNVVN 545


>gi|253584083|ref|ZP_04861281.1| BatA protein [Fusobacterium varium ATCC 27725]
 gi|251834655|gb|EES63218.1| BatA protein [Fusobacterium varium ATCC 27725]
          Length = 319

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 68/193 (35%), Gaps = 45/193 (23%)

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS-----RLN 267
           L ++   L   I K   ++ +L V  G  AY          PL+ + N +K       ++
Sbjct: 104 LEKAKEVLDEFIDKRGNDRLSLIV-FGGDAYT-------KVPLTFDHNVIKEMTRKLTVD 155

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            +     T     +  A   L            S    K +I +TDGEN+      +   
Sbjct: 156 DITSNTRTAIGMGIGVALNRL----------KDSEAKSKVIILLTDGENNSGEMSPS--- 202

Query: 328 TLQICEYMRNAGMKIYSVAVSAPP-----------------EGQDLLRKCTDSSGQFFAV 370
                +  +  G+KIY++ + A                   +   L      + G++F  
Sbjct: 203 --AAADIAKELGIKIYTIGIGAKEIKVPSFFGYKTVKNTELDENMLKSIAETTGGEYFRA 260

Query: 371 NDSRELLESFDKI 383
           +DS+E  E F+KI
Sbjct: 261 SDSKEFKEIFNKI 273


>gi|34541234|ref|NP_905713.1| batA protein [Porphyromonas gingivalis W83]
 gi|34397550|gb|AAQ66612.1| batA protein [Porphyromonas gingivalis W83]
          Length = 327

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/322 (13%), Positives = 90/322 (27%), Gaps = 90/322 (27%)

Query: 86  AQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSEN 145
           A+K    +T     P +        Y   +  +     +   +  L+        +    
Sbjct: 26  ARKTSATMTISSLKPFEGSRRGLRVYLRHSLPILRALSVGFLIIALARPQNTNSWQKDSI 85

Query: 146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
             I I + +DVS SM+ +  + +                                     
Sbjct: 86  EGIDIMLAMDVSGSMQAMDFKPN------------------------------------- 108

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
              +++   + A + +N            +  IG + +          PL+ +   + + 
Sbjct: 109 ---RLEAAKDVAISFIN---------NRPNDNIGMVTFAGESFTQ--CPLTTDHTVLLNM 154

Query: 266 LNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           +  L      + T     +  A   L            S    + VI +TDG N+     
Sbjct: 155 VQDLQMGVLDDGTAIGMGLATAVNRL----------KDSKAKSRVVILLTDGSNNMG--- 201

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK---------------------CT 361
              +      +  R  G+++Y+V V    E    ++                        
Sbjct: 202 --DITPRMAADIARTFGIRVYTVGVGTRGEAPFPIQTEFGVRIQNVPVDIDEPTLDGIAE 259

Query: 362 DSSGQFFAVNDSRELLESFDKI 383
            S G++F   D+  L E + +I
Sbjct: 260 VSGGKYFRAVDNETLNEIYKEI 281


>gi|222478562|ref|YP_002564799.1| von Willebrand factor type A [Halorubrum lacusprofundi ATCC 49239]
 gi|222451464|gb|ACM55729.1| von Willebrand factor type A [Halorubrum lacusprofundi ATCC 49239]
          Length = 491

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 48/348 (13%), Positives = 102/348 (29%), Gaps = 46/348 (13%)

Query: 48  RTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAES 107
              +D      +   I + +    +++  +   + G I        T D   P     E 
Sbjct: 84  EEEEDGVYLIGEVPNIDEGEWPDIVQERDFCAPDVGLINGDQIPVFTLDDVKPGD-CGEV 142

Query: 108 KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSR--SMEDLYL 165
                I     ++         + +  S        E  A+      D     S E    
Sbjct: 143 TISLHICDNPSWVWMNGELTANDENTVSEPEAGADGEGNALGD----DSDGPISGEGELA 198

