BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781108|ref|YP_003065521.1| von Willebrand factor type A
[Candidatus Liberibacter asiaticus str. psy62]
         (398 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL
Sbjct: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL
Sbjct: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT
Sbjct: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
           IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG
Sbjct: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360
           STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC
Sbjct: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKC 360

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
Sbjct: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 94/404 (23%), Positives = 157/404 (38%), Gaps = 27/404 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A      +   +          +  +   
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLISKQQLQEAA--DSAALATATALANGTIQTSQAEAFA 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L  
Sbjct: 82  RNFVAGQMANYLQSGVDIKSATGVTVQ------TNTSGNSTSYQVTVSPSYDLTVNPL-- 133

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +     +LS   T I   S    +IS+ + LD S SM +      N+ +   S  Y 
Sbjct: 134 MQAVGFTTQHLSTSGTTIGGHSQTQGSISMYLALDKSGSMGED-TATVNEEDPTESYTYD 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 K       T +    + A    KI+ L  +AGNL   +  A  +     VR G 
Sbjct: 193 CNGHYNKKGKWIYDTCTG---SRANYYTKIEALKMAAGNLFGQLSSA--DPNAQYVRTGA 247

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNEKE 293
           ++Y   IV    + L+   + V + +N L     TN+  AM  AY  L        + ++
Sbjct: 248 VSY--DIVQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAAGNDAED 305

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSAPP 351
           ++H        KK+++F+TDG+N+  S+   + +T     C+  ++ G++IY++A  AP 
Sbjct: 306 AAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPE 365

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            GQ LL  C      +F      +LL +F  I  K   Q  R+ 
Sbjct: 366 GGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRLT 409


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 96/415 (23%), Positives = 166/415 (40%), Gaps = 39/415 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA++  +       ++D+A+++  +NQ+Q A DAA L+  +++VSD    D    KD  
Sbjct: 25  MTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSDA-RPDIEEAKDLA 83

Query: 61  STIFKKQIKKHLK------------------QGSYIRENAGDIAQKAQINITKDKNNPLQ 102
               K Q                                  +     +I+IT   N    
Sbjct: 84  RKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPRWEDVNATEIDITATPNGAKG 143

Query: 103 YIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMED 162
              +     +   +   +  L+      +  RST      S+N A+S+ +VLD S SM  
Sbjct: 144 KSFQVTVANKHLLQFNAMTRLLGPESIEIETRSTAESATESKN-ALSMYLVLDRSGSMAW 202

Query: 163 LYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                +              P   ++ WSK        P       KID L  + G+L+ 
Sbjct: 203 KTNTINTGKAK--------CPNYTEANWSKYPDLKATGPC---YVTKIDALKTAVGDLLA 251

Query: 223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
            +  A  + ++  VR G I+Y      +  + LS         ++ L     T +  A  
Sbjct: 252 QLVTA--DPESAYVRTGAISY--NSAQDAASSLSWGTRGAAGYVDALVAIGGTASGNAFK 307

Query: 283 HAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMK 341
            A++++ N  E S H         K+++F+TDGEN+ A+   +   T Q C+  + + ++
Sbjct: 308 TAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHAN---DDTVTRQWCDTAKASKVQ 364

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           IYSVA  AP  GQ LL+ C  SS  +F   ++ +L+ +F  I ++      R+  
Sbjct: 365 IYSVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGERAAASVSRLTK 419


>gi|83955719|ref|ZP_00964299.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
 gi|83840013|gb|EAP79189.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
          Length = 480

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 61/471 (12%), Positives = 116/471 (24%), Gaps = 111/471 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   +I +        +D       R+++Q+  D AVL+          +      K   
Sbjct: 42  LALFMIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAA-------DLDQMRDPKTVV 94

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F K                               +          A   + T+ +  
Sbjct: 95  EDYFAKSGMTEFLSN------------------VVVDDGLNFRTVTVDASKNMDTQFI-- 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G        +   S      +   +++    VLD+S SM          N        +
Sbjct: 135 -GRFGFPTLEVPAHSQAEERVAKVEISL----VLDISGSMATNNRLGEVQNAADIFLDTV 189

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLS 235
           L    +          S+   A      +++V                            
Sbjct: 190 LKDENQDLISVSLVPYSEQVNAGPLIMDRMNVNRKHDYSHCIDFDNGDFDSIAMNSSTRY 249

Query: 236 VRIGTIAYNIG-------------IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
            ++    +N                   + TP S N   +K++++ L P   T+ +  M 
Sbjct: 250 NQMQHFQWNYDGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPRAGTSIFLGMK 309

Query: 283 HAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
            A   L                      +   +   +   K VI +TDG N  +   ++ 
Sbjct: 310 WAAAMLDPAFRDINNSLVNAGYVDREFYNRPASYTDSETLKTVILMTDGANDNSYRIRSN 369

Query: 326 LNTLQ-------------------------------------------ICEYMRNAGMKI 342
                                                           IC+  +   + I
Sbjct: 370 YYDSDSEYVHWNKYNLWWYLRREVDSRYWGYFYYHKYNKTLGNTLLSNICDAAKAKRIVI 429

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +S+      E    ++ C  S   FF V    EL E+F  I  +I +  + 
Sbjct: 430 WSIGFEVDDEDVPAMQDCASSPSHFFRVEGV-ELSEAFRAIARQINQLRLT 479


>gi|83941160|ref|ZP_00953622.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
 gi|83846980|gb|EAP84855.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
          Length = 480

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 62/472 (13%), Positives = 118/472 (25%), Gaps = 112/472 (23%)

Query: 1   MTAIIISVCF-LFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + A+ + +         +D       R+++Q+  D AVL+          +      K  
Sbjct: 41  ILALFMIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAA-------DLDQMRDPKTV 93

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
               F K                               +          A  ++ T+ + 
Sbjct: 94  VEDYFAKSGMTEFLSN------------------VVVDDGLNFRTVTVDASKDMDTQFI- 134

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
             G        +   S      +   +++    VLD+S SM          +        
Sbjct: 135 --GRFGFPTLEVPAHSQAEERVAKVEISL----VLDISGSMATNNRLGEVQDAADIFLDT 188

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNL 234
           +L    +          S+   A      +++V                           
Sbjct: 189 VLKDENEDLISVSLVPYSEQVNAGPLIMDRMNVNRKHDYSHCIDFDNGDFDSIAMNSSTR 248

Query: 235 SVRIGTIAYNIG-------------IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAM 281
             ++    +N                   + TP S N   +K++++ L P   T+ +  M
Sbjct: 249 YNQMQHFQWNYDGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPRAGTSIFLGM 308

Query: 282 HHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
             A   L                      +   +   +   K VI +TDG N  +    N
Sbjct: 309 KWAAAMLDPAFRDINNSLVNAGHVDREFYNRPASYTDSETLKTVILMTDGANDNSFRISN 368

Query: 325 TLNTLQ-------------------------------------------ICEYMRNAGMK 341
           T                                                IC+  +   + 
Sbjct: 369 TYYNEDSEYVHWNRYNLWWYLRREVNSRYWGYFYYQKYNKSLGNTLLSNICDAAKAKRIV 428

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           I+S+      E    ++ C  S   FF V    EL E+F  I  +I +  + 
Sbjct: 429 IWSIGFEVDDEDVPAMQDCASSPSHFFRVEGV-ELSEAFRAIARQINQLRLT 479


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score =  182 bits (462), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 87/420 (20%), Positives = 161/420 (38%), Gaps = 47/420 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+I  +       ++D+A+++  +NQ+Q A         A   +   + D     ++ 
Sbjct: 14  MTALIAPLLLAVGGVSVDVANMLMTKNQLQDAT-----DAAALAAASALVSDARPDIEEA 68

Query: 61  STIFKKQIKKHLKQGSYI---------------RENAGDIAQKAQINITKDKNNPLQYIA 105
             I +K +K  +   S                    + D    +++ I +  N       
Sbjct: 69  KAIARKFLKTQMAATSSADVPGEAVGTMAAAGSTAPSWDDVNTSEVVIVETPNGTKGKSF 128

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
           +     +   +   +  L+      L  RST      S+N AIS+ +VLD S SM   + 
Sbjct: 129 QVSVANKHLLQFNAMTRLLGKESIELETRSTADSATESKN-AISMYLVLDRSGSMA--WK 185

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP-ANRKIDVLIESAGNLVNSI 224
               D +            P+   W+ +        A +P    KI  L  +   L   +
Sbjct: 186 TDTVDTSR-----------PRCINWTASNWGESNVRATSPCYVDKITTLKSAVDKLFTPL 234

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
            K   +  N  +R G  +YN     ++ + L+       + +  L+    T++  A   A
Sbjct: 235 AKM--DPGNEYLRAGAASYNDR--QDRASKLTWGTKNASAHVQGLDATGGTDSSSAFAAA 290

Query: 285 YRELY-NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-------TLQICEYMR 336
             EL  + +  +H        +K+++F+TDGEN+  +   +  +       T   C   +
Sbjct: 291 VEELLLDGENEAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAK 350

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           N G+ I++VA  AP  G+DLL+ C  S   +   +D+  L+  F+KI  K      R+  
Sbjct: 351 NNGIAIFTVAFMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQKAAAMIARLTK 410


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 92/396 (23%), Positives = 152/396 (38%), Gaps = 22/396 (5%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V F     AI +  ++  + Q+Q A      +   +          +  +   
Sbjct: 25  MTAIVLPVLFGAAGMAIQVGDLLLSKQQLQEAA--DSAALATATALANGTIQTSQAEAFA 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G  I+   G   +      T        Y       Y I    L  
Sbjct: 83  RDFVAGQMANYLQSGIDIKSTTGVDVR------TTTSGKSTSYQVTVSPDYNIAVNPL-- 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              I     N+S  ST     S    ++S+ +VLD S SM +      N ++      Y 
Sbjct: 135 MQTIGFTTQNISTSSTTTSGNSQTQGSVSMFLVLDRSGSMGED-TATVNASDPTEEYNY- 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                +K  +   T K            KI+ L  + G L   +     + +   VR G 
Sbjct: 193 --DCSEKDRYGNVTKKKTCTDTRPHYYTKIEALKLAVGTLTGELDAV--DPEKEYVRTGA 248

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK-ESSHNTI 299
           ++Y   I   +   L      V   +NKL   + T++  A   AY +L +   + +H   
Sbjct: 249 VSY--NIEMQKAKALDWGTAHVTKYVNKLTATDGTDSGEAFKTAYNKLADAAEDKAHVDK 306

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
                 K+++F+TDG+N+  SA      T   C+  R+A M++Y++A  AP  GQ LL  
Sbjct: 307 TGQVPTKYIVFMTDGDNNYTSADT---ETKTWCDKARDAKMQVYTIAFMAPARGQALLSY 363

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           C  + G +F   D   LL++F +I  K   Q  R+ 
Sbjct: 364 CATAPGNYFPAGDMTALLKAFKEIGMKASNQVTRLT 399


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score =  180 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 82/397 (20%), Positives = 147/397 (37%), Gaps = 60/397 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALD-AAVLSGCASIVSDRTIKDPTTKKDQ 59
           +  I+I +    +T  ID++     R ++Q+A D AAV +G A +  + TI         
Sbjct: 85  LFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALLAEEITIAQANAYAKD 144

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT-KDKNNPLQYIAESKAQYEIPTEN- 117
                   +      GS      G +  K  + IT     N   Y+ +     +IP    
Sbjct: 145 AFNRIASGLSAS-GDGSSGTSIFGTMTVKPAVQITETVDGNTTNYVVKVNGTAKIPASPL 203

Query: 118 --LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
             +F  G       +L   S     ++    ++S+ +VLD S SM               
Sbjct: 204 SFMFFDGETGKNTISLGFESET-TAKAEAGASLSMALVLDRSGSMGWER----------- 251

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                            ++  L ++  +L+  +Q    +  +  
Sbjct: 252 -------------------------------PSRMSELKKAVRSLIKELQTV--DPDDQF 278

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-S 294
            R+G  AY+    G +   L+ N N V+S +N L     T   PA+  A  +L    E +
Sbjct: 279 TRLGAYAYHWYYAGKKE--LTWNKNSVRSWVNSLPASGGTRAAPAIQKAKNDLLTNSELN 336

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
           +H          F++++TDG +   +         + C   +NAG+ IY+VA  AP  G+
Sbjct: 337 AHINKNEQEPDLFILYMTDGIDGDPNW------AKRECTSAKNAGITIYTVAFKAPASGR 390

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
           +LL+ C  S   ++   ++ EL + F  I  +  +  
Sbjct: 391 NLLKACATSDAHYYDAKNANELNKVFKDIARETTKSI 427


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 90/404 (22%), Positives = 155/404 (38%), Gaps = 26/404 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  +M  + Q+Q A         A++ +   + + T +  Q 
Sbjct: 24  MTAIMAPVLLGVAGVAIQVGDMMLSKQQLQEAA------DSAALATATALANGTIQTSQA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +  +   +   +Y++      +  +    T        Y       Y++    L  
Sbjct: 78  EAFAQNFVAGQMA--NYVQSGVDFKSGTSVNVQTSTSGKSTSYQVTVSPSYDLTVNPL-- 133

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +     +LS   T +   S    +IS+ + LD S SM +      N ++   S  Y 
Sbjct: 134 MQAVGFKTQHLSTSGTTVGGHSQTQGSISMFLALDKSGSMGE-ATATVNADDPTESYTYD 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                            K   +      KI+ L  +AGNL   +  A  +     VR G 
Sbjct: 193 CNLHYNSKNNKWV--YDKCTGSRTNYYTKIEALKIAAGNLFGQLNSA--DPNAEYVRTGA 248

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNEKE 293
           ++Y   I     + L+     V S +N L     TN+  AM  AY  L        + ++
Sbjct: 249 VSY--DINQYTPSNLAWGTAGVTSYVNALQANGGTNSSGAMSTAYSSLTAKNAAGNDAED 306

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSAPP 351
           S+H        KK+++F+TDG+N+  S+   + +T     C+  ++ G++IY++A  AP 
Sbjct: 307 SAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPA 366

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            GQ LL  C      +F      +LL +F  I  K   Q  R+ 
Sbjct: 367 GGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASAQMTRLT 410


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 80/397 (20%), Positives = 159/397 (40%), Gaps = 58/397 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  + V F+  + A+D  + M ++ ++Q+A+D+A L+  A +  +  +     +    
Sbjct: 24  IAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAALATAARLSEEENLTAAQAQA-FA 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+K+               +    +NI   +        +     E       +
Sbjct: 83  LKFVNGQVKEDFGA-------FNGFSVTPTVNIDPVETGGRTVW-KVAVSMEGSQSLTPM 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++      +S+             A S+ +VLD S SM+     +             
Sbjct: 135 ARIMGKDKLTVSVVGKSESA-GEAQGAFSMALVLDRSGSMDWNLNGQK------------ 181

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                                       KI+VL  + G L+   ++A  + +   VR+G 
Sbjct: 182 ----------------------------KINVLKTAVGGLIEQFEEA--DPERKYVRLGA 211

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTI 299
            +YN  + G   T L  N  + K  ++ L     T++  A   AY  + +++E++ H+  
Sbjct: 212 SSYNSKLTG--STKLRWNPGKTKEFVDALPASGGTDSTDAFDWAYTAVTHKRENNTHDAK 269

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
                KKF++F+TDG+N+ +SA  +   T  +C+  ++ G+++Y+VA +AP  G+ LL  
Sbjct: 270 SGQVPKKFIVFMTDGDNNYSSADSS---TKHLCDDAKDDGIEVYTVAFAAPNRGKQLLSY 326

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           C  +   FF   +S +L+E+F  I     +   R+  
Sbjct: 327 CASTEEHFFDAQNSAQLIEAFKNIGYAASKVVSRLTE 363


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score =  179 bits (453), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 89/407 (21%), Positives = 159/407 (39%), Gaps = 28/407 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A      +   +          +  +   
Sbjct: 24  MTAILAPVLLGAAGLAIQVGDMLLSKQQLQEAA--DSAALATATALGNGTIQTSQAEAFA 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G  I+       Q +             Y       Y++    L  
Sbjct: 82  RNFVAGQMANYLQNGVDIKNATAVNVQTSN------SGKSASYQVTVTPSYDLTVNPLMQ 135

Query: 121 KGLIPS---ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
                +   + ++ ++        S+   ++S+ + LD S SM D     + D    T  
Sbjct: 136 AVGFSTQHLSTSSTTVSGPSQTPGSNSQGSVSMFLALDKSGSMGDPTETVNKDQPTETFT 195

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
               P   KK  W  +T       +      KI+ L  +AGNL   +  A  +     VR
Sbjct: 196 YDCNPHLNKKGKWVYDT----CTGSRTNYYTKIEALKMAAGNLFGQLTSA--DPDAQYVR 249

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YN 290
            G ++Y+I       + L+   + V S +N L     TN+  AM  AY  L        +
Sbjct: 250 TGAVSYDIDQY--TPSTLAWGTSGVSSYVNALQAGGGTNSSGAMGTAYSSLTAKNAAGND 307

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVS 348
            ++++H        KK+++F+TDG+N+  S+   + +T     C+  ++ G++IY++A  
Sbjct: 308 AEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFM 367

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           APP GQ LL+ C   +  +F      +LL +F  I  K   Q  R+ 
Sbjct: 368 APPGGQALLQYCASDAAHYFQAEQMEDLLAAFKAIGAKASAQLTRLT 414


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/404 (22%), Positives = 152/404 (37%), Gaps = 26/404 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI+  V       AI +  ++  + Q+Q A      +   +          T  +   
Sbjct: 24  MTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAA--DSAALATATALANGTIQTTEAEAFA 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G+ I+       Q      T        Y       Y +    L  
Sbjct: 82  RNFVAGQMANYLQSGTDIKSTTSVNVQ------TTTSGKSTSYQVTVSPAYVLTVNPL-- 133

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +     +LS   T I   S    +IS+ + LD S SM +      N+ +   S  Y 
Sbjct: 134 MQAVGFTTQHLSTSGTTIGGHSQTQGSISMFLALDKSGSMGED-TATVNEESPTESYTYD 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                            K   +      KI+ L  +AGNL + +  A  +     VR G 
Sbjct: 193 CNLHYNTKNNKWV--YDKCTGSRTNYYTKIEALKMAAGNLFSQLNSA--DPNAQYVRTGA 248

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNEKE 293
           ++Y   I     + L+  +  V S +N L     TN+  AM+ AY  L        + + 
Sbjct: 249 VSY--DINQYAPSSLAWGITGVSSYVNALQANGGTNSSGAMNTAYTSLTAKNAAGNDVEN 306

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSAPP 351
           S+H        KK+++F+TDG+N+   +   + +T   + C+  ++ G++IY++A  AP 
Sbjct: 307 SAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTATKKTCDDAKSKGIEIYTIAFMAPA 366

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            GQ LL  C      +F      +LL +F  I  K   Q  R+ 
Sbjct: 367 GGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQLTRLT 410


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 95/406 (23%), Positives = 166/406 (40%), Gaps = 30/406 (7%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TAI+  V       A+ +  ++  + Q+Q A D+A L+   ++ + +     +  +    
Sbjct: 1   TAILAPVLLGAAGMAVHVGDMLLSKQQLQEAADSAALATATALANGKI--QTSEAEAYAR 58

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L   
Sbjct: 59  NFVAGQMANYLQSGVDIKSATGVSVQ------TNTSGNSTSYQVTVSPSYDLTVNPL--M 110

