PSIBLAST alignment of GI: 254781108 and protein with PDB id: 3k6s

>gi|283807143|pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095
>gi|283807145|pdb|3K6S|C Chain C, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095
>gi|283807147|pdb|3K6S|E Chain E, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095
>gi|283807149|pdb|3K6S|G Chain G, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095
>gi|283807156|pdb|3K71|A Chain A, Structure Of Integrin Alphax Beta2 Ectodomain Length = 1095
>gi|283807158|pdb|3K71|C Chain C, Structure Of Integrin Alphax Beta2 Ectodomain Length = 1095
>gi|283807160|pdb|3K71|E Chain E, Structure Of Integrin Alphax Beta2 Ectodomain Length = 1095
>gi|283807162|pdb|3K71|G Chain G, Structure Of Integrin Alphax Beta2 Ectodomain Length = 1095
>gi|283807164|pdb|3K72|A Chain A, Structure Of Integrin Alphax Beta2 Length = 1095
>gi|283807166|pdb|3K72|C Chain C, Structure Of Integrin Alphax Beta2 Length = 1095
 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 56/174 (32%), Gaps = 17/174 (9%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
           N V ++    Q        +            +    S+N   + + +++L     T T 
Sbjct: 153 NFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ--GFTYTA 210

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
            A+ +    L++    +          K +I ITDG         ++L+   +      A
Sbjct: 211 TAIQNVVHRLFHASYGARR-----DAAKILIVITDG-----KKEGDSLDYKDVIPMADAA 260

Query: 339 GMKIYSVAVSA---PPEGQDLLRKCTDSSG--QFFAVNDSRELLESFDKITDKI 387
           G+  Y++ V            L            F V D   L +  +++ +KI
Sbjct: 261 GIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKI 314