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ 225
              +       N   +     +        +     + +    +I      A  L  +I 
Sbjct: 199 DAIDVTVWYDENCNNILDADAEEAGDSVCVQLVIDTSGSMGGSRIANTKSGAKQLAETIL 258

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
            A  +      ++G   +N G   +    L+++L++V++ ++ L+    TN    +    
Sbjct: 259 DANPDN-----QVGVTRFNNG--ASTPQQLTDDLDDVEAAIDGLSASGGTNAQAGVDAGQ 311

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGE-NSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            EL N    +          + ++   DG+ N+  SA              + AG +I++
Sbjct: 312 AELENCPHDN----------RVMVVFGDGDINTDGSA-------------AKVAGTEIFA 348

Query: 345 VAVSAPPEGQDL--LRKCTDSS--GQFFAVNDSRELLESFDKITDKIQ 388
           + V     G     L            F   D   + + F ++ + I 
Sbjct: 349 IGV----GGASFSDLEDLASDPADEHVFFAIDDGAIEQIFGQVAETIT 392


>gi|15840942|ref|NP_335979.1| hypothetical protein MT1528 [Mycobacterium tuberculosis CDC1551]
 gi|13881148|gb|AAK45793.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
          Length = 335

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 66/185 (35%), Gaps = 18/185 (9%)

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
              K   ++    + +G IAY  G      +P +N     K+ L+KL   + T T  A+ 
Sbjct: 124 EAAKQFADELTPGINLGLIAY-AGTATVLVSPTTNR-EATKNALDKLQFADRTATGEAIF 181

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            A + +      +    G T     ++  +DG+ +  +   N           ++ G+ I
Sbjct: 182 TALQAIATVG--AVIGGGDTXPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPI 239

Query: 343 YSVAVS--------------APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            +++                 P + + + +    S G  +      EL   +  +  +I 
Sbjct: 240 STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIG 299

Query: 389 EQSVR 393
            ++++
Sbjct: 300 YETIK 304


>gi|56477526|ref|YP_159115.1| hypothetical protein ebA3711 [Aromatoleum aromaticum EbN1]
 gi|56313569|emb|CAI08214.1| hypothetical protein ebA3711 [Aromatoleum aromaticum EbN1]
          Length = 441

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 67/222 (30%), Gaps = 6/222 (2%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+ + V   F   A+D  H+   + ++Q+  DA  L+    +       +  T+ +  
Sbjct: 18  ITALSLVVLVGFAGLALDGGHLYLTKTELQNGADACALAASYELTGSPISPENFTRAENA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK-NNPLQYIAESKAQYEIPTENLF 119
                 + +    QG  I     D+     +  +              +          +
Sbjct: 78  GKTVGTENRVDF-QGGAIAAADIDVTFSTSLAGSWLPAGGATGNSKYVRCTITRNGIAPW 136

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT---S 176
              ++      +S  +T  +  S  N AI + +    S S    +     D  +M    S
Sbjct: 137 FMQVMGFGDQTVSAIATATLAPSQNNCAIPMGLCTHPSSS-APHFGYVKGDWYSMNFKES 195

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
               +        W      +          +++  L E AG
Sbjct: 196 GGGTMENLTGDFRWVDFDPSTTTPNCSGKGAQELSCLFEGAG 237


>gi|310657870|ref|YP_003935591.1| hypothetical protein CLOST_0560 [Clostridium sticklandii DSM 519]
 gi|308824648|emb|CBH20686.1| exported protein of unknown function [Clostridium sticklandii]
          Length = 873

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 83/231 (35%), Gaps = 36/231 (15%)

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
           P  P       +T+ S     P  +   +     +A N  NSI     +      R+G I
Sbjct: 396 PEKPVDVILVIDTSGSMGTRIPGDSKAPLYYAKLAAINFANSIIDENPDS-----RVGVI 450