Query: 122 GLIPSALTNLSLRSTGIIERSSE---NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
             +     +LS   T I    S+     +IS+ + LD S SM +      N+ +   S  
Sbjct: 111 QAVGFTTQHLSTSGTTIGGGHSQTQGQGSISMYLALDKSGSMGED-TATVNEEDPTESYT 169

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
           Y   P   +       T +    + A    KI+ L  +AGNL   +  +  +     VR 
Sbjct: 170 YPCNPHYNRKGKEVWDTCTG---SRANYYTKIEALKMAAGNLFAQL--SGADPNAQYVRT 224

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNE 291
           G ++Y   IV    + L+     V S +N L     TN+  AM  AY  L        + 
Sbjct: 225 GAVSY--DIVQYAPSSLAWGAIGVSSYVNALQAGGGTNSSGAMSTAYLSLTAKNAAGNDA 282

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSA 349
           ++S+H        +K+++F+TDG+N+  S+   + +T     C+  ++ G++IY++A  A
Sbjct: 283 EDSAHKLKSGQIPQKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMA 342

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           PP GQ LL+ C   +  +F      +L  +F  I  K   Q  R+ 
Sbjct: 343 PPGGQALLQYCASDASHYFQAEKMEDLFAAFKAIGAKASTQVTRLT 388


>gi|255261929|ref|ZP_05341271.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104264|gb|EET46938.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 478

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 59/469 (12%), Positives = 114/469 (24%), Gaps = 113/469 (24%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            +  +  L    A+DL      R ++Q  LD AVL+          +    +     +  
Sbjct: 41  FMFVLMLLTAGMALDLMRYETHRARLQGTLDRAVLAAA-------DLDQTLSPAAVVTDY 93

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
           F K                        +  T         I  ++      T       L
Sbjct: 94  FAKAGLSSF------------------LTSTTVDQGLNYRIISAQGNM---TMPTTFMRL 132

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                  +   +T     S+  +++    V+D+S SM            + T    ++ P
Sbjct: 133 SGQTELAIRGDATAEERVSNVEISL----VVDISGSMGRNNKLSTLRTASHTFIDTVIRP 188

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVL-----IESAGNLVNSIQKAIQEK----KNL 234
             +          +    A      ++ V                   A  +        
Sbjct: 189 ETEDLISLNIIPYTAQVNAGPDIFDQLTVDQKHNFSHCIDFEPADFNTAALDVPPVSTRT 248

Query: 235 SVRIGTIAYNIGI-----------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
             ++    Y                  +  P S +   +KS +  L    NT  +  M  
Sbjct: 249 YKQMQHFQYGWSSSYVNNPGCPMQSYERIVPFSQDATSLKSTVTSLRARANTAIHLGMKW 308

Query: 284 -----------------AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                            A  ++  E              K ++ +TDG+N       +  
Sbjct: 309 GVSMLDPTFRPIVTAMIANNKVDPEFAGRPVAYNDPETLKTIVLMTDGQNVDTYRISDEF 368

Query: 327 NTL-------------------------------------------QICEYMRNAGMKIY 343
            +                                             IC+  +  G+ ++
Sbjct: 369 YSTPSQIAHWDRYQLFFFTNNYIDRDIDQNYYYKKFTATQADTMLQSICDAAKAEGILVW 428

Query: 344 SVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           ++           +  C  S   FF V    EL E+F  I  +I +  +
Sbjct: 429 TIGFEVSNHAAGEMLDCASSPSHFFRVEGV-ELSEAFASIARQINQLRL 476


>gi|84502751|ref|ZP_01000870.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
 gi|84389146|gb|EAQ01944.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
          Length = 470

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 52/466 (11%), Positives = 118/466 (25%), Gaps = 103/466 (22%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++          +D+      R ++Q  +DA+ L+            +    K   
Sbjct: 36  LVMFMLLTMMTVAGIGVDVMRTEMERTRIQQVIDASTLAAAH-------KDNALDPKQVV 88

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F K           I                           E     ++ T  +  
Sbjct: 89  LDYFDKAALASYISADDI----------------LVGGGETSTAVEVNLTAQVKTPFI-- 130

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              + +   N+  R        +  +++    VLD+S SM+D                 +
Sbjct: 131 -RHLGNESFNVPARGRAEQAYGNSEVSL----VLDISGSMDDNRRMSRLHRAANEFVDTV 185

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLS 235
           L P             +           +++V              +       + ++  
Sbjct: 186 LTPDSVDRVSVSLIPYTGDVNVGWDIFSRMNVRQLHDYSYCVQFTPDDFSTTAIDPEDAY 245

Query: 236 VRIGTIA-------YNIGIV--GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
           ++    +       Y           TP S N   +++++N+L   E T+ +  +     
Sbjct: 246 IQGQHFSHVDARFNYISCPTQSYETVTPFSQNNAALEAQINRLTGRERTSIHIGIKWGAA 305

Query: 287 ELYNEKES----------------SHNTIGSTRLKKFVIFITDGENS------------- 317
            L                            ++   K ++ +TDG N+             
Sbjct: 306 MLDEAFRPLVNDLVDNSIVDEAFRDRPAPFTSNTLKVIVVMTDGMNTETKRIKEFAYDTP 365

Query: 318 ----------GASAYQN-------------------TLNTLQICEYMRNAGMKIYSVAVS 348
                           +                         IC   +  G+ IYS+   
Sbjct: 366 DMRAHWARHAMDDWDNDVDGSVEDHLFDTYYDTAIGNALLQNICNAAKANGIIIYSIGFE 425

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
              +    +  C  S   F+ V    ++ E+F  I  ++++  + +
Sbjct: 426 INNDAAQEMEDCASSPSHFYRVEGV-QISEAFSSIAQQLKQLRLTL 470


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 84/398 (21%), Positives = 173/398 (43%), Gaps = 56/398 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ- 59
           +TAI++ V F+ +   I+ +H  +++ ++   LD ++L     I++     +   +K+  
Sbjct: 20  LTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDF 79

Query: 60  ----TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
                  I++   +  L++  +  ++  +I +   ++I  D  +   Y   + ++YE+P 
Sbjct: 80  SYRIIKNIWQTDFRNELRENGF-AQDINNIERSTSLSIIIDDQHK-DYNLSAVSRYEMPF 137

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
                     S+   L + S  +   S  ++ + + MVLDVS SM D +           
Sbjct: 138 IFCTFPWCANSSHAPLLITS-SVKISSKSDIGLDMMMVLDVSLSMNDHF----------- 185

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                        P   K+ V   S   +++ I+       N  
Sbjct: 186 ----------------------------GPGMDKLGVATRSIREMLDIIKSIPDV--NNV 215

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES- 294
           VR G + ++  IV     PL+  +  ++ ++N+L     T + P + +AY ++++ KE  
Sbjct: 216 VRSGLVTFSSKIVQTF--PLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKL 273

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
            H   G    KK++IF+TDGENS  +   +   +L  C   +  G  +Y++ V A    Q
Sbjct: 274 EHIAKGHDDYKKYIIFLTDGENSSPNI--DNKESLFYCNEAKRRGAIVYAIGVQAEAADQ 331

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             L+ C     +F++V +SR+L ++F +I  ++ +Q +
Sbjct: 332 -FLKNCAS-PDRFYSVQNSRKLHDAFLRIGKEMVKQRI 367


>gi|114764812|ref|ZP_01443994.1| hypothetical protein 1100011001322_R2601_10469 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542698|gb|EAU45721.1| hypothetical protein R2601_10469 [Roseovarius sp. HTCC2601]
          Length = 477

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/470 (13%), Positives = 125/470 (26%), Gaps = 110/470 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   +  +  +F    ID+ +    R ++Q+ LD AVL+                     
Sbjct: 40  MAVALSLLMMIFGGIGIDMMYAELQRTKIQNTLDRAVLAAA------------------- 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  +   L     + +    ++    +               +       T     
Sbjct: 81  ------DLDNELDAQGVVEDYMSKMSLADALVSVNVDEGLNYRTVTADG---YRTMPSNF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             LI          S  +         + + MVLD+S SM+D                 L
Sbjct: 132 MQLIGIENMQAGGHSQAMERI----NKVEVSMVLDISGSMDDGDKMAELQTAASDFVDTL 187

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLS 235
           L    +          S++  A       ++V              ++   A  +     
Sbjct: 188 LDDGSEDLVSISLVPYSEHVNAGPEILSYLNVNYMHDDSYCLEMPNSAFNSAALDLSLTY 247

Query: 236 VRIGTIAYNI------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
            ++    +N                  Q  P S +   +K+++++L P   T+ +  M  
Sbjct: 248 DQMQHFQWNYSGSNSLTDTVCPRYAYEQIRPWSQDAGALKTQISQLQPRAGTSIFMGMKW 307

Query: 284 AYRELYNE-----------------KESSHNTIGSTRLKKFVIFITDGE----------- 315
           A   L                     E        T + K ++ +TDG+           
Sbjct: 308 ASALLDPSTRPIASGMIADGTVDAVFEGRPVAYSDTDVLKTIVLMTDGQHDRSFRIQNWA 367

Query: 316 -------------------------NSGASAYQNTLNTLQ-------ICEYMRNAGMKIY 343
                                     + +S Y    +          +C   +  G+ I+
Sbjct: 368 YNDENEVEHWSQYNLWHYLNYYVNSWNRSSFYYQKYDAATGDTLLSSVCTAAKRQGILIW 427

Query: 344 SVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           S+       G +++  C  S   FF V    E+ E+F  I   + +  + 
Sbjct: 428 SIGFEVSDHGANVMESCASSPAHFFRVEGV-EISEAFSTIAQTLNQLRLT 476


>gi|260425757|ref|ZP_05779737.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260423697|gb|EEX16947.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 479

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/471 (13%), Positives = 126/471 (26%), Gaps = 111/471 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  ++  +  +F    ID+ +    R ++Q+ LD AVL+                     
Sbjct: 41  MAVVLSMMMMIFGGLGIDMIYAELQRTKVQNTLDRAVLAAA------------------- 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  +   L+    + +    +A    +               ++      T     
Sbjct: 82  ------DLDNELEAQGVVEDYMDKMALADALISVDVDEGLNYRTVVAEG---YKTMPSNF 132

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++          +      +   +++    VLD+S SM+D     +  +   T    L
Sbjct: 133 MQILGVDNLQAYGLAEATERINKVEVSL----VLDISGSMDDNDKLANMQDAAGTFIDTL 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPA-----NRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
           L    +          S+   A                        +    A  +     
Sbjct: 189 LAEGNEDLVSISLVPYSEQVNAGPEILSYLSANWKHGYSHCIEMPNSVFGSAALDFSRTY 248

Query: 236 VRIGTIAYNIGIVGNQ-------------CTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
            ++    +N     N                  S++ + +K+++N+L P   T+ +  M 
Sbjct: 249 EQMQHYQWNYDGYNNTLSDTVCPRYGYERIQAWSHDASALKAQVNQLQPRAGTSIFMGMK 308

Query: 283 HAYRELYNE-----------------KESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                L                     E        T + K V+ +TDG++  +   Q+ 
Sbjct: 309 WGTALLDPSTRPIASGMIARGSVDQVFEGRPVAYDDTDVLKTVVLMTDGQHDRSYRIQDW 368

Query: 326 LNTLQ-------------------------------------------ICEYMRNAGMKI 342
               +                                           IC   +  G+ I
Sbjct: 369 AYNSESEYAHWNRYNLWYYLSRYVSSYERSSFYYQKYNADLGDALLGSICAAAKAQGIII 428

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +SV       G D++  C  S   FF V    E+ E+F  I   + +  + 
Sbjct: 429 WSVGFEVGDHGADVMESCASSPAHFFRVEGV-EITEAFSTIAHTLNQLRLT 478


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 87/408 (21%), Positives = 158/408 (38%), Gaps = 33/408 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V        ++LA++M ++  MQ+       S   +  ++  +++     +Q 
Sbjct: 24  MTAILLPVLLGVAGAGMELANVMQVKADMQNT----ADSAALAAATEARLREGKLSDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I K  I   +++     E             T +      Y  E+  +++I    +  
Sbjct: 80  KEIAKNFIAAQMEKNLTAEEKIELEKNSPTRVTTTENARGKTYAVETTIKHQIQLNPM-- 137

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G I +   +LS+  T     + +   IS+ + LD S SM            +       
Sbjct: 138 LGFIGAKTLDLSVTGTAKSTIN-KGAPISMYLALDRSGSMSFKTDTVDTTKTS------- 189

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE----KKNLSV 236
                    WSK    +K +P       K   L  + G LV ++ KA         +  V
Sbjct: 190 -CQNYTSDNWSKYPNLAKTSPC---YVNKAASLKTAVGFLVATLNKADPTYTVNGGSELV 245

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKE 293
           R G   Y       Q        + V S ++K  P      T+   +++ AY  L     
Sbjct: 246 RTGASVYTHETYVAQSIG--WGTSGVTSYVDKQIPEFPSGGTDARSSLNAAYNALKKANP 303

Query: 294 SS---HNTIGSTRLKKFVIFITDGENSGASAYQNTL---NTLQICEYMRNAGMKIYSVAV 347
                H   GS   +++++ +TDGE +G SA  N+    +    CE  +  G+KI+SVA 
Sbjct: 304 DEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKKDGIKIFSVAF 363

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            AP +G+ LL+ C  S+  ++A  +  +++ +F +I  K       + 
Sbjct: 364 MAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIARKAAGSIATLT 411


>gi|254460794|ref|ZP_05074210.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677383|gb|EDZ41870.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 480

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 61/471 (12%), Positives = 125/471 (26%), Gaps = 111/471 (23%)

Query: 1   MTA-IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + A  ++ +        +DL      R  +Q  LD A+LS          +    T +  
Sbjct: 42  IFAVFMVLMILTIGGIGVDLMRSERDRTVLQHTLDRAILSAA-------DLDQTQTPQAV 94

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
               F+    +       + +        A+                             
Sbjct: 95  VDDYFETAGLESFLSNVTVDQGINYKTVGAEAQSITT---------------------TA 133

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
              +      N +         ++  ++    MVLD+S SM          +   +    
Sbjct: 134 FMKMAGVDTLNATAAGVAEERIANVEIS----MVLDISGSMGIGSKMTQLRSAATSFVNT 189

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNL 234
           +L P  +          S++  A      +++               ++  +   +    
Sbjct: 190 VLSPENEDLVSVSLVPYSQHVNAGPKIYNELNTNHRHNYSHCVEMADSAYSETELDLSVT 249

Query: 235 SVRIGTIAYNI------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
             ++    +N                  + T  S + + + +++ +L P   T  +  M 
Sbjct: 250 YDQMQHFQWNYSGANQLTDTICPRYSYERITAFSQDASALNAQIAQLQPRAGTQIFMGMK 309

Query: 283 HAYRELYNEK-----------------ESSHNTIGSTRLKKFVIFITDGEN--------- 316
            A   L                     ++       T   K V+ +TDG+N         
Sbjct: 310 WAAAMLDPAFNPVVNALVTSNDIDSVFDNRPAAFDDTETLKTVVLMTDGKNSSSMRIKSW 369

Query: 317 ------SGASAYQNTLNTL----------------------------QICEYMRNAGMKI 342
                       +  L                                IC   ++AG+ I
Sbjct: 370 AYDSSSDYYHWSRYNLWYYLRRNVNRHYHSRYYWFTHDAAQGDALLDDICNASKDAGIVI 429

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +S+       G D++  C  S   FF V    E+ E+FD I  +I +  + 
Sbjct: 430 WSIGFEVDDHGADVMANCASSPSHFFRVEGI-EISEAFDAIARQINQLRLT 479


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 94/397 (23%), Positives = 163/397 (41%), Gaps = 33/397 (8%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
              +ID+A+++  +NQ+Q A DAA L+  +++VSD    D    K+      K Q     
Sbjct: 37  GGVSIDMANMLMTKNQLQDATDAAALAAASALVSDE-QPDIAAAKEIARKFLKTQAGGTT 95

Query: 73  ------------KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                         G+       D     ++NIT+  N     I +     +  TE   +
Sbjct: 96  TPDAPADSGEGASSGAASSTPDWDDVNTLEVNITETPNGTKGKIFQVTVINKRVTEFNAM 155

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+ +    L   ST      S+N A+S+ +VLD S SM   +     +    +     
Sbjct: 156 TRLLGTDSIELEASSTAESATESKN-ALSMYLVLDRSGSMA--WKTNTINAAKKS----- 207

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
             P   +S WS+       +P       KID L  +  +L+  +   + +   + VR   
Sbjct: 208 -CPNYTESNWSRYPNLWASSPC---YVTKIDALKTAVTDLLAQL--LVADPDQIYVRTAA 261

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES-SHNTI 299
           I+Y    V +    L+   +   + +N L     T +  A   AY+++    E+ +H   
Sbjct: 262 ISY--NSVQDTAGTLAWGTSGAAAYVNALVATGGTASAGAFKTAYQKVIAATENTAHAAK 319

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
                 K+++F+TDGEN+      +   T Q C+  +   ++IYSVA  AP  GQ LL+ 
Sbjct: 320 NGQVPSKYMVFMTDGENN---YANDDTVTKQWCDTAKANKVEIYSVAFMAPERGQALLKY 376

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           C  SS  +F   +  +L+ +F  I ++      R+  
Sbjct: 377 CASSSSHYFEAEEVTDLVAAFKAIGERAAAVVSRLTK 413


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 129/401 (32%), Positives = 217/401 (54%), Gaps = 29/401 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M+A II VC +F+++ ID+ H+++++N +QS+LD A++SGC+ +VSD  I D   ++++ 
Sbjct: 27  MSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPKINDLNPQEERI 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + KK    ++ Q  +  E+A  I + A I+ +KD  N  +Y    +A++++  +N  L
Sbjct: 87  RDVIKKNAYVNMVQN-FPAEHAAYIIENANISFSKDLTNKYEYKITMEAKHQLSGKNFIL 145

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+P+ +T++S  STGII++ S+  A S+ MVLD S SM D                  
Sbjct: 146 GFLMPNVITHISSISTGIIQKPSDKKAFSVEMVLDCSGSMLDSM---------------- 189

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     S       Y+        KI  L  ++ + VN IQ+ +Q    +S RIG 
Sbjct: 190 ---QESCDLSSGRGGYYFYSKNNNKPKSKIYALKTASSDFVNLIQETVQTFPQISARIGL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY--NEKESSHNT 298
           I +N  I+ +  + LSNN N +K  ++++ P   T+T+  M+ AY  L     +  +HN 
Sbjct: 247 ITFNHYIMQD--SKLSNNFNVIKKTISRMKPKGGTDTFLPMNAAYEYLNNIPNETKAHNI 304

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP--EGQDL 356
             +  LK+++I +TDGEN+  S    T+N   +C+  R  G+ IYS+ ++     +G +L
Sbjct: 305 SDNVPLKRYIILMTDGENNHPSYDLKTIN---VCDNARKNGIIIYSIFLNYYEYTDGYEL 361

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            RKC  S   FF  N+++ LL+SF  I   IQ+++VRIA N
Sbjct: 362 ARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAVRIASN 402


>gi|163747459|ref|ZP_02154811.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
 gi|161379312|gb|EDQ03729.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 57/464 (12%), Positives = 114/464 (24%), Gaps = 116/464 (25%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
               +DL      R ++Q+  D AVL+          +    + +      F K      
Sbjct: 45  GGVGVDLMRHERERARVQAVADRAVLAAA-------DLDQTLSPEAVARDYFDKSGLADY 97

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS 132
                             I+    +           A  ++ T  +           ++ 
Sbjct: 98  ------------------ISSVTVEEGLNYRRVTVDASRDLKTMFI---DKFGQEKLHVP 136

Query: 133 LRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSK 192
            ++T       +   + I MVLD+S SM +     +  + +      ++    +      
Sbjct: 137 AKATA----EEKVAKVEISMVLDISGSMRENDKMNNLHDASNVFIDTVIQTDTEDLISIS 192

Query: 193 NTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI---AYN 244
               +                ++           +        +      +       Y 
Sbjct: 193 VVPYTAQVNVGKDIMDELNVTQLHSYSHCVDFEDSDFNLTTISQTRSYEHMQHFEAGYYW 252

Query: 245 IGI-------------------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
            G                       +    S N   +KSR+    P  NT  +  +    
Sbjct: 253 NGNDRDRTGHYDNISNPGCPKQSYEEIETFSQNAAALKSRIANFQPRANTAIHLGLKWGV 312

Query: 286 RELYNE-------------KESSHNTIGSTRLKKFVIFITDGEN---------------- 316
             L                              K VI +TDG N                
Sbjct: 313 ALLDPSFRAINEAIGGDAVFRGRPAEYNDIDTLKTVILMTDGVNVTTRRIAPEAYSNRDH 372

Query: 317 ---------------------------SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
                                      +  +A Q       IC+  +  G+ I+S+    
Sbjct: 373 YRHWSDYPFYWWLGRNVRSSEHYRWYRTKYTAGQADNLLDNICDAAKAKGIVIWSIGFEV 432

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
              G  +++ C  S   FF V    E++++F+ I  +I +  + 
Sbjct: 433 TDHGAAVMKNCASSDSHFFRVEGV-EIVDAFEAIARQINQLRLT 475


>gi|114798549|ref|YP_759188.1| hypothetical protein HNE_0458 [Hyphomonas neptunium ATCC 15444]
 gi|114738723|gb|ABI76848.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 460

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/441 (14%), Positives = 125/441 (28%), Gaps = 50/441 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ I        +AID       + ++Q A+D+AVL+   S+   +       + +  
Sbjct: 19  IAALTIIPIVGIAGFAIDFQVTTTQKARVQQAVDSAVLAATKSMQDGKDRAYSLKEANDY 78

Query: 61  STIFKKQIKKH--------LKQGSYIRENAGDIAQKAQINITKDKN-NPLQYIAESKAQY 111
                 Q            L       E  G +       ++K      L +   S A Y
Sbjct: 79  FKGILNQSNNSGLNCTNIDLVYIDETEELEGHVECSQNTTLSKVAGIRHLDFNVSSAATY 138

Query: 112 -----EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ 166
                EI         +           +      +   +        DV  +M      
Sbjct: 139 GIGKLEIAFVFDVSGSMANDNRMGNLKVAAREAVNTLLPVEGYAGDPEDVRLAMVSYDTM 198

Query: 167 ----------KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE- 215
                      + D          +        +  N T  ++         +   +   
Sbjct: 199 VNAGPYFKAVTNQDPERTEPFYGYIRERTTCRRYRNNGTCREWNYEWRGPYHRSYTIKST 258

Query: 216 SAGNLVNSIQKAIQEKKNLS----VRIGTIAYNIG----------IVGNQCTPLSNNLNE 261
                  + +       +      V     +YN               N   PL+ N N+
Sbjct: 259 CVWEREGAERYTDASPGHNRWLPPVSATFDSYNDSWSTDHQTDPWCNDNTPIPLTYNRNK 318

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT------IGSTRLKKFVIFITDGE 315
           +   ++ + P  NT  +      +  +  E  S                 K VI ++DG+
Sbjct: 319 LHDFIDDMTPRRNTAGHIGQAWGWYLVSPEWNSVWPAGSKALPYDEPDATKVVIMMSDGQ 378

Query: 316 NS----GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVN 371
            +      +   +      IC+ M+   + IY+V   A   GQD+L  C  +    +   
Sbjct: 379 YNETRHNNAYPSSVTQAEAICDKMKEKEVVIYTVGFDAG-YGQDVLNYCASNPAFAYKPT 437

Query: 372 DSRELLESFDKITDKIQEQSV 392
           + +EL E++  I   I +  +
Sbjct: 438 NGQELTEAYKSIARSISDLRI 458


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 81/408 (19%), Positives = 157/408 (38%), Gaps = 33/408 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V   F    ++LA++M ++  +Q+       S   +  ++  +K+     +Q 
Sbjct: 24  MTAILLPVLLGFAGAGMELANVMQVKADLQNTA----DSAALAAATEARLKEGALTDEQI 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I K  I   +++     E             T D      Y  ++   Y++    L  
Sbjct: 80  KEIAKAFIASQMEKTLTEEEKKALEKNSPVNIGTTDDARGKTYTIQTTINYQMQLNPLL- 138

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G   +   +L+   T  +   ++   IS+ +VLD S SM   +     +    +     
Sbjct: 139 -GFFGAKTLDLAATGTA-VSTVNKGAPISMYLVLDRSGSM--SFKTDTLNTKKTS----- 189

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE----KKNLSV 236
                    W         +P       K   L  + G LV ++ KA         +  V
Sbjct: 190 -CQNYTVDNWGSYPNLKNTSPC---YVNKATSLKTAVGYLVATLNKADPTYTANGGSELV 245

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKE 293
           R G   Y       Q  P++   + V + ++K  P      T+   +++ AY  L     
Sbjct: 246 RTGASVYTHETYAAQ--PITWGTSSVATYVDKQIPEFPSGGTDARSSLNAAYNALKKANT 303

Query: 294 ---SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI---CEYMRNAGMKIYSVAV 347
                H    S   +++++ +TDGE +G S+  ++     +   C+  +  G+KI+SVA 
Sbjct: 304 VEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNTCDTAKKDGIKIFSVAF 363

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            AP +G+ LL+ C  S   ++A  +  +++ +F +I  K       + 
Sbjct: 364 MAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIARKAAGSLATLT 411


>gi|218887819|ref|YP_002437140.1| von Willebrand factor A [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758773|gb|ACL09672.1| von Willebrand factor type A [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 406

 Score =  159 bits (402), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 55/435 (12%), Positives = 130/435 (29%), Gaps = 74/435 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V        ID   +    N++Q A+DAA L+G   +  D  +          
Sbjct: 4   LMAVLLPVVLGLAGLGIDSGMLYLAHNRLQGAVDAAALAGSLELPYDPQLDKG------- 56

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + K  + +++          G      + ++T      +                   
Sbjct: 57  --LVKGAVNQYMAANYPAAVLKGVTPGTEERSVTVKAEATVD---------------TIF 99

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G +    + +  ++T           + +  V+D + SM+   +Q+ N      +   +
Sbjct: 100 MGALGIGSSTVRAQATAGYNN------LEVVFVIDNTGSMKGTAIQQANAAATQLAELIM 153

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                          + K    PA  +   D    + G L  S      ++       G+
Sbjct: 154 PDGMETSVKVGLVPFRGK-VHIPAGVDGLADGCRNADGTLAPSWILEEYKQTKYRYPTGS 212

Query: 241 ---IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKES 294
              +         +   L++N   + S + K +       T     +      L  E   
Sbjct: 213 SLNVPKGTCDSIPRVQALTSNRTTIVSAIAKQDALGDASGTVISEGIKWGRHVLTPEAPF 272

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQN------------------------------ 324
           +  +     ++K +I +TDG+        N                              
Sbjct: 273 TQGSSN-KDMRKVMIVLTDGDTEDGKCGGNYALNYTPNAYWTNAYYGMFDMNTHCENGGK 331

Query: 325 -TLNTLQICEYMRNAGMKIYSVAVS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLE 378
                L   +  ++ G++I+++    +      L++        +   ++    + +L E
Sbjct: 332 LNAAMLSEAQIAKDKGIEIFAIRYGDSDSTDISLMKAIASSKAGTDDHYYNAPSAYDLEE 391

Query: 379 SFDKITDKIQEQSVR 393
            F KI  ++  + +R
Sbjct: 392 IFKKIGRQLGWRLLR 406


>gi|323700353|ref|ZP_08112265.1| von Willebrand factor type A [Desulfovibrio sp. ND132]
 gi|323460285|gb|EGB16150.1| von Willebrand factor type A [Desulfovibrio desulfuricans ND132]
          Length = 400

 Score =  159 bits (401), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 51/432 (11%), Positives = 134/432 (31%), Gaps = 73/432 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+++ V       A+D+ ++     ++Q+A+DA  L+G   +  D  +      K   +
Sbjct: 1   MALLLPVLLGVAGIAVDMGNMYMTHTRLQAAVDAGALAGSLELPYDPDL-----SKGIVT 55

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                 ++ ++++                  +T+          +  AQ E+    + L 
Sbjct: 56  QAVNDMVETNMEEAV----------------VTEISAGTEIRSVKVTAQAEVR---MLLM 96

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            ++  A   +   +     +      + +  V+D S SM+   +       +      L+
Sbjct: 97  EVLGMADKTVEASAMAGFNK------LEVVFVIDNSGSMKGTPI-DLVKQASEELTDLLI 149

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN--LSVRIG 239
           P                        +   +  + + G+L   I +   ++ N        
Sbjct: 150 PDGTTPDTKVGLVPFRGKIRLGEAVDGYAEGCVNADGSLNTGINEEFMDEYNALPYYYKR 209

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESSH 296
            I  +         PLS N + + + +           T     +      L  +   + 
Sbjct: 210 YITLDTCSDIPTVLPLSKNKSTIIAAIGSQTATGAASGTVISEGIKWGRNILTPDAPFT- 268

Query: 297 NTIGSTRLKKFVIFITDGE----------------NSGASAYQN---------------T 325
                   +K +I +TDG+                N+  +                    
Sbjct: 269 QAGSKEDFRKIMIVLTDGDTEDGECGGTYRATYRPNNYWTNAYYGMGVDTAHCNDGGVLN 328

Query: 326 LNTLQICEYMRNAGMKIYSVAVS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLESF 380
            + L   +  ++AG++I+S+    +     +L+++       +   +F      ++ + F
Sbjct: 329 ADMLSEAQLAKDAGIEIFSIRFGSSDTTDINLMKEIASSKAGTDDHYFDAPSVYDIPDIF 388

Query: 381 DKITDKIQEQSV 392
            +I  ++  + +
Sbjct: 389 KQIGKQLGWRLL 400


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 82/446 (18%), Positives = 175/446 (39%), Gaps = 62/446 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+++ V        +D+    Y  + ++ A   A+++    ++  +++++ +++   +
Sbjct: 25  ITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI--QSLEEVSSRAKNS 82

Query: 61  STIFKKQIKKHLKQG--SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENL 118
            T  K++I+++L +   + +++N  D   +  +  T  + NP +   +            
Sbjct: 83  FTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLN 142

Query: 119 FLKGL-----IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH----- 168
            L        I S L      +  +     +   +SI  V+D SRSM D           
Sbjct: 143 PLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLN 202

Query: 169 ---------NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP-------------- 205
                      + +  + K  +       +         Y   P P              
Sbjct: 203 CFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSS 262

Query: 206 ----ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
                 +K  ++ ++  +++ SI+K   +  N +VR+G   +N  ++ +     S  +++
Sbjct: 263 SLRHVIKKKHLVRDALASVIRSIKKI--DNVNDTVRMGATFFNDRVISD--PSFSWGVHK 318

Query: 262 -----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITDGE 315
                VK+     N   +T    AM  AY  + +  E   H    +   KK+++ +TDGE
Sbjct: 319 LIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGE 378

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD----LLRKCTDSSGQFFAVN 371
           N+     Q+    + IC   ++ G++I ++A S     Q+     L  C      FF  N
Sbjct: 379 NT-----QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCAS-PNSFFEAN 432

Query: 372 DSRELLESF-DKITDKIQEQSVRIAP 396
            + EL + F D+I ++I E+ +RI  
Sbjct: 433 STHELNKIFRDRIGNEIFERVIRITK 458


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/400 (18%), Positives = 150/400 (37%), Gaps = 23/400 (5%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++ V       A+D   ++  R+ +QS++     +  A+  +              
Sbjct: 53  MTAVLLPVSIGVAGLAMDATEMVQSRSALQSSV---DAAALAAASAMSNGMSEADAIALA 109

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            +    Q+   + +             +  I++   + N      + +           L
Sbjct: 110 KSFLSSQLANTMARDENTSSVDQITQAEPDISVKTTQVNSSSTSYDVELTGSYTITMNPL 169

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++      L          ++    +S+ +VLD S SM          N+   +    
Sbjct: 170 SRVLGWETVTLKAYGKAQAATTASESPLSMYLVLDRSGSM----------NDETATTYTG 219

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  S +  N   +  + +      KI+ L  +  +L   ++KA  +  +  VR G 
Sbjct: 220 TCTKTTTSGYGWNKKTTTTSYSCTKNYTKIESLKLAVADLAAQLKKA--DPNSEYVRTGA 277

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
            +YN     +    +S     V + +N L+    T+   A+  AY  L    ++      
Sbjct: 278 DSYNASA--DTAQAMSWGTANVVTYVNALSATGGTDARGALSAAYSALQTSNKTEITAHN 335

Query: 301 STRLKK---FVIFITDGENSGASAYQNTLNTLQI---CEYMRNAGMKIYSVAVSAPPEGQ 354
            + + K   +++F+TDGE +G S+  ++     +   C  ++  G++IY+VA  AP  G+
Sbjct: 336 VSSVSKIGRYIVFMTDGEMTGNSSSWSSSIDSAVRSQCTSIKADGIQIYTVAFMAPANGK 395

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            LL  C   +  ++   D+  L+ +F +I  K    S R+
Sbjct: 396 SLLSACASDASHYYEATDAASLVAAFGEIGKKATSTSTRL 435


>gi|118591415|ref|ZP_01548813.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
 gi|118436087|gb|EAV42730.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
          Length = 474

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/463 (13%), Positives = 143/463 (30%), Gaps = 90/463 (19%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             +++ +  +     ID++  +  R ++  A+DAA LS  A + +           +Q  
Sbjct: 28  FGLMVVLIVVIAGITIDVSRTVNAREKLSFAIDAAALSVAADLSTSV------MSDEQIK 81

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                  K +L    ++ E   +++      +   +N  ++  + +           +  
Sbjct: 82  AALADSFKANLADVEFLDEAIKNLSF-----VVDAENGTIKVSSFATLDNYFIDMGGYGM 136

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
             +     N    S      +     + + +V+DV+ SM +        + +      L+
Sbjct: 137 QALGPETFNFGTSSQ----VTYSRFDVELALVVDVTGSMRNDM--DTLRDASKGLVNILI 190

Query: 182 PPP----PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS-V 236
           P        K   S              A  K  V   +  ++  + ++   + +++  V
Sbjct: 191 PETTEEADSKVRISLVPYSQGVNLGTYAAKVKGGVYGYADSSVCVTERQDYDDGEDIYKV 250

Query: 237 RIGTIAYNI-------------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT 277
           R   + YN                        ++  PL+ + + +   +  L+    T  
Sbjct: 251 RYTDMPYNYYVKTDPPPKDVFYGGGSNRCSGTSKMIPLTADRDTLLDAIADLDDNGGTAG 310

Query: 278 YPAMHHAYRELYNEKESSHN------TIGSTRLKKFVIFITDGENSG------------- 318
              +   +  +                  +  + KF I +TDG+N+              
Sbjct: 311 QTGVVWGWNSISPNYSDVWPLASKPEPYDNDDVLKFAIIMTDGDNNRFYEFVKEREECDW 370

Query: 319 ---------------------------ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
                                      +    ++     +C+ M++ G+ I+ V      
Sbjct: 371 VYSRRYGWQWTCEMVSVNQWQERSESESYNNNSSKAQRALCQAMKDEGISIFGVYFGTND 430

Query: 352 E--GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              G   ++ C  + G ++    S EL+ +F  I  KIQ+  V
Sbjct: 431 SSAGSKNMQSCAST-GNYYKATSSDELINAFANIAKKIQQIYV 472


>gi|254486311|ref|ZP_05099516.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043180|gb|EEB83818.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 476

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/469 (12%), Positives = 115/469 (24%), Gaps = 116/469 (24%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           +  +     +D       R ++Q                              + +    
Sbjct: 40  MMVMVGGIQLDFMRHEMERTKLQ-------------------------AAADRAVLAAAD 74

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
           + + L     + E          ++    +N         KA  E+ T+ L   G     
Sbjct: 75  LDQTLAPADVVDEYFAKSGMSDYLSSVTIENGLNFRTVTVKANNEMKTQFL---GRFGFP 131

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
             ++   S          +++    VLDVS SM++        +   T    +L P  K 
Sbjct: 132 TLDVPALSKAEERVEKVEISL----VLDVSGSMKNNSKLTTMKDAAKTFIDTVLRPETKN 187

Query: 188 SFWSKNTTKSKYAPA-----PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
           +        S+          A                     +          +     
Sbjct: 188 NVSLSLIPYSEQVNVGPDIFNALWVDTRHDFSYCIDVPDGHFVQTQMTPGFPWDQTQHFQ 247

Query: 243 YNI------------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
           +N                     V  +  P+S +   +K++++   P   T  Y  M   
Sbjct: 248 WNTYSIESGYQQNTLHDTVCPRAVYERVRPISQDGPSLKAQIDLFQPRAGTAIYMGMKWG 307

Query: 285 YRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
              L                                  K ++ +TDG+NS +        
Sbjct: 308 TALLDPSFRETTASLVSDSVVESTFADRPADYSDRETLKTIVLMTDGQNSNSQRISTAYY 367

Query: 328 TLQ-------------------------------------------ICEYMRNAGMKIYS 344
                                                         IC   ++ G+ I++
Sbjct: 368 NSSSEVVHWSKWNFNYYLSQYIKEKDWHRYYYTRYTAEKGNTLMDNICSAAKDEGIVIWT 427

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +       G D+++KC  S   FF V    EL ++F  I  +I +  + 
Sbjct: 428 IGFEVNDTGADVMKKCASSPSHFFRVEGV-ELTDAFSAIASQINQLRLT 475


>gi|114705525|ref|ZP_01438428.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
 gi|114538371|gb|EAU41492.1| Flp pilus assembly protein TadG [Fulvimarina pelagi HTCC2506]
          Length = 461

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 55/463 (11%), Positives = 121/463 (26%), Gaps = 76/463 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCAS-----------------I 44
            A+ I    L +   +D+     +   +Q A+D A L    +                  
Sbjct: 1   MALAILPMLLAVGGTVDVGRQSSLATDLQEAIDIAALHIAKAPSDAIPGEEDVLQLIKSN 60

Query: 45  VSDRTIKDPTTKKDQTSTIFKKQIKKHL----------------KQGSYIRENAGDIAQK 88
           ++ +  +    K D T           +                +     RE  G+I   
Sbjct: 61  ITTKDSRIALKKLDVTEKDVSLHATAEITPFFLGLAGIKNLTAQRATKTAREARGEIEVA 120

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAI 148
             ++ T   +             +     L          T +++               
Sbjct: 121 LVLDTTWSMSEKDSSGKSRLDSLKGAAAKLVDTIFTEDGKTRVAVVPYADYVNVGTQ--H 178