Query: 242 AYNIGIVGNQCTP-----LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
            ++ G  G          L+NN   + S +N L  +  TN       AY ++        
Sbjct: 451 EFSGGYYGYASDASTVINLTNNKANLASSINGLTTHNMTNIQAGFRLAYNKISA------ 504

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLN-------TLQICEYMRNAGMKI----YSV 345
               +    K V+F+TDG  + +    ++ N       T+      ++    I    +++
Sbjct: 505 -ISSTRDSVKSVVFLTDGVANVSIGNWSSSNPVVHNTHTIAAYTEGQSLYSYINGNLFTI 563

Query: 346 AV-------SAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQ 388
            +       S     +D L+K       +++  + + +L   ++ I+ K++
Sbjct: 564 GLFGAISNSSVKSIARDTLQKAVYDDLEKYYEASSAVDLGPVYETISQKLE 614


>gi|225621320|ref|YP_002722578.1| von Willebrand factor type A (vWA) domain-containing protein
           [Brachyspira hyodysenteriae WA1]
 gi|225216140|gb|ACN84874.1| von Willebrand factor type A (vWA) domain containing protein
           [Brachyspira hyodysenteriae WA1]
          Length = 289

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 64/179 (35%), Gaps = 42/179 (23%)

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL--NPYENTNTYPAMHHAYREL 288
           KK    +I  +++   +  +  +P + +   ++  + K+  +   +T+    +  A   L
Sbjct: 81  KKRNFDKISLVSF--ALRASVLSPATFDYTSLEEEIKKIEIDEEGSTSIGLGIATAVDML 138

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
            + KE +         +K +I +TDGEN+        ++     E   N  +KIY++ + 
Sbjct: 139 RSVKEDN---------EKIIILLTDGENNSG-----EIDPKLASEIASNFNIKIYTIGIG 184

Query: 349 APPEGQD------------------------LLRKCTDSSGQFFAVNDSRELLESFDKI 383
                                          L+     + G++F   ++  L   ++ I
Sbjct: 185 DANGSHAWVTYDDPNYGKRRIRADFTLNEESLIDIAATTGGKYFNAKNASALDNVYNTI 243


>gi|166367777|ref|YP_001660050.1| hypothetical protein MAE_50360 [Microcystis aeruginosa NIES-843]
 gi|166090150|dbj|BAG04858.1| hypothetical protein MAE_50360 [Microcystis aeruginosa NIES-843]
          Length = 420

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 44/266 (16%), Positives = 92/266 (34%), Gaps = 69/266 (25%)

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
            L L      E+ + NL I++C+VLD S SM+                            
Sbjct: 24  QLMLSIAATSEQINTNLPINLCLVLDHSGSMQG--------------------------- 56

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI-V 248
                             + ++ + ++A +L+ S+         ++ R+  IA++    V
Sbjct: 57  ------------------KPLETVKKAALSLIESL--------GVNDRLSVIAFDHRAKV 90

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
                   ++L  ++S++ +L     T     +    +E         ++ GS      +
Sbjct: 91  ILPSQSREDDLTLIRSKIQQLQAGGGTAIDEGIKLGIQE---------SSTGSKGYVSHI 141

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF 368
             +TDGEN       N    L++ E     G+ + +           L +    + G   
Sbjct: 142 FLLTDGENEHG----NNQRCLKLAEVAAEYGITLNTFGFGDHWNQDILEKIADIAGGSLS 197

Query: 369 AVNDSRELLESFDKITDKIQEQSVRI 394
            +    + L  F ++ +++  QSVR+
Sbjct: 198 YIERPEQALIEFTRLFNRL--QSVRL 221


>gi|159036783|ref|YP_001536036.1| von Willebrand factor type A [Salinispora arenicola CNS-205]
 gi|157915618|gb|ABV97045.1| von Willebrand factor type A [Salinispora arenicola CNS-205]
          Length = 319

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 71/204 (34%), Gaps = 38/204 (18%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            ++    E+A   V+ +     ++ N+    G +A+          P   +   +   ++
Sbjct: 106 DRLTAAKEAARRFVDGL----PDEFNV----GLVAFAGSAAV--LVPPDTDREALDEGID 155