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF----------------WSK 192
                LDV  S      ++  +     +      P  + +                  S+
Sbjct: 179 RNQSWLDVPPSYSTTPSERRCETRTTRTQCTSYAPTYQCTRTVDGVSESTTCGGGCTSSE 238

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
               + Y       + +         +   ++           +R               
Sbjct: 239 TVQVAPYEYCTGGGSSRTYDWYGCVASR--TVGDYRLTDARPDIRYPGFLGTSRECPGPL 296

Query: 253 TPLSNNLNEVKSRLNKLNPYEN-----TNTYPAMHHAYRELYNEKESSHNTI--GSTRLK 305
             LS    +VK+ ++ L+         T     +      L              +   +
Sbjct: 297 LSLSTREADVKTSISNLSYGGGGYRPSTFIPAGLIWGLNVLSPPAPFEEQAYDPNNKLPR 356

Query: 306 KFVIFITDGENSGASAYQN---------------TLNTLQICEYMRNAGMKIYSVAVSAP 350
           K ++ +TDG N+      +                 +T+ IC  ++ +G++I++V     
Sbjct: 357 KALVLMTDGANTMVFNSSDGRHRNARSGTEVAQSDRDTISICNNIKRSGIEIFTVGFMVN 416

Query: 351 PEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                DLL++C      +F      EL  +F +I D + +  +
Sbjct: 417 SSSALDLLKECATDGEHYFDATSPEELHSAFGRIADGLTQIRL 459


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score =  153 bits (387), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 84/344 (24%), Positives = 137/344 (39%), Gaps = 25/344 (7%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q+  +L+ G  I+   G   Q      T    N   Y       Y++    L  
Sbjct: 1   RNFVAGQMANYLQSGVDIKSATGVTVQ------TNTSGNSTSYQVTVSPSYDLTVNPL-- 52

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +     +LS   T I   S    +IS+ + LD S SM +      N+ +   S  Y 
Sbjct: 53  MQAVGFTTQHLSTSGTTIGGHSQTQGSISMYLALDKSGSMGED-TATVNEEDPTESYTYD 111

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 K       T +    + A    KI+ L  +AGNL   +  A  +     VR G 
Sbjct: 112 CNGHYNKKGKWIYDTCTG---SRANYYTKIEALKMAAGNLFGQLSSA--DPNAQYVRTGA 166

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNEKE 293
           ++Y   IV    + L+   + V + +N L     TN+  AM  AY  L        + ++
Sbjct: 167 VSY--DIVQYTPSALAWGTSGVSTYVNALQAGGGTNSSGAMSTAYSSLTAKNAAGNDAED 224

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSAPP 351
           ++H        KK+++F+TDG+N+  S+   + +T     C+  ++ G++IY++A  AP 
Sbjct: 225 AAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPE 284

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            GQ LL  C      +F      +LL +F  I  K   Q  R+ 
Sbjct: 285 GGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQLTRLT 328


>gi|269105138|ref|ZP_06157832.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268160588|gb|EEZ39087.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 436

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 62/439 (14%), Positives = 122/439 (27%), Gaps = 66/439 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I V F   T A D A  +  + +++ A +AA L+  A    +       +     
Sbjct: 14  LFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPNVNSDGLGSGSKVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +K ++     I            I       N  +       +YE+       
Sbjct: 74  RRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRF---FEYEVEALTTQN 130

Query: 121 KGLIPSALTNLSLRSTGIIERS----SENLAISICMVLDVSRSMEDLYLQKH-------- 168
                + + +    +      S     ++ A+ +    D S+SME+ +            
Sbjct: 131 SWFPGNNVISGFGDTFSTRGHSLARKYQSEAVDVVFAADFSKSMEEPWTGGRQKYKDLVR 190

Query: 169 ---------------NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
                          N  +    N   + P    ++   +   S +           D  
Sbjct: 191 VINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCFMKQDYFEKNSRDHR 250

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            +   ++  ++     EK N S        +          L+N+ +     + K  P  
Sbjct: 251 KKKYVDIKRTLNNIFIEKGNDS---CGFKSDDPDAVFHDIYLTNDFDTFNKEIRKFRPGN 307

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T +   +  + + L             T  ++ +I I+DG +             +I  
Sbjct: 308 GTASCQGIIRSAQML----------RKGTNSRRLLIIISDGNDWYYPYSGYKETDKEIAN 357

Query: 334 YMRNAGM---------------------KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
            + NAGM                     +I  +           L  C       F    
Sbjct: 358 KLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCA-GEDNVFKAQY 416

Query: 373 SRE-LLESFDKITDKIQEQ 390
             E L +    IT++I   
Sbjct: 417 RDELLDQILSLITEEIGHL 435


>gi|254501086|ref|ZP_05113237.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
 gi|222437157|gb|EEE43836.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
          Length = 465

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/461 (13%), Positives = 128/461 (27%), Gaps = 86/461 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ V  +    AID++  +  R ++  A+DAA LS    + +     +      Q 
Sbjct: 20  IFAGMVLVLVVIGGAAIDISRAVNAREKLAYAIDAAALSVATDLSTTVLRDN------QI 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            T  +   + +L    ++ +   ++             +         +   +    L +
Sbjct: 74  KTRIENSFRANLSDAEFLDQAIDNLDF---------DVDSNAGTVTVSSSAGLNNYFLNI 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G     L           E +     + + +V+DV+ SM          +        L
Sbjct: 125 PGFGKDGLGPDVFNFGTSAEVNYSRFDVELALVVDVTGSMAGDM--GALRDAAEEVVDIL 182

Query: 181 LPPPPKKS----FWSKNTTKSKYA--PAPAPANRKIDVLIESAGNLVNSIQKAI----QE 230
           +      S      S              +                    +        +
Sbjct: 183 IEDDASNSASKVRISLVPYSQGVNLGSYASTVTNGSTSWRNCVNEREGQQKYTDAVYNYD 242

Query: 231 KKNLSVRIGTIAYN--------------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
             N     G  +Y                    +   PL+++ N + S +  L+    T 
Sbjct: 243 GTNSEYFHGLQSYFIWDYGSSENWSSARDDCPSSSLQPLTSDKNTLISDIRNLSSGGGTG 302

Query: 277 TYPAMHHAYRELYNEK----------ESSHNTIGSTRLKKFVIFITDGENS--------- 317
               +   +  L              E   N      +KKF + +TDG+ +         
Sbjct: 303 GQTGVAWGWYTLSPNWTSLWPTDSDPEPYGNGTPDDDVKKFALIMTDGDFNAQYGKEERT 362

Query: 318 ------------------------GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                                                +C+ M+   ++I++V        
Sbjct: 363 TCTGRGRNRVCTTNEYWVERYHRYSDYNDPPATRARTLCDAMKAENIEIFTVFFDTGGSA 422

Query: 353 -GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G DL+  C   S  ++  ++  EL+ +F  I  +IQ+  +
Sbjct: 423 FGDDLMSYCASGSDYYYEADNKDELITAFSNIAKRIQQIYL 463


>gi|288956977|ref|YP_003447318.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
 gi|288909285|dbj|BAI70774.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
          Length = 456

 Score =  152 bits (383), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 57/439 (12%), Positives = 122/439 (27%), Gaps = 63/439 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+   V    +  AID A   ++ +++  A DAA L+               +  DQ 
Sbjct: 32  MVALSFLVLLGMLGVAIDFARAQFVSSRIYYAADAATLAVSRE-------NFQVSTNDQL 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + +     +           G +     +++      P            +P     L
Sbjct: 85  KALAQSYFDANFPP--------GTMGATTSLSVATSGTPPTVQGFTVTVTATLPLVFAPL 136

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLA----ISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
              +          S       +   +    + + +VLD S SM+            +  
Sbjct: 137 VETLGGPTIGSVGISKASGAVFTTQTSNQGGMELVIVLDNSASMKGSQEDLRGGVKALLD 196

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN--- 233
             Y      K  +              +    K D++    G + N     +  K N   
Sbjct: 197 MLYGNADTRKNLYVGIVHYSGAVNVLQSALKNKADIVAPVVGGMANCPMATVNGKLNGSR 256

Query: 234 ------------LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAM 281
                        +     I Y         + LS N  +    +       +T     +
Sbjct: 257 LSNAPPKTFKFDSTTDGVEIQYCGASTLGTSSALSPNRGDADKAIKSYVAGGDTLIGEGL 316

Query: 282 HHAYRELYNEKESSHNTIGS-----------TRLKKFVIFITDGEN-----SGASAYQNT 325
              +R L        NT                +KK ++ +TDG N     +  + Y + 
Sbjct: 317 VWGWRMLTPSWRGLWNTKDQPGASLPLDYDLPYMKKVLVLMTDGVNHIAGRNYTAYYSDP 376

Query: 326 LNTLQ-----------ICEYM-RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
             T+            IC    ++  + +Y++   +    +  +  C     + +     
Sbjct: 377 YQTVADASKADADLMTICNAAKKDHNVVLYTITYGSD-TDEQQMSDCASDPSKHYHAALP 435

Query: 374 RELLESFDKITDKIQEQSV 392
           ++L ++F ++   +    +
Sbjct: 436 QDLAKAFTQVGTDLTTMKL 454


>gi|312621090|ref|YP_003993818.1| protein tadg, associated with flp pilus assembly [Photobacterium
           damselae subsp. damselae]
 gi|311872811|emb|CBX86902.1| Protein TadG, associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae]
          Length = 436

 Score =  152 bits (383), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/439 (14%), Positives = 123/439 (28%), Gaps = 66/439 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I V F   T A D A  +  + +++ A +AA L+  A    +       +     
Sbjct: 14  LFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPNVNSDGLGSGSKVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +K ++     I            I       N  +       +YE+       
Sbjct: 74  RRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRF---FEYEVEALTTQN 130

Query: 121 KGLIPSALTNLSLRSTGIIERS----SENLAISICMVLDVSRSMEDLYLQKH-------- 168
                + + +    +      S     ++ A+ +    D S+SME+ +            
Sbjct: 131 SWFPGNNVISGFGDTFSTRGHSLARKYQSEAVDVVFAADFSKSMEEPWTGGRQKYKDLVR 190

Query: 169 ---------------NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
                          N  +    N   + P    ++   +   S +           D  
Sbjct: 191 VINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCFMKQDYFEKNSRDHR 250

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            +   ++  ++     EK N S        +          L+N+ +     + K  P  
Sbjct: 251 KKKYVDIKRTLNNIFIEKGNDS---CGFKSDDPDAVFHDIYLTNDFDTFNKEIMKFRPGN 307

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T +Y  +  + + L             T  ++ +I I+DG +             +I  
Sbjct: 308 GTASYQGIIRSAQML----------RKGTNSRRLLIIISDGNDWYYPYSGYKETDKEIAN 357

Query: 334 YMRNAGM---------------------KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND 372
            + NAGM                     +I  +           L  C       F    
Sbjct: 358 KLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCA-GEDNVFKAQY 416

Query: 373 SRE-LLESFDKITDKIQEQ 390
             E L +    IT++I   
Sbjct: 417 RDELLDQILSLITEEIGHL 435


>gi|110679843|ref|YP_682850.1| hypothetical protein RD1_2614 [Roseobacter denitrificans OCh 114]
 gi|109455959|gb|ABG32164.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 488

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/483 (11%), Positives = 124/483 (25%), Gaps = 118/483 (24%)

Query: 1   MTA-IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + A +++ +  L    A+DL     +R ++Q+ LD A+L+          +  P    + 
Sbjct: 33  IFATMMVLMMLLVCGIAVDLMQNEMMRTRVQNTLDRAILAAS-------DLDQPLPADEV 85

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
               F K           I                    +                    
Sbjct: 86  VDDYFAKAGMTEFLDDVQITP----------------GAHLPTTNFRVVQAEARTRTPSI 129

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
              +       + +  T      +  +++    VLD+S SM +     +           
Sbjct: 130 YMAMTGVRSLPVYVAGTAEETIENTEISL----VLDISGSMRNNGKIGNLRTAAKDFIGA 185

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKI----------------------------- 210
           +L      +        +          ++                              
Sbjct: 186 VLEGNAANTTSLNIVPYAGQTNPGPIVFQRAGGRPFATFIEDSDGNEILYGQTFVDDEGN 245

Query: 211 ------DVLIESAGNLVNSIQKAI-------QEKKNLSVRIGTIAYNIGIVGNQCTPL-- 255
                 + +                      Q    ++  I     + G      + +  
Sbjct: 246 SIDVPYNTMSSCLDLTNGDFDNIDLPSGGYDQTPYFMNWPIDAPTMDWGWCPQNKSSIRY 305

Query: 256 -SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES-----------------SHN 297
             NN  +++  ++ +  ++ T T   M +    L                          
Sbjct: 306 AQNNAGQLQDFIDDMRLHDGTGTQYGMKYGVALLNPSSRDTFVALNAAGLVPDGFKDRPA 365

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTL---------------------------Q 330
             G+T  +KF++ +TDG+ +     ++  +                              
Sbjct: 366 DFGTTDTRKFIVLMTDGQITDQFRPEDKNDPKNDEIALNQRIGDRDTYATQSTNVANFYS 425

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           IC   + AG+ +Y++A  AP      +R C  S   F+ V    E+  +F  I  +I E 
Sbjct: 426 ICNKAKAAGITVYTIAFEAPANAITQMRTCATSPAFFYKVEGV-EIKTAFKSIARQINEL 484

Query: 391 SVR 393
            + 
Sbjct: 485 RLT 487


>gi|86749514|ref|YP_486010.1| hypothetical protein RPB_2394 [Rhodopseudomonas palustris HaA2]
 gi|86572542|gb|ABD07099.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/432 (15%), Positives = 132/432 (30%), Gaps = 45/432 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIV--------------- 45
           + AI +     FI  AID +     R  MQ+ALD+A L     +                
Sbjct: 28  IFAIALLPMIGFIGAAIDYSRANKARTSMQAALDSAALMVSKDLASGVITAGQVSAKAQS 87

Query: 46  ------SDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
                 ++    + T     T+          LK    I     ++     + I      
Sbjct: 88  YFASLYNNTEAPNITVTATYTAKDSTGSSTVLLKGTGDISTEFMNMFGFPTLGIGSAATA 147

Query: 100 PLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS 159
                    A     T ++   G +P+  +        +   +     + I ++      
Sbjct: 148 TWGGTRLRVAIALDVTGSMASAGKMPAMQSAAKTLVDNLRANAQTADDLYISII----PF 203

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
            + + + K N N +     Y        ++W   T  S  +     ++           +
Sbjct: 204 AQMVNVGKSNKNASWIKWDYWEDTTGSCNWWWLTTKSSCESAGRTWSSTNQSQWGGCVTD 263

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP---LSNNLNEVKSRLNKLNPYENTN 276
                          + R     Y+              S+N   +K +++ L+P   TN
Sbjct: 264 RDQPADTTKDAPTTAATRFPAANYSACPEQILPMTSAYSSSNATTIKDKIDALSPNGGTN 323

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGENSGASAYQNTL--------- 326
               MH A+  L +    +     +       +I ++DG N+    Y N           
Sbjct: 324 QPIGMHWAWMSLQDGAPLNTPAKDADYKYTDAIILLSDGMNTIDRWYGNGSSWSKDVDAR 383

Query: 327 -----NTLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESF 380
                + ++           IY++ V+   + + ++L+ C DS G FFA   +  +  +F
Sbjct: 384 QKLLCDNIRAASAASTTKTVIYTIQVNTDGDPESEVLKYCADS-GNFFATTTASGISTAF 442

Query: 381 DKITDKIQEQSV 392
            +I   + +  +
Sbjct: 443 AQIGASLSKLRI 454


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 59/408 (14%), Positives = 120/408 (29%), Gaps = 25/408 (6%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
                    +D++    + +++++ALDA+ L+   +     +      +    +     +
Sbjct: 29  PVVAAAGATVDISRAYIVESRLKAALDASALAVGGATGMTTSQMQAMAQSFFNANYPASK 88

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDK-NNPLQYIAESKAQYE---------IPTEN 117
           +            N   ++  AQ+  T             + +Q           +  +N
Sbjct: 89  LGVPGTLSVSQSGNVVSLSVHAQLPTTLMGVVGINTLNVSATSQVTRMGKKLEVALVLDN 148

Query: 118 LFLKGLIPSALT-------NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                               ++  S          +AI    V     +  +     H D
Sbjct: 149 TGSMASGGRMTVLKTAAKNLITTVSAAATNPGDVKVAIVPFNVDVNIGTTNENVSWLHWD 208

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
               +                     +              +  +   +  N+       
Sbjct: 209 EFTPSGGGGNGNGNCNIIQILLGLCNNNNNSNSHAGWEGCVMDRDQNYDAQNTFPPPNPG 268

Query: 231 KKNL--SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
             N        + + N         PLS N + + S ++ +    NTNT   +   +  L
Sbjct: 269 GSNATRYPASNSDSDNSNCNLQTIMPLSTNWSALNSHIDAMASAGNTNTTIGLAWGWNML 328

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN----TLNTLQICEYMRNAGMKIYS 344
                 S     +  L K ++F+TDG+N+      N       T  IC  ++ AG+K+YS
Sbjct: 329 TQGGPLSSAAAPAANLDKVIVFLTDGDNTRNRWSNNSNTINARTTLICNNIKAAGIKVYS 388

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           V V        L+R C    G +++V  + EL   F  I   +    +
Sbjct: 389 VRVIEG--NATLIRNCATEPGMYYSVTTASELTSVFASIAQSLSNLRI 434


>gi|254506100|ref|ZP_05118244.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
 gi|219550918|gb|EED27899.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
          Length = 415

 Score =  150 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/416 (15%), Positives = 129/416 (31%), Gaps = 41/416 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+II   F   T A D A  +  + +++ A + AVL+  A    ++  +   +     
Sbjct: 14  LFAMIIPGLFGIFTLATDGARALQTKARIEDASEIAVLAIAAHNDDNQDSQGAGSGSRVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  +L+  + +           QI         L        QYEI   ++  
Sbjct: 74  RQIATDYLNAYLRDSTQLTGLKVKKYNCDQIAEC---RAGLARGEPRFFQYEIEVSSVQD 130

Query: 121 KGLIPSALTNLSLRST----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                +        +       + R  ++ A+ I  V D S SM   +    N       
Sbjct: 131 TWFPGNDSIEGFGDTFSAKGAAVARKYQSEAVDIIFVSDYSGSMAWNWSGGRNRKYIDLR 190

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKK-NL 234
           N         + F   N T +      A     K      S    +  +         + 
Sbjct: 191 NIIQEVTDELQKFNDLNNTDNNTVGLTAFNYYTKTVPSNRSNHCFMTQLVNPNGRFSASQ 250

Query: 235 SVRIGTIAYNIGIVGN-------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
           +VR   +  N     N       Q  PL++N +   + +    P   T ++  +    + 
Sbjct: 251 TVRNIFVEKNNRYCVNHGDSSRFQDLPLTDNYSSFNNSVRSFYPNHGTASFQGIIRGAQM 310

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA--------- 338
           L                ++ +I ++DGE+   S +   +N   +C  + N          
Sbjct: 311 L----------RKGRNPRRLLIVLSDGEDGDPSRHMQLVNA-GMCSTIVNTLSGDLTPDG 359

Query: 339 ---GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDKIQEQ 390
                ++  V           L+KC  +    +   +  + L +  + IT++I   
Sbjct: 360 HKVKARLAVVGFDYDVNKNRALQKCVGAE-NVYKAQNRDDILNKILELITEEIGHL 414


>gi|83859217|ref|ZP_00952738.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852664|gb|EAP90517.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 436

 Score =  150 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 67/442 (15%), Positives = 134/442 (30%), Gaps = 77/442 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+   V    +  A+D +    + +++QSALD+  L+  +            T+    
Sbjct: 22  IMALCSGVLVTAVGGALDYSRSTTVSSELQSALDSGALAAASL-----------TQDRNP 70

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + +  ++  L     +  +                 +    +  + A   +PT  L  
Sbjct: 71  EDVVRAYVEAALADHPQLLASLQLDVVA--------DISLNSRVVNATASVAMPTTML-- 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL+      L   S  I +     +++    VLDVS SM    +    D   +   + +
Sbjct: 121 -GLVGINTLTLEHASEAIEQVRDVEISL----VLDVSGSMGGSKINALQD-AAIEFVEIV 174

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           L     +         +     P   N+ I     +       +         +++    
Sbjct: 175 LAADAAERTSISVIPYNGGVRTPREVNQDIVSGNNNHRRQSGCVDMGTDYPVEMTLPYRE 234

Query: 241 IAYNIGIVGNQCTP---------------LSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
           + +       Q                  LS N   ++  +N L    NT    A     
Sbjct: 235 MEFTEYYGSEQTGNSSSAFCPRSNMESEFLSQNEGRMRGLINSLRAEGNTGLDVATMWGA 294

Query: 286 RELYNEKES--------SHNTIGSTRLKKFVIFITDGENSG------------------- 318
           R L                 +       K ++ +TDGE +                    
Sbjct: 295 RALDPAWRGNLGGSFSDRPASYDDRDTIKILVVMTDGEATAQIRSEEYTYYDWWGRERTG 354

Query: 319 ------ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-APPEGQDLLRKCTDSSGQFFAVN 371
                  SA Q   N  + C+     G++IY++A   +    +DL+R C +    ++ V 
Sbjct: 355 TRSYELYSARQARENMAEACDIAEGNGVQIYTIAFQLSGQTNRDLMRNCANKPQNYYQVE 414

Query: 372 DSRELLESFDKITDKIQEQSVR 393
           +  ++ E+F  I   I    + 
Sbjct: 415 NL-DIAEAFSSIAADINRLRLT 435


>gi|294139879|ref|YP_003555857.1| hypothetical protein SVI_1108 [Shewanella violacea DSS12]
 gi|293326348|dbj|BAJ01079.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 405

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 66/401 (16%), Positives = 126/401 (31%), Gaps = 49/401 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I +      I  +I LA  +    +   A DAA L+   S  +D+            
Sbjct: 17  MFVICLPFILTMIAVSILLAMYLLTVTRAGQASDAASLACGYSQRADQD----------- 65

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                      L  G       G +    +  ++ D  N          +         +
Sbjct: 66  -----------LLVGILDYYRPGFVVHDGEALVSIDGKN------RCSIEATYRFNPTMM 108

Query: 121 KGLIPSALTNLSLRST----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
             L  SA T++SL S       +  +S  L + + +VLD+S SM     Q     N    
Sbjct: 109 ALLPESARTHVSLSSDTGATSHLVINSTPLPMDLALVLDISSSMSAQLPQLKLIINGALE 168

Query: 177 NKYLLPPPP-KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK--- 232
                 P       +S    ++      AP   K    +     L          +    
Sbjct: 169 EIRQQDPNEVGGVRFSLVPFETGVGVLNAPWMPKSAAKVTCVDGLSYGQHSVDYARTVDD 228

Query: 233 --------NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
                   N+     +   +   +     PL+ +LN VK R++ L     T++Y  +   
Sbjct: 229 LAEPAANLNIKSVFASQWLDACSMDATILPLTQDLNLVKQRVDALVTSGTTSSYQGLIWG 288

Query: 285 YRELYNEKESSHNTIGSTRLK--KFVIFITDGENSGASAYQNTLNTLQICEYMRNA-GMK 341
            R L  + +              + ++  TDG + G   + + L    +C  +++   ++
Sbjct: 289 VRTLLPQWQEEWQIPPVESPALIQRLVLFTDGADQG--FHLDDLIEQGLCRVIQDKHHIE 346

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           +  +            R+C    G+ +   +++EL   F +
Sbjct: 347 MSFIGFGVSDRRLQQFRECAGDKGKVYDAQNTQELEAFFRE 387


>gi|307943467|ref|ZP_07658811.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773097|gb|EFO32314.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 466

 Score =  149 bits (375), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 61/463 (13%), Positives = 137/463 (29%), Gaps = 93/463 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A +  +  +    A+D    +  R+++ +A+DAA L+    + +    ++      Q 
Sbjct: 24  LVAGVCLILLVVAGSAVDYGRALGYRHKIANAVDAAALTVAKQLSTTVLTEN------QI 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            T  K   + +L       +   ++  K           P +   +  +  +I T  + L
Sbjct: 78  RTGLKNAFRANLNAAGINSQGIDNLDFKVD---------PGEGTLDVWSSVDIQTNFIKL 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G+ P       L      + +     + + +VLDV+ SM            + +    L
Sbjct: 129 GGIGPE-----KLEVGAASQVNYSRFDVELALVLDVTGSMRPDMNA--LKEASKSIVNIL 181

Query: 181 LPPPPK----KSFWSKNTTKSKYA--PAPAPANRKIDVLIESAGNLVNSIQKAIQ----- 229
           LP        K   S                                   +         
Sbjct: 182 LPDDSNSRESKVRISLVPYSQGVNLGSYATRVTNGGSTWRNCVNERSGPQKFTDAPYNYA 241

Query: 230 ----EKKNLSVRIGTIAYNIGIVGNQCT---------PLSNNLNEVKSRLNKLNPYENTN 276
               +  +   +     Y                   PL+ +  ++   ++ L     T 
Sbjct: 242 GSRSDFFHGKPKQFVWDYGWTEQWQTRPEACPKTAVEPLTADRTKLLRAISGLKDGGGTG 301

Query: 277 TYPAMHHAYRELYNEKESSHNTIGS----------TRLKKFVIFITDGENSGASAYQNT- 325
               +   +  L  + ++      +             KKF + +TDG+ + A  +    
Sbjct: 302 GQTGIAWGWYTLSPKWKNLWPRDSAPATYGTGSHTDDTKKFALIMTDGDFNAAYGWDCGC 361

Query: 326 ----------------------------------LNTLQICEYMRNAGMKIYSVAVSAPP 351
                                                 ++C+ M++  ++I++V      
Sbjct: 362 RKIRDKPLYCRKKSNKKSWIERYFSPSKISHAPAQRAKKLCDEMKSKNIEIFTVYFDTGG 421

Query: 352 E--GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              G DL+  C   S  ++  ++S EL+++F  I ++IQ   +
Sbjct: 422 ATFGDDLMSYCASGSRNYYRADNSNELIQAFSNIANEIQSIYI 464


>gi|39936212|ref|NP_948488.1| hypothetical protein RPA3149 [Rhodopseudomonas palustris CGA009]
 gi|39650067|emb|CAE28590.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 455

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/429 (14%), Positives = 126/429 (29%), Gaps = 40/429 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  A+D +     R  +Q+ALD+A L     +       D  + K   
Sbjct: 28  IFALALVPLLGFIGVAVDYSRANNARTSLQNALDSAALMLSRDLGVGTITPDQVSSK--A 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA--------------E 106
            T F             +              I       +Q                  
Sbjct: 86  QTYFNSLYTNKETGAVTVTATYTAKDGSGSSTIAMSGQGAVQTQFMKILGFQTMAIGSST 145

Query: 107 SKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD-----VSRSME 161
           +               +  S  +   + +     ++  +   +    +D     V    +
Sbjct: 146 TTTWGGTRLRVAMALDVTGSMASAGKMSAMKTAAKNLVDSLRASAQTVDDVYISVVPFAQ 205

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
            + +   N N +              S W  +T  S             +       +  
Sbjct: 206 MVNVGSSNRNASWVRWDLWDESNGSCSSWWYSTKSSCEYAGRTWTATSHNQWAGCVTDRD 265

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNTY 278
                      + + R   + Y+           +    N   +K++++ L+P   TN  
Sbjct: 266 QPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSAYSLSNATTIKNKIDALSPNGGTNQA 325

Query: 279 PAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGENSGASAYQNTLN--------TL 329
             MH A+  L      +     S       +I ++DG N+    Y N  +          
Sbjct: 326 IGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILLSDGLNTVDRWYGNGRDWSPQVDARQR 385

Query: 330 QICEYMRN-----AGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKI 383
            +C+ +R        + IY++ V+   + +  +L+ C DS G FFA   S  +  +F +I
Sbjct: 386 ILCDNIRASATNTNPVVIYTIQVNTDGDPESAVLKYCADS-GNFFATTTSSGIGTAFAQI 444

Query: 384 TDKIQEQSV 392
              + +  V
Sbjct: 445 GSSLSKLRV 453


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 78/444 (17%), Positives = 156/444 (35%), Gaps = 57/444 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           ++A+++ V F+ I   IDL    Y  N +  A++ A LS    +++    K         
Sbjct: 25  ISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTAALSASVQLLNSVEDKSKEKALSSV 84

Query: 61  --STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN- 117
                 K+ +  +LK   Y      D  +  Q       N    +I    + Y +P    
Sbjct: 85  LGENNIKQYLLNNLKISLYNNFGEMDSQRIIQHTKVNIYNRKGTHIINVYSHYNLPLNPF 144

Query: 118 -LFLKGLIPSALTNLSLRSTGIIE---RSSENLAISICMVLDVSRSMED-----LYLQKH 168
            LF   LI      ++      +       +   +S+  ++D S SM        +  K 
Sbjct: 145 SLFFMNLINIKSWPITTVGEAEVTSKKNYHKEEGVSVQWLIDDSGSMGSIIDRACFGSKQ 204

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA-------------------------- 202
             +     +K  +                    +                          
Sbjct: 205 LKSQYNVGSKIGIVRNENADTSDSFYPIVGELVSCDRSLYYVLNDKKILEDDDLEEKNLD 264

Query: 203 --PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
                  RK  ++ ++    +  ++K    K  L     +  Y      +   P++  + 
Sbjct: 265 NHSQYYIRKRYLVRDALATFIKRVRKIDNLKDKLR---MSFMYFNE-RIDHYFPMTWGIK 320

Query: 261 EVKSRLNK----LNPYENTNTYPAMHHAYRELYNEK-ESSHNTIGSTRLKKFVIFITDGE 315
           E K  ++      +    T+ +P +  AY +L+++  +  H    S  +KKF++ +TDG 
Sbjct: 321 EFKQEVSSHYKRKHENTATDIHPILQEAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTDGA 380

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE----GQDLLRKCTDSSGQFFAVN 371
            +      +++  L+IC+  +  G+KI++++ S          D L +C     +FF   
Sbjct: 381 QNEGVHSVDSV--LKICDAAKEEGIKIFTISYSVDSSERKKANDFLSRCAS-PDKFFEAY 437

Query: 372 DSRELLESFDK-ITDKIQEQSVRI 394
           D+ +L   F + I D I E+ V+I
Sbjct: 438 DADKLNMIFKEHIGDAIFERLVKI 461


>gi|192291928|ref|YP_001992533.1| hypothetical protein Rpal_3558 [Rhodopseudomonas palustris TIE-1]
 gi|192285677|gb|ACF02058.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 455

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 62/430 (14%), Positives = 128/430 (29%), Gaps = 42/430 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  A+D +     R  +Q+ALD+A L     +       D  + K   
Sbjct: 28  IFALALVPLLGFIGVAVDYSRANNARTSLQNALDSAALMLSRDLGVGTITPDQVSSK--A 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA--------------- 105
            T F             +              I       +Q                  
Sbjct: 86  QTYFNSLYTNKETGAVTVTATYTAKDGSGSSTIAMSGQGAVQTQFMKILGFQTMAIGSST 145

Query: 106 -----ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
                 ++ +  +  +              +   +  +++    +   +  + + V    
Sbjct: 146 TTTWGGTRLRVAMALDVTGSMASAGKMS-AMKTAAKNLVDSLRASAQTADDVYISVVPFA 204

Query: 161 EDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
           + + +   N N N              S W  +T  S             +       + 
Sbjct: 205 QMVNVGSSNRNANWVRWDLWDESNGSCSSWWYSTKSSCEYAGRTWTATSHNQWAGCVTDR 264

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN---NLNEVKSRLNKLNPYENTNT 277
                       + + R   + Y+           +    N   +K++++ L+P   TN 
Sbjct: 265 DQPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSAYSLSNATTIKNKIDALSPNGGTNQ 324

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDGENSGASAYQNTLN--------T 328
              MH A+  L      +     S       +I ++DG N+    Y N  +         
Sbjct: 325 AIGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILLSDGLNTVDRWYGNGRDWSPQVDARQ 384

Query: 329 LQICEYMRN-----AGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDK 382
             +C+ +R        + IY++ V+   + +  +L+ C DS G FFA   S  +  +F +
Sbjct: 385 RILCDNIRASATNTNPVVIYTIQVNTDGDPESTVLKYCADS-GNFFATTTSSGIGTAFAQ 443

Query: 383 ITDKIQEQSV 392
           I   + +  V
Sbjct: 444 IGSSLSKLRV 453


>gi|209809179|ref|YP_002264717.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
 gi|208010741|emb|CAQ81132.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
          Length = 422

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/424 (13%), Positives = 130/424 (30%), Gaps = 50/424 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F   T A D A  +  + +++ A + A L+  A    ++      +     
Sbjct: 14  LFAMMIPALFGIFTLASDGARAIQTKARIEDAAEVATLAVSAHNDPNQDYGGGGSPSSAN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    I  ++     I E         +I   K     L        ++E+       
Sbjct: 74  QQIVTDYINAYISDVDSINEIKVYKRNCEEIPECK---AGLAVGEPRYFEHEVGVTTSQK 130

Query: 121 KGLIPSALTNLSLRSTGIIERS----SENLAISICMVLDVSRSMEDLYLQ---------K 167
                +        S      S     ++ A+ +    D S SM D +            
Sbjct: 131 SWFPGNDAIVGMGDSFSTSGHSLARKYQSEAVDVMFAADFSGSMGDRWTGGNKKYEDLID 190

Query: 168 HNDNNNMTSNKYLLPPPPKKSF------WSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
             D+ +    K+                +++ T       +         +    +    
Sbjct: 191 IIDSISKELQKFNDLEHNDNDNTMGITAYNEYTYSQYSGSSGGWWGDDCYLSQAESDGFW 250

Query: 222 N--SIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYP 279
              SI K I    N   +            N   PL++N + V   +++  P   T++Y 
Sbjct: 251 GGVSISKTIDGLWNEKSKDHCNNSYNSGRFNDI-PLTSNFDVVNQDVSRFWPEGGTSSYQ 309

Query: 280 AMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC------- 332
           A+    + L             T  ++ +I ++DG ++  +   + +N   +C       
Sbjct: 310 ALIRGAQLLTYG----------TNSRRLLIVLSDGMDTDNNLTSSLVNA-GMCRDIQQGL 358

Query: 333 ---EYMRNAGMK--IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDK 386
              + + N  ++  +  +     P     L+ C  +    +   +S + L    + I+++
Sbjct: 359 ESDKTLDNRPIRAQMAVIGFDYEPSENQALKDCVGAE-NVYKAENSDDILNTILELISEE 417

Query: 387 IQEQ 390
           I   
Sbjct: 418 IGHL 421


>gi|91977525|ref|YP_570184.1| hypothetical protein RPD_3057 [Rhodopseudomonas palustris BisB5]
 gi|91683981|gb|ABE40283.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 464

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/438 (11%), Positives = 124/438 (28%), Gaps = 49/438 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     FI  AID +     R  MQ+ALD+  L     + +D+     +   ++ 
Sbjct: 28  IFALTLLPILGFIGAAIDYSRASRARTAMQAALDSTALMVSKDLGADKIKT--SEVSEKA 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY----------------- 103
            T F         +G  +  N           +  + +  +                   
Sbjct: 86  QTYFNSLYTGTEARGVTLTTNYTAKDDSGSSTVVVNGDGAVSTHFMKMFGFPSLAIGSAA 145

Query: 104 ---IAESKAQYEIPTENLFLKGLIPSALT-NLSLRSTGIIERSSENLAISICMVLDVSRS 159
                 ++ +  +  +      L  S     +   ++ +++    +      + + V   
Sbjct: 146 TATWGGTRLRVAMALDVTGSMVLNGSTKLAEMKKAASALVDTLRASAQSKDDLYISVVPF 205

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
            + + +   N + +              S     T                        +
Sbjct: 206 AQMVNVGSSNIDASWIKWDVWDETEGSCSKSKFKTKTDCEDNGRTWTVTDRSKWKGCVTD 265

Query: 220 LVNSIQKAIQEKKNLSVRIGT--IAYNIGIVGNQCTPLSN-----NLNEVKSRLNKLNPY 272
                        +   R               Q  P+++     +  ++K  ++ L   
Sbjct: 266 RDQPADTTKDAPTSDDTRFPALRTLLGTTSCPAQIFPMTSAYAATDAQKIKDVIDDLVAD 325

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIG-STRLKKFVIFITDGENSGASAYQN------- 324
             TN    M  A+  L      +      + +    +I ++DG N+              
Sbjct: 326 GGTNQPIGMAWAWMSLQQGNPLNTPAKDPNYKYTDAIILLSDGLNTMDRWPDYGDGQRQF 385

Query: 325 ----TLNTLQICEYMR---NAGMK--IYSVAVSA-PPEGQDLLRKCTDSSGQFFAVNDSR 374
                     +C+ ++   + G +  +Y++ V+        +L+ C    G FFA   + 
Sbjct: 386 DGKIDARQKLLCDNIKLPDSNGKRPVVYTIQVNTTGDPESTILKYCA-DGGNFFATTTAS 444

Query: 375 ELLESFDKITDKIQEQSV 392
            +  +F +I   + +  +
Sbjct: 445 GIGTAFAQIGSSLSKLRI 462


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score =  145 bits (366), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 64/407 (15%), Positives = 125/407 (30%), Gaps = 43/407 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ + V F F+  AID + + Y R ++Q A D+AVL   A   +    +     K   
Sbjct: 32  IFALSVFVIFGFVGAAIDFSRVDYARRRLQDAADSAVLRAMALKSATDESRGVAADKAFA 91

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                         G Y    A        I           Y   +           + 
Sbjct: 92  ENFG--------HPGVYDLNGALKREVNENII-------SQTYTVHATVSS-------YF 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK-Y 179
                     +++ S              I  VLD + SM +     +  ++  ++    
Sbjct: 130 GAFFGKDSYPVTVVSQAKTSL----DVFEIAFVLDTTGSMAEANKMPNLKSSVDSAMAGL 185

Query: 180 LLPPPPKKSFWSKNTTKSKYAP---APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
           L                +       A         +       + +       +    + 
Sbjct: 186 LQNGKNLSGSKIAVVPFNTQVRLSDATVTTMSSQGLSSGWGNCVHDRDLATSHDVSASAA 245

Query: 237 RI------GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN 290
           +         +             LS+N++  ++ +  L P   TN    +      L  
Sbjct: 246 QKGKAQTLYPLETCDEASLKPVQGLSDNISSARNFIKTLQPGGYTNVTMGVQWGMEVLSP 305