Query: 268 KLNPYE----NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           +L         T    A++     L   K             + ++ ++DG N+      
Sbjct: 156 RLVEGATGVQGTAIGEAINT---SLGAVKALDGEAAKDPPPAR-IVLLSDGANT------ 205

Query: 324 NTLNTLQICEYMRNAGMKIYSVAV--------------SAPPEGQDLLRKCTDSSGQFFA 369
           + ++ ++         + ++++A                 P +GQ L     ++ GQF  
Sbjct: 206 SGMDPMEAATDAVAMDVPVHTIAFGTASGYVDRGGRPIQVPVDGQTLDEVARETGGQFHE 265

Query: 370 VNDSRELLESFDKITDKIQEQSVR 393
            + ++EL   +D I   +  ++ R
Sbjct: 266 ADSAKELRAVYDDIGSSVGYRTKR 289


>gi|90422080|ref|YP_530450.1| hypothetical protein RPC_0556 [Rhodopseudomonas palustris BisB18]
 gi|90104094|gb|ABD86131.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 453

 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 67/448 (14%), Positives = 132/448 (29%), Gaps = 91/448 (20%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAA----------VLSGCASIVSDRTIKDPT 54
           +I    + I  AID A    IR++MQSA DAA                S+ +D  I   +
Sbjct: 28  LIP-LLVAIGCAIDYARATQIRSKMQSAADAASVGSVSKASPAFLAAGSMTTDGPIAVGS 86

Query: 55  TKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
           T     + IF   +        Y          K+   +T                    
Sbjct: 87  T---DATNIFNGNMASQ---SGYTLSKLDAAVTKSGATLTSTVTFSASVATT-------- 132

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                   +I      +       +  SS  + I   ++LD S SM              
Sbjct: 133 -----FLTIIGKTALAI---GGTSVSTSSMPVYIDFYLLLDNSPSMGVGATPTDVATMVD 184

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
            ++          +        +K          +IDVL ++   L+++           
Sbjct: 185 NTSDKCAFACHDVNDEHNYYELAKTLGVK----TRIDVLRDATQQLMDTAAATATYPNQF 240

Query: 235 SVRI---GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE 291
            + I   G  A +  +        S +  +  +    L   +  N       +Y +L   
Sbjct: 241 RMAIYDFGASAQSAALRRLFALSSSLSSAKTAAGAIDLMTVKGQNDNDDRDTSYSKLLPA 300

Query: 292 KESSHNTIGSTR---LKKFVIFITDG--ENSGASAYQNTLNTL--------------QIC 332
            +      G+      +K+++F++DG  + + A   +   N                 +C
Sbjct: 301 IDKQITAAGAGTSDAPQKYLLFVSDGVADETNAGCAKTMKNAFWGNKSPRCQSPIDPALC 360

Query: 333 EYMRNAGMKI----------------------------YSVAVSAPPEGQDL---LRKCT 361
           + M + G+K+                            ++V    P    ++   ++ C 
Sbjct: 361 KAMTDRGVKVAVLYTTYLALPLKQANGDPSWYASWIAPFNVGPYGPSPNSEIANNMKACA 420

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQE 389
            S G +F V+ +  + ++ + I  K   
Sbjct: 421 -SPGFYFEVSPTDGIADAMNAIFRKAVA 447


>gi|226315301|ref|YP_002775197.1| hypothetical protein BBR47_57160 [Brevibacillus brevis NBRC 100599]
 gi|226098251|dbj|BAH46693.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 597

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 67/159 (42%), Gaps = 22/159 (13%)

Query: 237 RIGTIAYNIGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
           ++G +AY   I   +     N   + N++K+ ++ L     T+    +  A + L     
Sbjct: 77  KVGVVAYTDKIEREKALLEINSEEDKNDIKAFIDSLQKGAYTDIAVGVTEAVKIL----- 131