Query: 291 EKESS-HNTIGSTRLKKFVIFITDGENSGASAYQN----TLNTLQICEYMRNAGMKIYSV 345
            +  S     GST+ +KF+I +TDG+N+ +    +       T   CE  +  G+ +Y+V
Sbjct: 306 NQPFSDATEFGSTKARKFMIVVTDGDNTKSFTSWSASVIDKRTALACENAKAKGITVYTV 365

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +        +LRKC  +   F+ +  + +L  +   I   I +  +
Sbjct: 366 KIIQGNSN--MLRKCASAPEYFYDLTSANQLNAAMSGIFKSINKTRL 410


>gi|317154611|ref|YP_004122659.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
 gi|316944862|gb|ADU63913.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
          Length = 395

 Score =  145 bits (366), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/426 (11%), Positives = 121/426 (28%), Gaps = 73/426 (17%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           +       A+D+ ++     ++Q+A+DA  L+G   +  D  +      K          
Sbjct: 1   MLLAVAGLAVDMGNMYVTHTRLQAAVDAGALAGSLELPYDPDL-----SKGIVQQAVSDM 55

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
           I  ++                    +               A+ ++   NL + G +  A
Sbjct: 56  IHTNMPDAV----------------VESVSPGTEVRSVVVTAKAKV---NLLVMGFLNLA 96

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
              +   +     +      + I  V+D S SM+   +    + +   ++  +       
Sbjct: 97  DQWVEAGAAAGFNK------LEIVFVIDNSGSMKGTPINLVKEASIGLTDLLIPDGQQPD 150

Query: 188 SFWSKNTTKSKY--APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
           +       + K                   S    ++    ++    +   R      + 
Sbjct: 151 TKVGLVAFRGKVRLGGDVDGLEAGCRNADGSVNTGIHEDFMSMYWALSSYYRNQI-DLDT 209

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESSHNTIGST 302
                +  PLS +  ++   +N          T     +  A   L  E           
Sbjct: 210 CSSIPESRPLSQDKGDIVEGINSQTALGSASGTVISEGIKWARHMLTPEAP-YTQAGDKK 268

Query: 303 RLKKFVIFITDGE----------------NSGASAYQN---------------TLNTLQI 331
             +K +I +TDG+                N+  +                     + L  
Sbjct: 269 DFRKIMIVLTDGDTEDGECGGSYRASFRPNNYWTNAYYGMGVDTAHCQDGGVLNQDMLAE 328

Query: 332 CEYMRNAGMKIYSVAVSAPPE-GQDLLRKCTD----SSGQFFAVNDSRELLESFDKITDK 386
            +  ++ G++I+++           L+++       ++  +F      ++ + F KI  +
Sbjct: 329 AQLAKDEGIEIFAIRFGVSDNTDISLMKQIASSKAGTNDHYFDAPSVYDIPDVFKKIGKQ 388

Query: 387 IQEQSV 392
           +  + +
Sbjct: 389 LGWRLL 394


>gi|323495646|ref|ZP_08100717.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
 gi|323319281|gb|EGA72221.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
          Length = 419

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/420 (14%), Positives = 128/420 (30%), Gaps = 45/420 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+II   F   T A D A  +  + +++ A + AVL+  A    ++  +   +     
Sbjct: 14  LFAMIIPGLFGLFTLASDGARAIQTKARIEDASEIAVLAIAAHNDDNKNSQGSGSGSAVN 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    ++ +L     +           QI         L        QYE+   +  +
Sbjct: 74  RKIATDYLEAYLHDVDSVNNLKIHKYNCDQIPECV---AGLARGEPRFFQYEVEATSRHV 130

Query: 121 KGLIPSALTNLSLRST----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                 +      ++         R  ++ A+ I  V D S SM   +    N       
Sbjct: 131 SWFPGDSSIPGFGKTFDAKGAATARKYQSEAVDILFVADYSGSMAGGWNGGSNRKYIDLR 190

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSI----------Q 225
           N   +     + F   N T +            K      S    +  +           
Sbjct: 191 NIIKVVTDELQKFNDLNNTDNNTVGMTGFNYYTKTKPTNRSNSCFMTQLVYNNNYNINYT 250

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
           K +    N       ++ +      +   L++N +   + +N   P   T +Y  +    
Sbjct: 251 KTVNNIFNEKNNKYCVS-HSDSSRFRDIDLTDNYSSFNTTVNGFYPNHGTASYQGIMRGA 309

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGEN--SGASAYQNTLNTLQICEYMRNA---GM 340
           + L             T  ++ +I ++DG++  +        L    +C  ++     G+
Sbjct: 310 QML----------KKGTNPRRLLIVLSDGDDSGTSQKNIHKQLVNAGMCTKIKQELSTGI 359

Query: 341 ---------KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDKIQEQ 390
                    ++  V           LR C  +    F   ++ + L +  + IT++I   
Sbjct: 360 SSSGQSIKARLAVVGFDYNVNNNTALRDCAGAE-NVFKAQNTDDILNKILELITEEIGHL 418


>gi|163731887|ref|ZP_02139334.1| hypothetical protein RLO149_21324 [Roseobacter litoralis Och 149]
 gi|161395341|gb|EDQ19663.1| hypothetical protein RLO149_21324 [Roseobacter litoralis Och 149]
          Length = 468

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/483 (12%), Positives = 133/483 (27%), Gaps = 118/483 (24%)

Query: 1   MTA-IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           + A I++ +  L    A+DL     +R ++Q+ LD A+L+          +  P    + 
Sbjct: 13  IFATIMVLMMLLVCGIAVDLMQNEMMRTRVQNTLDRAILAAS-------DLDQPLPADEV 65

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
               F K                       +I    D       I +++A+         
Sbjct: 66  VDDYFAKAGMTEFLNDV-------------RITPGSDLPTTNFRIVQAEAR---TRTPSI 109

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
              +       + +  T           I I +VLD+S SM +     +           
Sbjct: 110 YMAMTGVRTLPVYVSGTAEETIE----KIEISLVLDISGSMRNNGKIGNLRTAAKDFIGA 165

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKI----------------------------- 210
           +L     K+        +           +                              
Sbjct: 166 VLEGNAAKTTSLNIVPYAGQTNPGRIVFERAGGLPFATFIEDSNGDEILYGQTIVDDEGN 225

Query: 211 ------DVLIESAGNLVNSIQKAI-------QEKKNLSVRIGTIAYNIGIVGNQCTPL-- 255
                 + +        +             Q    ++  I     + G      + +  
Sbjct: 226 SIDVPYNTMSSCLDLTNSDFDNIDLPSGGYDQTPYFMNWPIDAPTMDWGWCPQNNSSIRY 285

Query: 256 -SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES-----------------SHN 297
             N+   ++  ++ +  ++ T T   M +    L     +                    
Sbjct: 286 AQNDAGRLQDFIDDMRLHDGTGTQYGMKYGVALLNPSSRNTFLALNAAGLVPDGFKNRPA 345

Query: 298 TIGSTRLKKFVIFITDGE---------------------------NSGASAYQNTLNTLQ 330
             G+T  +KF++ +TDG+                           ++ ++   N  N   
Sbjct: 346 DFGTTDTRKFIVLMTDGQITDQFRPEDKNDPKNDEIALNQRTGDRDTYSTQSTNVTNFYS 405

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           +C   +  G+ +Y++A  AP +    +R C  S   F+ V    ++  +F  I  +I E 
Sbjct: 406 VCNKAKAEGITVYTIAFEAPADAVTQMRTCATSPAFFYKVEGV-QIKTAFKSIARQINEL 464

Query: 391 SVR 393
            + 
Sbjct: 465 RLT 467


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score =  145 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/411 (17%), Positives = 140/411 (34%), Gaps = 53/411 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTAI++ V       AID +++   + ++Q A         A   +        +     
Sbjct: 24  MTAIMMPVLLGAAGLAIDYSNMALSKRELQEAT-----DSAALAAATALASGAASTTADA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I K  +   +         +   A  +             Y       Y I       
Sbjct: 79  EAIAKDFVSGQMANYVDTDAISSIKAGTSVDIDVSATATSKSYKVTVATSYGIAATP--F 136

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++     N+   ++     S    A+S+ +VLD S SM +                  
Sbjct: 137 MSVLGYKTLNIGASTSTSSGTSDTKTALSMELVLDQSGSMGEKTTTCA------------ 184

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                           +           KID L ++A  L +++  A  +     VR G 
Sbjct: 185 ----------------TYNGKNCKTYVTKIDALKKAADALFDALDTADPDHS--LVRTGA 226

Query: 241 IAYNIGIVGN-------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
            +YN G++ N         + ++       + ++ +     T+    M  A   +    +
Sbjct: 227 YSYNNGLIYNSQKTQIKSMSGMAWGTATTATYVSGITASGGTDATEPMRQATLSIAKASD 286

Query: 294 S------SHNTIGSTRLKKFVIFITDGENSGASAYQNTL---NTLQICEYMRNAGMKIYS 344
                  +H   G+T + +++I +TDGE +G +    +    N    C+  + AG+KI++
Sbjct: 287 GSDVETQAHAVKGNTIVSRYIILMTDGEMTGNTGVWQSSFDQNVRNQCDATKTAGIKIFT 346

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           VA  AP +G+ LL+ C    G ++      +L+ SF  I  +  +    + 
Sbjct: 347 VAFMAPDKGKQLLQYCASPGGNYYEAETMEKLVASFTSIAKEATKAVTLLT 397


>gi|149909171|ref|ZP_01897828.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
 gi|149807695|gb|EDM67641.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
          Length = 402

 Score =  145 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/408 (12%), Positives = 126/408 (30%), Gaps = 39/408 (9%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              ++      +   +  A    +  +   A D+AVL+          + +         
Sbjct: 15  FTFMLPAIVSLLAITVFFAMYSQVVIRAGQAADSAVLACAYQQNDTGVVTEG-------- 66

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                  + +       +    +     QI+        +          +    +    
Sbjct: 67  --ILDYYRPNFVLPELNKSVKLNSNNGCQISAQYRFEPAMVNALPVAIDSDTEVVSNS-- 122

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                     S +    +  +     +   +VLD+S SM     +       +T     +
Sbjct: 123 --------QSSAKLVQNVNVNGIQNPVDFSLVLDISGSMTWHLPELKK---IITDVISDI 171

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK--------- 232
            P   +  +S    ++    + AP     +   +    LV        +K          
Sbjct: 172 VPSSNQVRFSIVPFQTGVGVSGAPWLLSSEASPKCVDGLVYRNGNLDADKTVQSLNYSSD 231

Query: 233 --NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELY 289
             + +        +     +   PL+NNLN V   +  L+     T +Y       R L 
Sbjct: 232 RLDFNEVTPGRWLDRCSETSFILPLTNNLNRVIRYVESLDTSGGSTASYQGFIWGVRTLT 291

Query: 290 NEKESSHNTIG--STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA-GMKIYSVA 346
           ++ +         S+ L + +I  TDG+++    + + ++   +C+ ++    +++  + 
Sbjct: 292 DQWQKEWQVTPVQSSSLTQRLILFTDGDDNRRDYFNDLMSA-GLCDVIQQDLNIQVSFIG 350

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
                +     ++C   +G  F  N++ EL + F+   +   E  VRI
Sbjct: 351 FGVSADRIKQFKQCAGRNGSVFDANNTAELADYFEDAININIETKVRI 398


>gi|300023811|ref|YP_003756422.1| von Willebrand factor A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525632|gb|ADJ24101.1| von Willebrand factor type A [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 466

 Score =  144 bits (362), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/437 (15%), Positives = 136/437 (31%), Gaps = 60/437 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  ++  V F  I  A+D    +  R+Q  +A DAAVL+G  ++ ++    D        
Sbjct: 43  LFGLMALVLFAMIGLAVDYGRFVNARSQTIAATDAAVLAGARALQTNG--GDQAAALRVA 100

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            + + +  K  L   +                     +N    +    A    P   L  
Sbjct: 101 QSYYAQATKNRLSLSNDTINF-------------AIADNATAMVTTGNAVITTPFMGLAG 147

Query: 121 KGLIPSALTNLSLRSTGIIER-SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
            G +P    + S  S  ++    +  L + I M+LD++ SM    L       +   N  
Sbjct: 148 TGSLPILRKDGSDYSKAVLAVGGNAELNLEIAMMLDITGSMRGQKLTDMKAAASDLLNIV 207

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE----SAGNLVNSIQKAIQEKKNLS 235
           +     K +        +     PA A +K                 + +          
Sbjct: 208 VWTDQSKFTSKVAIVPFAYDVRLPAAAFKKATGTTSTNYPCVVERTGTEKYTDAAPATGK 267

Query: 236 VRIGTIA------------YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
             +                        +  PL+++ + + +++N L+   +T  +     
Sbjct: 268 YVMVHNTSSTKKNKTTYSPTCDVASSAEVLPLTSDKSTLLAKVNGLSTAGSTAGHIGTAW 327

Query: 284 AYRELYNEK-------ESSHNTIGSTRLKKFVIFITDGE--------------------N 316
           A+  L            S+     +  L+K  + +TDGE                     
Sbjct: 328 AWYMLAPNWSSLWTSASSTPAAYNADNLRKIAVLMTDGEYNTQYTTNGVPDDSSSLTRCP 387

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP-EGQDLLRKCTDSSGQFFAVNDSRE 375
           + A+   ++   +  C  M+  G+++Y+V          D L +C   S  F+       
Sbjct: 388 NAANGVCSSAQAVSQCTAMKAKGIEVYTVGFQLDNQTAIDTLSQCATDSSHFYNSTTGDA 447

Query: 376 LLESFDKITDKIQEQSV 392
           L  +F  I  KI    +
Sbjct: 448 LKAAFRDIALKISTLYL 464


>gi|92117939|ref|YP_577668.1| hypothetical protein Nham_2418 [Nitrobacter hamburgensis X14]
 gi|91800833|gb|ABE63208.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 483

 Score =  143 bits (360), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 55/456 (12%), Positives = 124/456 (27%), Gaps = 66/456 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     F+  A+D       R+ MQ+A+D+A L       +              
Sbjct: 28  IFAIALLPMLGFVGAAVDYTRANAARSSMQAAMDSAALMVAKDANAASPQMTADQVTAAA 87

Query: 61  STIFKKQIKKH-----------------------LKQGSYIRENAGDIAQKAQINITKDK 97
              F                              L     ++ +   +    QI+   + 
Sbjct: 88  QKYFNALYHNTDAQGASVSAVYTPYNNGTPATVVLSGSGNVQTDFMKVVGFPQISFKTNS 147

Query: 98  NNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAIS----ICMV 153
                      A     T ++   G +             +   ++    +        V
Sbjct: 148 TATWGNTKLRVAMALDVTGSMSSAGKLVQMKIAAKKLIDTLKASATAEGDVYISIIPFNV 207

Query: 154 LDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
           +    +  +       ++ +  ++               NT  S  A       + I   
Sbjct: 208 MVNVGANNNTASWLEWEDGSYDNSSSNYGSCSGSGKSKPNTKSSCIAAGKTWTPKNISSW 267

Query: 214 IESAGNL-------VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN--------- 257
                +                 E    +     +A N     +   P+++         
Sbjct: 268 KGCVTDRGPVSKPGSGDYDTTKDEPVASTPYTLYLARNYSTCPSSILPMTSAYDSKESDS 327

Query: 258 --NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFITDG 314
             + + +K ++N L     TN   AM  A+  L                    +I ++DG
Sbjct: 328 STDDSTLKGKINNLVANGATNQAIAMQMAWMMLQPTAPFPAPAKDEKYKYTDAIILLSDG 387

Query: 315 ENSGASAYQNTLNTLQ--------ICEYMRNAGM---------KIYSVAVSAPPEGQ-DL 356
            N+    Y N  +           +C  ++N  +         +IY++ V+   + +  +
Sbjct: 388 LNTQDRWYGNGSDWSSQVDTRQALLCNNIKNDPISKTDPTRRTRIYTIQVNTDGDPESTV 447

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           L+ C      FF  + +  +  +F +I   + +  +
Sbjct: 448 LKNCATDG--FFPTSTASGIASAFAQIGASLSQLRI 481


>gi|260775644|ref|ZP_05884540.1| protein TadG associated with Flp pilus assembly [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608060|gb|EEX34229.1| protein TadG associated with Flp pilus assembly [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 407

 Score =  143 bits (359), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 56/418 (13%), Positives = 127/418 (30%), Gaps = 43/418 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I + F       D A  +  + +++ A         A+ ++     D     D+ 
Sbjct: 12  LFAMLIPLLFGVFALGSDGARAIQSKARIEDA-------SEAAALALSARDDEHAMSDEN 64

Query: 61  STIFKKQIKKHLKQGSYIRENAGD--IAQKAQINITKDKNNPLQYIAESKAQYEIPTENL 118
            TI +  I+++L          G   +         +          +   +        
Sbjct: 65  KTIVQAYIEEYLPVEDSDVTILGIERLECDDMPECRQGSGRGEARYTQYSVRVSADQTPW 124

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
           F  G     +  +     G   R  ++ A+ I    D S SM   +            + 
Sbjct: 125 FGGGSPEVEVPEVWRSQGGAKARKYQSNAVDIVFAADFSGSMASPWTGGSQPKYRDLIDI 184

Query: 179 ------YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                  L P       ++ +   S +            V       L+  +  +    +
Sbjct: 185 LEKVTVELAPYNFDSQRYNSSVGVSGFNALTYRNEL-CAVNNLEKQGLLGVVDYSRTVAR 243

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
               +           G    PL+++ +     +++      T +Y A+    R L +  
Sbjct: 244 MWETKSCRPPSISNSAGFHDVPLTDDYSTFNRTVDRFTARGGTASYQAVMSGARLLDHGS 303

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM------------RNAGM 340
            +           + +I I+DG+++  + + N L    +C  +            R+   
Sbjct: 304 NNR----------QILIVISDGQDNNLN-HTNGLVNAGMCRDIISRLEGRPSANGRDVSA 352

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           ++  +     P     + +C       F   ++ EL   F++I   I+E+   +A  R
Sbjct: 353 RLAFIGFDFEPSMNPAMVRCV-GEDNVFKAENTDEL---FEQIMFLIREEVGHLATRR 406


>gi|83859216|ref|ZP_00952737.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852663|gb|EAP90516.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 441

 Score =  143 bits (359), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 55/430 (12%), Positives = 124/430 (28%), Gaps = 66/430 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+++    + +  A+D +    I  ++QSA+DA  L+  +            ++ +  
Sbjct: 38  MFAMLLGPLVVSVGGALDYSRTFTIGAEIQSAMDAGTLAAASL-----------SQGEDP 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            TI +  I   L + + + E                  N  +  A++            +
Sbjct: 87  ETIVRNYITAALSEHNGVLERLNVQVSSD------LAINSREVTADAVISV-----PTLM 135

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            G+I      L+  S            + I +VLD+S SM    +     +        +
Sbjct: 136 LGIIGYDALTLNRVSEANERVR----NLEISLVLDISGSMSGSKITA-LRDAAEEFVGVM 190

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           + P  +          +     P      +     +    +             +     
Sbjct: 191 MDPDLEGLTSLSVIPYNGGVRLPQTVTNDLVPGTPNDSGCLELGVSDPVTMDLAANGYDW 250

Query: 241 IAYNIGIV------------GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
           + +                       L    + + + +  L+   NT    A     R L
Sbjct: 251 LDWQDRDQRGWRSSAFCPEENEATVFLEQTPSVLVNLIRDLDAGGNTGLDVATAWGARAL 310