Query: 294 SSHNTIGSTRLKKFVIFITDGEN-----SGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
            +     +      ++ + DG N     S  +  ++     Q  +  ++ G  +Y++ ++
Sbjct: 132 DAGRNPNNAP---IIVLLADGNNFLNKASSRTQAKSDQELQQAVKEAKDKGYPVYTIGLN 188

Query: 349 APPEGQ----DLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           A  +GQ     L +   +++G+FF  + + +L +   +I
Sbjct: 189 A--DGQLNRTTLQQIAAETNGKFFETSTADKLPQILSEI 225


>gi|51893456|ref|YP_076147.1| hypothetical protein STH2318 [Symbiobacterium thermophilum IAM
           14863]
 gi|51857145|dbj|BAD41303.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 414

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 61/168 (36%), Gaps = 12/168 (7%)

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +A        + + ++     R+  + Y+  +     +      + V+  ++ +     T
Sbjct: 58  AALYFTKQALRFLVDQMAEEDRLAIVTYDDQVHVPFPSQPVVQKDAVRLLVDGITAGGTT 117

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +    +++       H   G  R+ + V+ +TDG  +      + L         
Sbjct: 118 NLSGGLATGMQQI-----RPH--AGPGRVSR-VLLMTDGLANVGVTDPDVLAG--WARAW 167

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDS-SGQFFAVNDSRELLESFDK 382
           R  G+ + ++ V  P   +DLL    ++  G F  + +  ++   F +
Sbjct: 168 REKGLAVSTMGVG-PHFSEDLLVALAEAGGGNFHYIANPDQIPRIFQE 214


>gi|255526268|ref|ZP_05393185.1| von Willebrand factor type A [Clostridium carboxidivorans P7]
 gi|296186262|ref|ZP_06854666.1| von Willebrand factor type A domain protein [Clostridium
           carboxidivorans P7]
 gi|255510048|gb|EET86371.1| von Willebrand factor type A [Clostridium carboxidivorans P7]
 gi|296049063|gb|EFG88493.1| von Willebrand factor type A domain protein [Clostridium
           carboxidivorans P7]
          Length = 422

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 61/155 (39%), Gaps = 19/155 (12%)

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNK-----LNPYENTNTYPAMHHAYRELYNEKESSHN 297
           Y       +  P+S    + +  ++       NP  NTN   A+  AY E+ + +    N
Sbjct: 155 YKFDDTAEKIIPMSQVTKQSREEVSGKLKDMQNPKGNTNMRDALEKAYEEIKSSETKDKN 214

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                     VI ++DG       Y  +    +  +  +   + IY++   +      +L
Sbjct: 215 A--------MVIMLSDG----GDTYDLSKKFDETLKPFKEKNISIYTIG-MSNGNNFSML 261

Query: 358 RKCT-DSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           ++   +S G ++ V + ++L   F+KI    Q++ 
Sbjct: 262 KEIAKESGGNYYNVKEIKDLKNVFNKIYRDRQQRL 296


>gi|58580793|ref|YP_199809.1| hypothetical protein XOO1170 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425387|gb|AAW74424.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 335

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 86/254 (33%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 101 MMLAVDLSGSMNE--------------------------------------PDMVLGGKV 122

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L   
Sbjct: 123 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLRDS 174

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 175 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 219

Query: 327 NTLQICEYMRNAGMKIYSVAVSA-----------PPEGQD------LLRKCTDSSGQFFA 369
           + L+  E  +  G++I+++A              P  G D      L +    + G+FF 
Sbjct: 220 DPLKAAELAKAEGVRIHTIAFGGGGGYSLFGVPIPAGGNDDIDEDGLRKIAQQTGGRFFR 279

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 280 ARDTEELAGIYAEL 293


>gi|78049050|ref|YP_365225.1| hypothetical protein XCV3494 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037480|emb|CAJ25225.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 451

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 87/254 (34%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 214 MMLAVDLSGSMSE--------------------------------------PDMVLGGKV 235

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L+  
Sbjct: 236 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLSDS 287

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 288 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 332

Query: 327 NTLQICEYMRNAGMKIYSVAVS-----------APPEGQD------LLRKCTDSSGQFFA 369
           N L+  E  +  G++++++A              P  G D      L +    + G+FF 
Sbjct: 333 NPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPAGGNDDIDEDGLRKIAQQTGGRFFR 392

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 393 ARDTEELAGIYAEL 406


>gi|301064759|ref|ZP_07205139.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
 gi|300441134|gb|EFK05519.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
          Length = 332

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 89/278 (32%), Gaps = 86/278 (30%)

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
                ++  I I + +DVS SME L    +N+  N                         
Sbjct: 78  GTSEVDSSGIDIVLAVDVSGSMEALDFTINNEPAN------------------------- 112

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                     ++DV+ +     +           +   RIG +A+         +PL+ +
Sbjct: 113 ----------RVDVVKKVVFRFIGE------RPDD---RIGLVAFAGRPYM--VSPLTLD 151

Query: 259 LNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
            + +  RL  ++P    + T    A+  +   L ++K  S          K VI +TDG 
Sbjct: 152 HDWLGRRLQTIHPGMVEDGTAIGSAIGSSINRLRDQKAKS----------KVVILLTDGM 201

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVA------VSAPPEGQ--------------- 354
           N+        +  +   E     G+KIY++       V  P   +               
Sbjct: 202 NNAGK-----ILPVTAAEAAETLGIKIYTIGAGSRGEVPVPITDKFGNQKIVRAKVDIDE 256

Query: 355 -DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
             L +    +  +++   D+  L + + +I      + 
Sbjct: 257 ATLEKVAQMTGAKYYRATDTDSLKKIYSEINKLETTKR 294


>gi|166713250|ref|ZP_02244457.1| hypothetical protein Xoryp_17865 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 335

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 86/254 (33%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 101 MMLAVDLSGSMNE--------------------------------------PDMVLGGKV 122

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L   
Sbjct: 123 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLRDS 174

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 175 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 219

Query: 327 NTLQICEYMRNAGMKIYSVAVSA-----------PPEGQD------LLRKCTDSSGQFFA 369
           + L+  E  +  G++I+++A              P  G D      L +    + G+FF 
Sbjct: 220 DPLKAAELAKAEGVRIHTIAFGGGGGYSLFGVPIPAGGNDDIDEDGLRKIAQQTGGRFFR 279

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 280 ARDTEELAGIYAEL 293


>gi|255535987|ref|YP_003096358.1| aerotolerance operon BatA [Flavobacteriaceae bacterium 3519-10]
 gi|255342183|gb|ACU08296.1| BatA (Bacteroides aerotolerance operon) [Flavobacteriaceae
           bacterium 3519-10]
          Length = 334

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 82/277 (29%), Gaps = 95/277 (34%)

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
            I E + +   I I M +DVS SM         D                          
Sbjct: 81  TISENNDDTKGIDIMMSVDVSLSML------ARDLEP----------------------- 111

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS 256
                       ++  L   A   V+         K    RIG + Y+         P++
Sbjct: 112 -----------DRLTALKNIAKKFVD---------KRPGDRIGLVTYSGEAFTK--VPVT 149

Query: 257 NNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
           ++   +   L  LNP E    T     +  A   L + K  S          K +I +TD
Sbjct: 150 SDHAVLLEELENLNPLELQPGTAIGEGLSVAVSHLRHSKAKS----------KIIILMTD 199

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL---------------- 357
           G N+  +A    +         ++  +++YS+ +     G  L+                
Sbjct: 200 GVNTIENAMPAQVGAQL----AKSNDIRVYSIGIG--TNGYALMPTQTDIFGDLVFTEVE 253