Query: 289 YNEKES--------SHNTIGSTRLKKFVIFITDGENS-----GASAYQNTLNTLQI-CEY 334
                                    K ++ +TDG  +       + Y +  +        
Sbjct: 311 DPAWRGRLGGDFASRPAAYDDPSTMKVLVVMTDGAATAQIRRAQNWYGDWYSYEIYSASQ 370

Query: 335 MRNA-----------GMKIYSVAVS-APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
            R+            G+ IY++A   +    ++L+R C      ++AV +  ++  +F+ 
Sbjct: 371 ARDNMADACDAAEAEGVHIYTIAFQVSGSTNRNLMRDCASRPENYYAVENL-DISAAFNS 429

Query: 383 ITDKIQEQSV 392
           I   +    +
Sbjct: 430 IAADLNNLRL 439


>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score =  142 bits (358), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 72/400 (18%), Positives = 159/400 (39%), Gaps = 59/400 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81

Query: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
              +    +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 82  ILCRIKNTWNMSFRNELRDNGFVNDI-DDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139

Query: 116 EN-LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           +   F+     S    + + S  +   S  +  + + +VLDVSRSME  +          
Sbjct: 140 KFCTFIPWYTNSRHIVMPITS-SVKVNSQTDARLDMMIVLDVSRSMESFFDSS------- 191

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                             KID+ I+S   ++  ++       N 
Sbjct: 192 --------------------------------ITKIDMAIKSINAMLEEVKLIPDV--NN 217

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYN-EK 292
            V+ G + ++  I       L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ + 
Sbjct: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
              H        KK ++F+TDGEN      Q +L     C   +  G  +Y++ +     
Sbjct: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY---YCNEAKKRGAIVYAIGIRV-IR 331

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             + LR C      F+ V +   + ++F  I   I  + +
Sbjct: 332 SHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370


>gi|261251589|ref|ZP_05944163.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
 gi|260938462|gb|EEX94450.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
          Length = 396

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/398 (12%), Positives = 122/398 (30%), Gaps = 51/398 (12%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++    +     I + + + + N+   A DAA L+                  +   T+ 
Sbjct: 21  MLIPMIIAAASTIVIGYQVQLSNRGMQATDAASLAC-------------EFSGEYDGTMA 67

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           +  +  +  +   +    G  +                        Y + T    L    
Sbjct: 68  QGYLDYYRPKIDKVSGQIGTHSGCN-----------------VSLSYSLSTIFTSLTLSD 110

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY--------------LQKHND 170
            S + + +      +     +  + + +VLD+S SM                   ++ N+
Sbjct: 111 ASFVVSSTANEKAYVTEDVASEPLELILVLDISGSMASDLDDLKAILKRGLASLKEQQNN 170

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
             +    K  + P       +     ++          +      +A  + N      Q 
Sbjct: 171 ALSKDHIKVSIVPFSDGVSVNNAPWLNETGTFCVEGITESGGKFSAAHTVANLDITHDQT 230

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN 290
                     +        +   PL+ +LN+V + ++ L     T +Y  +    R+L  
Sbjct: 231 PVKTFQPDKWLM--DCSAMSVTLPLTADLNQVTNAVDSLRTEGGTASYQGLIWGLRQLTP 288

Query: 291 EKESSHNTIGSTRLKKF---VIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
             + +     +    K    ++ +TDG      ++ + L    +C+  ++ G+ +  V  
Sbjct: 289 NWQKAWEVGPNRNFDKVERKLVLMTDGA--DYGSHFDELINAGLCDRAKDYGVALNFVGF 346

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
                  +   +C   +   F+ ++++EL   F ++  
Sbjct: 347 GVYGARLEQFTRCAGDANGVFSASNTQELDSYFSQLLS 384


>gi|316933619|ref|YP_004108601.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
 gi|315601333|gb|ADU43868.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
          Length = 483

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 62/455 (13%), Positives = 130/455 (28%), Gaps = 64/455 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVS-------------- 46
           +  I +     F+  A+D +     R  MQSALD+  L     + S              
Sbjct: 28  IFGIALLPLLGFVGAAVDYSRASRARTAMQSALDSTALMVAKDLTSGKITAENVQSAANT 87

Query: 47  -------DRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
                  +            T     +  K  +     I      +   +Q+++      
Sbjct: 88  YFTSLYKNTDAPSIDVTATYTPKTSSENAKLTVGGTGSINTEFMKVMNISQMSLGASSTT 147

Query: 100 PLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSEN----LAISICMVLD 155
                    A     T ++   G + +  T        +   S+      ++I    V+ 
Sbjct: 148 TWGGTRLRVALALDVTGSMDSAGKLSAMKTAAKQLIDTLKATSTTKEDVYISIVPFNVMV 207

Query: 156 VSRSMEDLYLQKHNDNN------NMTSNKYLLPPPPKKSFWSKNTTKSK------YAPAP 203
                         D +        T+           ++WS      K       A   
Sbjct: 208 NVGPGNKNATWLDWDTSYGSCKSKYTTKNACQAGGDSWNYWSNTCQSQKTLKSACQAGGH 267

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL-------- 255
                 ++       +   +      E  + +     +A N         P+        
Sbjct: 268 TWTASNVNSWKGCVTDRTQNYDTTKTEPTSATPDTLFLAQNYSDCMASLLPMKSAYEATE 327

Query: 256 ---SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVIFI 311
              S +   +K R+N L+    TN    M  A+  L            S       ++ +
Sbjct: 328 SDSSTDATTLKGRINTLDAQGGTNQGIGMFWAWMTLQATAPLYTPAKDSEYKYTDAIVLL 387

Query: 312 TDGENSGASAYQNTLN--------TLQICEYM--RNAGM---KIYSVAVSAPPEGQ-DLL 357
           +DG N+    Y N  N           +C+ +  +  G+    IY++ V+   + +  +L
Sbjct: 388 SDGMNTKNRWYGNGSNWSPQVDDRQKILCDNITTKVNGVPETTIYTIQVNTSGDPESSVL 447

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           + C  + G FF+   +  +  +F ++   + +  +
Sbjct: 448 KYCGSTGG-FFSTTTASGIQSAFQEVGASLTKLRI 481


>gi|59713412|ref|YP_206187.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59481660|gb|AAW87299.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 423

 Score =  140 bits (352), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 52/426 (12%), Positives = 120/426 (28%), Gaps = 50/426 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F     A D A  +  + +++ A + A L+  A    D+      T   + 
Sbjct: 15  LFAMMIPALFGIFALASDGARAIQTKARIEDASEVAALAISAHNDPDQPDNGSYTPSTRN 74

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  ++     + +      +   I+                 ++EI       
Sbjct: 75  RQIVVDYVNAYISDIDAVTDIKVAKRRCELISGCVAGLYKGD---ARYLEHEIDVTTRQN 131

Query: 121 KGLIPSALTNLSLRSTGIIERS----SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                +        +     +S     ++ A+ +    D S SM D +    N       
Sbjct: 132 SWFPGNEAIEGMGETFSTRGKSLARKYQSEAVDVMFAADFSGSMLDTWSGSSNPKYIDLI 191

Query: 177 NKYLLPPPPKKSFWSK--NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                     + F     N  KS    +                  ++    +  +  N 
Sbjct: 192 EIIRNISVELQKFNDLPENRDKSTMGISAFSTFTNSFTSDTGIQCSLSQGVNSKNKPGNW 251

Query: 235 S--------------VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
                           +      +    G     L++N N +  ++        T +Y A
Sbjct: 252 FRPVKPANTVANIWNEKTEDYCKSGAYAGFHDVNLTSNFNSLNGQVGSFYAGGGTASYQA 311

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--- 337
           +    + L                ++ +I ++DG ++  +   N L +  +C  ++    
Sbjct: 312 LIRGAQLLD----------RGRNSRRLLIVLSDGMDNDRNLA-NGLVSNGMCREIQAGLE 360

Query: 338 -------AGM--KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
                    +  K+  +     P     L+ C       +   D+ E+ +    I + I 
Sbjct: 361 SDRTPDGRPIAAKMAVIGFDYDPFANKALKDCV-GEKNVYKAEDADEVEDI---ILELIN 416

Query: 389 EQSVRI 394
           E+   +
Sbjct: 417 EEVGHL 422


>gi|90406741|ref|ZP_01214934.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
 gi|90312194|gb|EAS40286.1| hypothetical protein PCNPT3_01875 [Psychromonas sp. CNPT3]
          Length = 404

 Score =  140 bits (351), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/398 (15%), Positives = 133/398 (33%), Gaps = 42/398 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              ++      +  +I  A  +    +   A D + ++   S  ++ ++           
Sbjct: 16  FIFLLPAMLAMLALSILTAMYLLSVTRASQASDVSSIACAYSQRANVSLTQG-------- 67

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F +  K +       +       ++ +I I       L+ +  + +Q ++        
Sbjct: 68  --FAQYYKPNFISHVNAQSTFLSGQKQCKIQIGYAFTPLLKDLLPASSQNKVHA------ 119

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                   ++ ++ST  +   SE   + + +VLD+S SM           N    N    
Sbjct: 120 --------SVQIQSTSTLTVHSEIKPMDLSLVLDISGSMSGRIGLLKRIINQAIQNIEQQ 171

Query: 182 PP-PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ-----------KAIQ 229
                 +  +S     S  + + AP   K          +                    
Sbjct: 172 NTKNNTQIRFSIVPFSSGVSISNAPWLAKSKGKALCVDAMSYPGNVLNTAQTVADIDTHP 231

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
            K N+  +      N   V +   PL+NNL++V+  ++ L+   +T +Y       R L 
Sbjct: 232 SKLNIRAKEPLSLINDCNVYSLLLPLTNNLSKVRKHVDSLSILGSTASYQGFIWGVRTLL 291

Query: 290 NEKESSHNTIGSTRL--KKFVIFITDGENSGASAYQNTLNTLQICEYMRNA-GMKIYSVA 346
              + + N    T     + +I  TDGE   +    + L    +C+ +++   + I  + 
Sbjct: 292 PNWQKAWNLQPETSSLLSQRLILFTDGE-DDSRDQFDKLVRSGMCQRIQDDFNIDISFIG 350

Query: 347 VSAPPEGQDLLRKCTDSSGQ--FFAVNDSRELLESFDK 382
               P   D  +KC  S+G+   +   +  +L + F +
Sbjct: 351 FGLSPRRLDQFKKCIGSNGKGVVYDAKNGSDLEKFFAE 388


>gi|90418244|ref|ZP_01226156.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337916|gb|EAS51567.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 489

 Score =  137 bits (344), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 52/491 (10%), Positives = 120/491 (24%), Gaps = 134/491 (27%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++    +    AIDL     +R+ +Q  LD  VL+  +       +      ++  
Sbjct: 26  MTALMLVPMIVISGGAIDLIAHERLRSVLQDGLDRGVLAAAS-------LTQTRPPRETI 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            +  K  +                  + +     K          E+ A       +   
Sbjct: 79  ESFLKAAVT-----------------KGSYALDVKADELSNAKRVEASATA---VTDTAF 118

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH-----------N 169
             LI      +   +        +   I I ++LD+S SM       +            
Sbjct: 119 LRLIGIDKLTVEAHAEA----EEKRKNIEISLLLDMSGSMRFDKSGSYPGPSGAMRINYL 174

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR------KIDVLIESAGNLVNS 223
                +    +L    +          +                 +            N 
Sbjct: 175 RPAAKSFMDMVLADGAEDYTTVSIVPYAGQVSIGPVLFDALARNRRQHDRSSCFQFGRND 234

Query: 224 IQKAIQEKKN-----------------------LSVRIGTIAYNIGIVGNQCTP------ 254
               + +  N                       ++                         
Sbjct: 235 FTLGVPDFANLPQTQHFTQANHHDALKKAGEAQITEPWWCPDDPHDPRPGTTPDFVAGEG 294

Query: 255 ----------LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE----------- 293
                     LSN+   +K +++    Y+ T T  A+      L    +           
Sbjct: 295 KDTDRTSVSFLSNDREYLKRQIDNYKLYDGTGTPIALKWGLLLLDPAIQPMLREAARYRA 354

Query: 294 ------------SSHNTIGSTRLKKFVIFITDG----------------ENSGASAYQNT 325
                       +   +       KF++ +TDG                  +  S   + 
Sbjct: 355 LSEELDIDARFSNRPASFTDPDTMKFLVLMTDGAISSQRIPKDASKPVQYYNNGSLNTDL 414

Query: 326 LN-------TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            +          +C   +   + ++++           +  C   + +F+ V ++ ++ +
Sbjct: 415 YSVGDAERFAAALCTAAKQKNVIVFTIGFDVNDTAAKQMSNCASGAERFYRV-NALDIQD 473

Query: 379 SFDKITDKIQE 389
           +F  I   IQ+
Sbjct: 474 AFKSIATAIQK 484


>gi|78357411|ref|YP_388860.1| von Willebrand factor, type A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219816|gb|ABB39165.1| von Willebrand factor, type A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 402

 Score =  136 bits (341), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 49/434 (11%), Positives = 123/434 (28%), Gaps = 74/434 (17%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+++ V    +   +D   +    +++Q+A+DAA L+G   +  D  +           
Sbjct: 1   MAVLLPVILGIMGLGLDSGMLYLSHSRLQAAVDAAALAGSLQLPYDPAMDKG-----LVR 55

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               + +  +  Q        G                         A+    T      
Sbjct: 56  AAVDEYMHANFPQAVVQSVLPGAEE----------------RSVTVNAEA---TVGTIFM 96

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G +    + +  +++           + +  V+D S SM+   + + N       +  + 
Sbjct: 97  GALGIGSSTVRAQASAGYNN------LEVVFVIDNSGSMKGSPINETNAAATRLVDLIMP 150

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG-- 239
                         + K    PA  +        + G+L         +K          
Sbjct: 151 EGMATSVKIGLVPFRGK-VRIPADVDGLPSGCRNADGSLNEDGLLDEYKKPEYRYPYNDR 209

Query: 240 -TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE---NTNTYPAMHHAYRELYNEKESS 295
             +             L+ +   +   + + +       T     +  A   L  E   +
Sbjct: 210 LRVTPYSCSSIPLTQGLTADRATITQAIGRQDARGDSSGTVISEGLKWARHVLTPEAPFT 269

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQN------------------------------- 324
             +  +  ++K +I +TDG+    +   N                               
Sbjct: 270 EGS-SAKDMRKVIILLTDGDTEDGNCGGNYSVYYRPNNYWTNAYYGMMDMDSHCEDGGVL 328

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSA-PPEGQDLLRKCTD----SSGQFFAVNDSRELLES 379
               L      ++AG++I+++   +     ++L+R        +   +F      ++ + 
Sbjct: 329 NNAMLSEAALAKDAGIEIFAIRYGSSDAVDRNLMRAVASSKEGTDDHYFDAPSPYDIDDV 388

Query: 380 FDKITDKIQEQSVR 393
           F  I  ++  + +R
Sbjct: 389 FKLIGRQLGWRLLR 402


>gi|86147193|ref|ZP_01065509.1| TadG-like protein [Vibrio sp. MED222]
 gi|85835077|gb|EAQ53219.1| TadG-like protein [Vibrio sp. MED222]
          Length = 435

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/449 (11%), Positives = 123/449 (27%), Gaps = 83/449 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I   F       D A  +  + +++ A +AAVL+                K +Q 
Sbjct: 15  LFAIMIPALFGVFMLGSDGARALQTKARLEEASEAAVLAVS-------------AKDEQD 61

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++ I+ +L     I +         +I          +       +Y +  + L  
Sbjct: 62  HQLAERYIQHYLYDMDSILDIEVKKLGCDEIPEC---IAATERGEARYFEYRVAGQTLHK 118

Query: 121 KGLIPSALTNLSLRST----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                + + +    S         R  ++  I I  ++D S SM D +    +   N   
Sbjct: 119 SWFPGNDVISGFGDSFNVTGSSKARRYQSQPIDITFIVDFSESMNDSWSGGRHSKLNDLK 178

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA-----GNLVNSIQKAIQEK 231
           +          ++                  R I+             +V+   +  ++ 
Sbjct: 179 DIIEDVADELGAYNDLYPEHPHRVALTGFNRRTINKDKNDNLVVRDQRVVSREGEYDKDD 238

Query: 232 KNLSVRIGTIAY-----------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
                +     +           +           + + +    ++ K      T +   
Sbjct: 239 TVNFNKTIAQQFIVKGEASRVPNSDDDARFYDLYFTTDFSSFTKKVKKFKAGGGTASLQG 298

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAYQNTLNTLQICEYMRNA- 338
           +  A + + +          S   K+ +I ++DG + +  +   N L +  +C  + N  
Sbjct: 299 IIRAGQIVTS---------MSKNQKQLIIILSDGEDWNHYAGQTNKLVSKGMCSNILNMV 349

Query: 339 --------------------------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
                                             ++  +           LR C      
Sbjct: 350 NGGKVSADNTHDDIEVIGGVSQGMMTPDGERMNARMAVIGFDYELNKNVGLRNCV-GRDN 408

Query: 367 FFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +   +     +  +KI   I E+   +A
Sbjct: 409 VYKAENKE---DILNKILGLITEEVGHLA 434


>gi|218708116|ref|YP_002415737.1| hypothetical protein VS_0028 [Vibrio splendidus LGP32]
 gi|218321135|emb|CAV17085.1| Conserved hypothetical protein, putative exported, TadG [Vibrio
           splendidus LGP32]
          Length = 435

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/449 (11%), Positives = 122/449 (27%), Gaps = 83/449 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+I   F       D A  +  + +++ A +AAVL+                K +Q 
Sbjct: 15  LFAIMIPALFGVFMLGSDGARALQTKARLEEASEAAVLAVS-------------AKDEQD 61

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++ I+ +L     I +         ++          +       +Y +  + L  
Sbjct: 62  HQLAERYIQHYLYDMDSILDIEVKKLGCDEMPEC---IAATERGEARYFEYRVAGQTLHK 118

Query: 121 KGLIPSALTNLSLRST----GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                + + +    S         R  ++  I I  ++D S SM D +    +   N   
Sbjct: 119 SWFPGNDVISGFGDSFNVTGSSKARRYQSQPIDITFIVDFSESMNDSWSGGRHSKLNDLK 178

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA-----GNLVNSIQKAIQEK 231
           +          ++                  R I+             +V+   +  ++ 
Sbjct: 179 DIIEDVADELGAYNDLYPEHPHRVALTGFNRRTINKDKNDNLVVRDQRVVSREGEYDKDD 238

Query: 232 KNLSVRIGTIAYN-----------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
                +     +                       + + +    ++ K      T +   
Sbjct: 239 TVNFNKTIAQQFIVKGEASRVPNGDDDARFYDLYFTTDFSSFTKKVKKFKAGGGTASLQG 298

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAYQNTLNTLQICEYMRNA- 338
           +  A + + +          S   K+ +I ++DG + +  +   N L +  +C  + N  
Sbjct: 299 IIRAGQIVTS---------MSKNQKQLIIILSDGEDWNHYAGQTNKLVSKGMCSNILNMV 349

Query: 339 --------------------------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
                                             ++  +           LR C      
Sbjct: 350 NGGKVSADNTHDDVEVIGGVSQGMMTPDGERMNARMAVIGFDYELNKNVGLRNCV-GRDN 408

Query: 367 FFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +   +     +  +KI   I E+   +A
Sbjct: 409 VYKAENKE---DILNKILGLITEEVGHLA 434