Query: 358 ---------RKCTDSSGQFFAVNDSRELLESFDKITD 385
                         + G++F    ++ L E +++I  
Sbjct: 254 VKIDEPVLREIAQTTGGKYFRATSNQSLEEVYEEINQ 290


>gi|289667993|ref|ZP_06489068.1| hypothetical protein XcampmN_05693 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 310

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 86/254 (33%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 76  MMLAVDLSGSMSE--------------------------------------PDMVLGGKV 97

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L   
Sbjct: 98  VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLRDS 149

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 150 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 194

Query: 327 NTLQICEYMRNAGMKIYSVAVS-----------APPEGQD------LLRKCTDSSGQFFA 369
           N L+  E  +  G++++++A              P  G D      L +    + G+FF 
Sbjct: 195 NPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPAGGNDDIDEEGLRKIAQQTGGRFFR 254

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 255 ARDTEELAGIYAEL 268


>gi|289662175|ref|ZP_06483756.1| hypothetical protein XcampvN_03493 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 335

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 86/254 (33%), Gaps = 81/254 (31%)

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
           + + +D+S SM +                                      P      + 
Sbjct: 101 MMLAVDLSGSMSE--------------------------------------PDMVLGGKV 122

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           +D L  +   L + + +   +      R+G + +  G      TPL+ +L  V+ +L   
Sbjct: 123 VDRLTAAKAVLSDFLDRRDGD------RVGLLVF--GQRAYALTPLTADLTSVRDQLRDS 174

Query: 270 N---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                   T    A+  + + L  +K+           ++ V+ +TDG N+        L
Sbjct: 175 VVGLAGRETAIGDAIALSVKRLREQKQG----------QRVVVLLTDGVNTAG-----VL 219

Query: 327 NTLQICEYMRNAGMKIYSVAVS-----------APPEGQD------LLRKCTDSSGQFFA 369
           N L+  E  +  G++++++A              P  G D      L +    + G+FF 
Sbjct: 220 NPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPAGGNDDIDEEGLRKIAQQTGGRFFR 279

Query: 370 VNDSRELLESFDKI 383
             D+ EL   + ++
Sbjct: 280 ARDTEELAGIYAEL 293


>gi|330829762|ref|YP_004392714.1| von Willebrand factor, type A [Aeromonas veronii B565]
 gi|328804898|gb|AEB50097.1| von Willebrand factor, type A [Aeromonas veronii B565]
          Length = 347

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/247 (14%), Positives = 78/247 (31%), Gaps = 60/247 (24%)

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
            + +VLD+S SM +                                    ++P P  +  
Sbjct: 99  DVMIVLDLSGSMAET----------------------------------DFSPDPGKSLS 124

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL---SNNLNEVKSR 265
           ++D   E       +             R+G I +               +      ++ 
Sbjct: 125 RLDAAKEVLKQFAAT---------REGDRLGLILFGDAAFLQAPFTADLETWQTLLQETD 175

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           +      ++T+   A+  A +   N          S + +K  I +TDG ++G+      
Sbjct: 176 VA--MAGQSTHLGDAIGLAIKVFNNSDRHGQQDQNSAKREKVAIILTDGNDTGSFVSPRD 233

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPE-GQ------DLLRKCTDSSGQFFAVNDSRELLE 378
              +         G++++++A+  P   G+       L +  T + GQ F   D  +L  
Sbjct: 234 AARVAAVN-----GVRLHTIAMGDPATVGEQALDLDTLQQLATLTGGQLFQALDEAQLTR 288

Query: 379 SFDKITD 385
           ++  I +
Sbjct: 289 AYQVIGE 295


>gi|254512360|ref|ZP_05124427.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221536071|gb|EEE39059.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 668

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 58/417 (13%), Positives = 113/417 (27%), Gaps = 106/417 (25%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGC------------------- 41
           +T  +I + F    +A+DL      R ++Q ALD AVL+                     
Sbjct: 37  LTLFLIMIVFTVAGFAVDLMRYDRERVRLQYALDRAVLAAADLDQELCPRVVVNDYISKE 96

Query: 42  ---------------ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIA 86
                            + +D +  D        ++            G+    +     
Sbjct: 97  GFDPGIIDEIKVDPETCLNTDSSDSDGDGTDSSDASGSDSDPSDTASSGTESGSDGTSSG 156

Query: 87  QKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146
                  T      LQ   + +A  ++  E  F+           ++ ST +        
Sbjct: 157 GDTAGTSTTTNAVELQGKRKVEASAQLNIETHFM-----KWSGVDTINSTAVSAAEESIG 211

Query: 147 AISICMVLDVSRSME-----------------------------------------DLYL 165
            + I +VLDVS SME                                         D  +
Sbjct: 212 NVEISLVLDVSGSMEGAKLTNLQKAAKDFVKEMLEKSADDSLSISIIPYSEQVGVPDYMM 271

Query: 166 QKHNDNNN---MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
            K N           ++         F + +      A  P P+  +       + +   
Sbjct: 272 DKINTTGGNKVANCIEFQPADFTAIPFTAFSIGAPSEATNPPPSVPQSLHFTNRSNDFRR 331

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP------LSNNLNEVKSRLNKLNPYENTN 276
              +  +   ++  R      N     +  T       + N+L+ +  ++N L    +T+
Sbjct: 332 GGNRDHRSTNDVVSRFSPWDANFPCREDTPTDRREMVVIQNDLDTLNKQINNLVAAGSTS 391

Query: 277 TYPAMHHAY-----------RELYNEK------ESSHNTIGSTRLKKFVIFITDGEN 316
               +               + + N+       E       +T   K V+ +TDG+N
Sbjct: 392 INIGLKWGLALLDESIQPLIKTVANDTNVPKIFEDRPRPTNTTDTLKVVVLMTDGKN 448



 Score = 58.0 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 42/109 (38%), Gaps = 9/109 (8%)

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY--QNTLNTLQICEYMRNAGM 340
            A+ E+   +     T G T    F+       NS  +A   +     + +C       +
Sbjct: 562 WAHTEIKAIESLFRRTKGDTYADDFI------RNSIVTADISKKNEQVVSLCGKAEEKEV 615

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            I+S+A  AP   + +L+ C     +++      ++   FD I+  IQ 
Sbjct: 616 LIFSIAFEAPSSVKQMLKDCAVKPARYYEAT-GTQIERVFDSISTSIQN 663


>gi|297606054|ref|NP_001057930.2| Os06g0578100 [Oryza sativa Japonica Group]
 gi|255677166|dbj|BAF19844.2| Os06g0578100 [Oryza sativa Japonica Group]
          Length = 622

 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 83/236 (35%), Gaps = 59/236 (25%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
           ++ I +  VLDVS SM D                                     +P   
Sbjct: 67  HVPIDVVAVLDVSGSMNDPVAA---------------------------------SPESN 93

Query: 205 PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL----SNNLN 260
               ++DVL  S   ++  +            R+  +A+N G V    + L     +  +
Sbjct: 94  LQATRLDVLKASMKFIIRKLDDGD--------RLSIVAFNDGPVKEYSSGLLDVSGDGRS 145

Query: 261 EVKSRLNKLNPYENTNT--YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
               ++++L     + +   P +  A + L   + +S N +G      F++ +TDG+++ 
Sbjct: 146 IAGKKIDRLQARGGSGSALMPELQEAVKILDERQGNSRNRVG------FILLLTDGDDTT 199

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
              +   +    +          +++ A+ A  + + LL    +S G +  V+D  
Sbjct: 200 GFRWSRDVIHGAV------GKYPVHTFALGAAHDPEALLHIAQESRGTYSFVDDGN 249


>gi|54290564|dbj|BAD61973.1| zinc finger-like [Oryza sativa Japonica Group]
 gi|54291279|dbj|BAD62048.1| zinc finger-like [Oryza sativa Japonica Group]
          Length = 598