>gi|114799275|ref|YP_759187.1| hypothetical protein HNE_0457 [Hyphomonas neptunium ATCC 15444]
 gi|114739449|gb|ABI77574.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 512

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/490 (11%), Positives = 125/490 (25%), Gaps = 100/490 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA +I         AIDL + +  ++++Q+ALD+AVL+G    +  +            
Sbjct: 25  ITAFVIPCILALTGIAIDLQNTVRQKSKVQAALDSAVLAGA---LGRQAGNTAAETTLDV 81

Query: 61  STIFKKQIK-----------KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA 109
            T                        + +        ++     +   ++ L++   S +
Sbjct: 82  QTYALALFTDQGGGLDCDPVAVTFDETNLDILGTVRCRQPTYLSSLIGHDELEFNVASTS 141

Query: 110 QY-----EIPTENLFLKGLIPSALT-NLSLRSTGIIERSSENLAISICMVLDVSRSMEDL 163
            Y     ++         +        L   +   ++    +       V     S    
Sbjct: 142 TYGVGKLDVAFIFDVSGSMNSYNRLAQLKTAAVAAVDELLPDSRERDGTVRLAIASYNHS 201

Query: 164 YLQKHNDNNNMTSNKYLLPPPP------------------------------KKSFWSKN 193
                       +                                         S W+  
Sbjct: 202 LNAGAYIGAVTETVTLSADGSNSTALSRYNSHNTKRMIDQDSGKRFFYYQSGTCSSWNCG 261

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI------------------------- 228
              S              +          +                              
Sbjct: 262 KYSSWSWDTKRRFFDDTGLADACVYERTGTQAATDAAPGSGAWIGAGNPRWSFYAGSSSK 321

Query: 229 QEKKNLSVRIGTIAY--------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
            +            Y        +   + +   PL+ +   +K  +N L     T  +  
Sbjct: 322 YDGWQNVENQNATGYGVGAYEGRHGTCMPSGPVPLTEDKTVLKDHVNALVAEGGTAGHLG 381

Query: 281 MHHAYRELYNEKESSHNTIGSTRL------KKFVIFITDGENSGAS---AYQNTLNTLQI 331
           +   +  +  E  +                 K VI +TDG+ +      +  +   ++ +
Sbjct: 382 IAWGWYLVSPEWAAIWPEASEPLPYRQPQTSKAVILMTDGDFNIEHPTASRDSFRQSMDL 441

Query: 332 CEYMRN--AGMKIYSVAVSAPP------EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           C+ M+     ++IY+V    P       +G+ +L  C  S    F+ +   EL+E +  I
Sbjct: 442 CDGMKASSRRIQIYTVGFQVPSSVQRTGDGRTILEYCATSPSHAFSADSGEELIEVYRSI 501

Query: 384 TDKIQEQSVR 393
              I +  ++
Sbjct: 502 ARSISDLRLK 511


>gi|218506715|ref|ZP_03504593.1| hypothetical protein RetlB5_03444 [Rhizobium etli Brasil 5]
          Length = 269

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 68/273 (24%), Positives = 113/273 (41%), Gaps = 16/273 (5%)

Query: 132 SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWS 191
           S     +   S    +IS+ + LD S SM D      N ++      Y   P   K    
Sbjct: 3   STSGRTVSGHSQSQGSISMFLALDKSGSMGDP-TATVNADDPTEPFTYDCNPHLNKK--G 59

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ 251
                     + A    KI+ L  +AGNL + +  A  +     VR G ++Y   +V   
Sbjct: 60  TKIIYDTCTGSRAHYYTKIEALKIAAGNLFSQLNSA--DPNAEYVRTGAVSY--DLVEYT 115

Query: 252 CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL-------YNEKESSHNTIGSTRL 304
            + L+  +  V S +N L     TN+  A++ AY  L        + ++++H        
Sbjct: 116 PSKLAWGITAVTSYVNALESGGGTNSSGAVNTAYTSLTAKNAAGNDAEDAAHKLKTGQLP 175

Query: 305 KKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
           KK+++F+TDG+N+  S    + +T     C+  +  G++ Y++A  AP  GQ LL  C  
Sbjct: 176 KKYIVFMTDGDNNDDSRGGRSYDTLTKATCDTAKAKGIETYTIAFMAPEGGQALLHYCAS 235

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
               +F      +LL +F  I  K   Q  R+ 
Sbjct: 236 DDAHYFQAEKMEDLLAAFKAIGAKASAQVTRLT 268


>gi|197337036|ref|YP_002157821.1| hypothetical protein VFMJ11_A0264 [Vibrio fischeri MJ11]
 gi|197314288|gb|ACH63737.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 423

 Score =  133 bits (335), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/423 (12%), Positives = 119/423 (28%), Gaps = 48/423 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F     A D A  +  + +++ A + A L+  A    D+      T   + 
Sbjct: 15  LFAMMIPALFGIFALASDGARAIQTKARIEDASEVAALAISAHNDPDQPDNGSYTPSTRN 74

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  ++     + +      +   I                  ++EI       
Sbjct: 75  RQIVVDYVNAYISDVDAVTDIKVAKRRCELIPECVAGLYDGDMRY---LEHEIDVTTRQN 131

Query: 121 KGLIPSALTNLSLRSTGIIERS----SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
                +        +     +S     ++ A+      D S SM D +    N       
Sbjct: 132 SWFPGNEAIEGMGETFSTRGKSLARKYQSEAVDAMFAADFSGSMLDTWSGSSNPKYVDLI 191

Query: 177 NKYLLPPPPKKSFWSK--NTTKSKYAPAPAPANRKIDVLIESAGNLVNS----------- 223
                     + F     N  KS    +                  ++            
Sbjct: 192 EIIRNISAELQKFNDLPENRNKSTMGISAFSTFTNSFTSDTGIQCSLSQGVNGRNGPATW 251

Query: 224 ---IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
              ++ A       + +      +    G     L++N N +  ++        T +Y A
Sbjct: 252 FRPVKAANTVANIWNPKTEDYCKSGAYAGFHDVNLTSNFNYLNGQVGSFYAGGGTASYQA 311

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--- 337
           +    + L                ++ +I ++DG ++  +   + L +  +C  ++N   
Sbjct: 312 LIRGAQLL----------RKGNNSRRLLIVLSDGMDN-DTQLADGLVSAGMCRDIQNGLE 360

Query: 338 -------AGM--KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE-SFDKITDKI 387
                    +  K+  +     P     L+ C       +   D+ E+ +   + I ++I
Sbjct: 361 SDRTPDRRPIAAKMAVIGFDYNPFANKALKDCV-GEKNVYKAEDADEVEDIILELINEEI 419

Query: 388 QEQ 390
              
Sbjct: 420 GHL 422


>gi|144898053|emb|CAM74917.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 460

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 60/472 (12%), Positives = 118/472 (25%), Gaps = 110/472 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +    L +  A+D A    +++++  ALDAA L+  +S  +            + 
Sbjct: 17  IFALALIPLSLSVGLAVDTARAYAVKSKLSQALDAAALAVGSSTGT----------AAEL 66

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I +K    + K        +                  +    +  +          L
Sbjct: 67  QQIGQKFFDANFKDSGLDAAGSF----------------SVSVTGDVVSANGSAQVQTTL 110

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+      +S  +            + + +VLD + SM          +        L
Sbjct: 111 MQLVGIDTIAVSESAQ----VIRSIKGLELALVLDNTGSMTTSDNIGALRDAAQELVDIL 166

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPAN------------RKIDVLIESAGNLVNSIQKAI 228
                              +  P P                +          V    +  
Sbjct: 167 FGGRADHPTLRVAVVPYSASVNPGPIAPTLISGNDAYAPTNLLGWKGCVIERVGRAMEDS 226

Query: 229 QEKKNLSVRIGTIAYNIGI-------------------------VGNQCTPLSNNLNEVK 263
                  +R   +                                    TPL+     V 
Sbjct: 227 PASTAPWLRYQWLPAIDNYYDATKASTVRADPSQGNGGTGPNLGCPTPITPLTGVKATVD 286

Query: 264 SRLNKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGENSGAS 320
           S +  L       T     M    R L  E   +      + +  K VI +TDG+N    
Sbjct: 287 SAIQALRAWSRGGTMGDIGMAWGLRVLSPEPPFTEGLAWNTPKWAKAVILMTDGDNQFYK 346

Query: 321 AYQN--------------------------------------TLNTLQICEYMRNAGMKI 342
                                                          Q+C+ M++ G+ +
Sbjct: 347 LTSTTGPNKVNSAVNSDYSGYGRLDQYGALGTTSTTTAKSVINTRLTQVCQAMKDKGITV 406

Query: 343 YSVAV--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           Y++          +D+ + C  S+ ++F      +L  SF  I  ++ +  V
Sbjct: 407 YTITFTSGINQATKDIYKACASSTAKWFDSPSQADLRASFRAIATELSQLRV 458


>gi|312883763|ref|ZP_07743482.1| hypothetical protein VIBC2010_14219 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368512|gb|EFP96045.1| hypothetical protein VIBC2010_14219 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 396

 Score =  133 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/389 (11%), Positives = 121/389 (31%), Gaps = 33/389 (8%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDP-----TTKKDQ 59
           ++    +     I + + + + N+   A DAA ++       D+ +          K D+
Sbjct: 21  MLIPMVIAAASTIVIGYQVQLSNRAMQAADAASIACEFKGEYDQALTQSYLDYYQPKIDK 80

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                +     ++  G  +      +       +     N   Y+ E      +      
Sbjct: 81  VRGQIRTNSGCNMSLGYSLSTIFTSLTLSDTSFVVSSTANEKAYVTEDVVSDPLELV--- 137

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
                      L + ++     +     +   +V            ++ N+  +    K 
Sbjct: 138 ---------IVLDISTSMYGAINDLKAILKRGIV---------SLKEQQNNAQSEDHIKV 179

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
            + P       +     +           + +    +A  + N       ++ ++ +   
Sbjct: 180 SIIPFSTGVSVNNAPWLNDARTFCVDGTTESEDKFYAARTVANL--DITHDQISVKLSQP 237

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
                     +   PL+ +L++V + ++ L     T +Y  +    R+L    + +    
Sbjct: 238 NKWRESCSAASFTLPLTADLDQVTNTVDSLRTEGGTASYQGLIWGLRQLTPNWQKAWEVG 297

Query: 300 GSTRLKKF---VIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
            +  + K    ++ +TDG  +    Y + L    +C+  ++ G+ +  V         + 
Sbjct: 298 PNRNVDKVERKLVLMTDG--NDYGRYFDDLINAGLCDRAKDYGIALNFVGFGVNGSRLEQ 355

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITD 385
             +C       F+ +D+++L   F ++  
Sbjct: 356 FTRCAVDPKGVFSASDTQDLDHYFSQLLS 384


>gi|148258759|ref|YP_001243344.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
 gi|146410932|gb|ABQ39438.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
          Length = 449

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 56/433 (12%), Positives = 120/433 (27%), Gaps = 59/433 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            AI+       +   +D +    +R ++QSA+DAA + G  S  S   I       D   
Sbjct: 23  FAIVCVPLITAVGCGVDYSRANQLRAKLQSAVDAASV-GAVSRTSPAFIAAGAMTADGII 81

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           T      +                +   ++            +  +   +      +   
Sbjct: 82  TAGNDDARNIFNGNMNGTTGYTLNSVTPEV-------KKTGSVLTATVSFSASV-PMMFM 133

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            ++      L   S      +S    I   ++LD S SM               ++    
Sbjct: 134 NIVGIKTMTLQGMSKA---TASMPKYIDFYLLLDNSPSMGVAATPDDVTKMVNATSDAKY 190

Query: 182 PPPPKKSFWSKNTTKSKYAPA---PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                 +F   +   S              +IDVL  +   L+++  +         + I
Sbjct: 191 GSNRYCAFACHDYNDSNNFYNLAKSIGVTTRIDVLRSATQQLMDTATQTQTYPNQFRMAI 250

Query: 239 GTIAYNIGI-VGNQCTPLSNNLNEVKSRLNKLNPYE----NTNTYPAMHHAYRELYNEKE 293
                            LS NL+  KS    ++       N          +  ++    
Sbjct: 251 YDFGAASKTIGLRALFALSANLSSAKSAAGNIDLMGVYGNNDAYTADKDTPFTAVFPAVN 310

Query: 294 SS---HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL----------QICEYMRNAGM 340
           +         +    K++ F++DG    ++A                   +C  ++N G+
Sbjct: 311 NEISTPGDGTTGSPLKYLFFVSDGVADESNAACLKPKASGNRCQSPINPALCTTLKNRGI 370

Query: 341 KIYSVA-----------------------VSAPPEGQ--DLLRKCTDSSGQFFAVNDSRE 375
           KI  +                            P  +    ++ C    G +F V+ ++ 
Sbjct: 371 KIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQACAS-PGFYFEVSPTQG 429

Query: 376 LLESFDKITDKIQ 388
           + ++ + +  K  
Sbjct: 430 IADAMNALFKKAV 442


>gi|149909538|ref|ZP_01898192.1| TadG-like protein [Moritella sp. PE36]
 gi|149807443|gb|EDM67394.1| TadG-like protein [Moritella sp. PE36]
          Length = 405

 Score =  132 bits (332), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 57/406 (14%), Positives = 126/406 (31%), Gaps = 31/406 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A++I   F   T A D A  +  + +++   DAA  +  A    +      ++     
Sbjct: 14  LFAMMIPAFFGIFTLASDGARALQSKARLE---DAAEAAVLAIAAHNADNSGSSSGSAIN 70

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK-NNPLQYIAESKAQYEIPTENLF 119
             I    I ++++    I +          I   K+   N      + +   +    + F
Sbjct: 71  KKIASDWIGQYMQDMQAISDIKITKLNCNDIAECKEGLENGESRYFQYEILAKTNHLSWF 130

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
                 +              R  ++ ++ +  V D S SM + +    N        K 
Sbjct: 131 PGNNSTAGFGESFDVVGSATARKFQSESVDVMFVSDFSGSMNNKWSGGSNSRRYKDLIKI 190

Query: 180 LLPPPPKKSFWSK--NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
           +     +   ++    TT ++          +         +  +    A +    +   
Sbjct: 191 IGDVIKELDKFNNAHTTTTNRVGFTGFNTYTRKTADNSCYQDQYDR--SAGRTVNKIFEV 248

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
            G  + + G        +++N NE K+ +    P   T +Y  +    + +    E    
Sbjct: 249 KGCKSRSSGGAKFHDIAMTDNYNEFKNTIKYFKPGGGTASYQGIIRGAQMMDAAPEPRPR 308

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM------------RNAGMKIYSV 345
                   + +I ++DG +S  S   N L    +C  +            +    K+  V
Sbjct: 309 --------RIMIILSDGIDSKRSRA-NKLVEEGMCSKILLKLGNANTSDGKAIKTKMAVV 359

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRE-LLESFDKITDKIQEQ 390
                P     L KC       +  N+  + L +  + I+++I   
Sbjct: 360 GFDYNPASNPSLAKCV-GEHNVYGANNPEDVLNKILELISEEIGHL 404


>gi|84515372|ref|ZP_01002734.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
 gi|84510655|gb|EAQ07110.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
          Length = 485

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 61/485 (12%), Positives = 118/485 (24%), Gaps = 126/485 (25%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MT +++    +    A+D       R  +QS  D AVL+  +   +  +           
Sbjct: 36  MTILLLVTMLIMGGMAVDFMRYEARRATLQSVSDRAVLAAASLNQTLDS----------- 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +  ++ +  +  +     G         I  D  N       S         N F 
Sbjct: 85  ----RDVVEDYFAKAGFPNALVG-------APIVVDNGNSRTVTVRSALDV-----NTFY 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L          RS+           + I +VLD+S SM       +     +   + +
Sbjct: 129 LRLAGMDRLTAPARSSATEGV----GKVEISLVLDISGSMRFSNRFVNMQAAAIAFAEEV 184

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI--------------ESAGNLVNSIQK 226
           L P    +        +            +  +                        +  
Sbjct: 185 LDPANGGTVSLTIIPYAGATNPGPEMFAFMGGVRYPDTLLAGDDGILGTEDDYFFPQVSS 244

Query: 227 AIQEKKNL------------------------SVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
            ++   +                         SV                        + 
Sbjct: 245 CVEMVGSDWSSAGLPGAGRAQVPHFQVWDIARSVMDWGWCPQDRSSIQYAMA---TPAQA 301

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKE-------------------SSHNTIGSTR 303
           +S +N L  ++ T T+ AM +A   L    +                   +         
Sbjct: 302 RSFINGLRMHDGTGTHYAMKYALATLDPSSQPAFMHLSHPGRGLVPPQFANRPAAWDDPE 361

Query: 304 LKKFVIFITDGENSGASAY------------------------------QNTLNTLQICE 333
            KK ++ +TDG+ +                                    N      IC 
Sbjct: 362 TKKIIVLMTDGDITQQERPRIAQQERDIDYIISRSINGRDNRGQFVDAATNVGRFEAICT 421

Query: 334 YMRN--AGMKIYSVAVSA--PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                   + +Y+VA            +R C      FF      EL++ F  I ++I +
Sbjct: 422 LANQPARSVDVYTVAFEVQPNSAADLQMRNCASDPSMFFR-TSGAELIDVFSGIAERITD 480

Query: 390 QSVRI 394
             + +
Sbjct: 481 LRLNL 485


>gi|56696619|ref|YP_166980.1| hypothetical protein SPO1742 [Ruegeria pomeroyi DSS-3]
 gi|56678356|gb|AAV95022.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 558

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/352 (12%), Positives = 87/352 (24%), Gaps = 66/352 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   +           +DL      R  +Q  +D AVL+          +    + +   
Sbjct: 38  MALFLFLALVGAAGIGVDLMRYEQKRAALQYTMDRAVLAAA-------DLDQQVSPETVV 90

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            +  +K                        ++    +         + A  E+P      
Sbjct: 91  RSYLEKA------------------GLLEYLSSVTVQEGLGYRKVSATATAELP---THF 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L       +   ST           + I +VLDVS SM       +  N       ++
Sbjct: 130 MKLSGYDSLTIPAASTAEESI----GNVEISLVLDVSGSMNSNSRLYNLKNAAKEFVDHM 185

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLS 235
           L      +        +    A A      +V            + +   +    +    
Sbjct: 186 LSATEPGTVSISIVPYATQVNAGADILSYYNVSTEHNYSHCVNFIDDEFSQPGLSRVTPL 245

Query: 236 VRIGTIAYNIGI------------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
            R                         +  P SN+   + + ++ L    NT+       
Sbjct: 246 ERTMHFDPFSYTKDPISTPVCPVRASTEILPFSNDQTVLNNYIDGLTGRGNTSIDIGTKW 305

Query: 284 AY-----------------RELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
                               ++    +   +   S  + K +I ++DGEN+ 
Sbjct: 306 GVVMLDPGTQSVISGLISDNKVPASFQGRPSAYDSGDVLKVLIVMSDGENTN 357



 Score = 78.0 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/329 (12%), Positives = 100/329 (30%), Gaps = 15/329 (4%)

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA-----QYEIPTENLFLKGLIPSA 127
           + G                + TKD  +       +         +    N ++ GL    
Sbjct: 236 QPGLSRVTPLERTMHFDPFSYTKDPISTPVCPVRASTEILPFSNDQTVLNNYIDGLTGRG 295

Query: 128 LTNLSLRST-GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
            T++ + +  G++       ++   ++ D              D+ ++     ++     
Sbjct: 296 NTSIDIGTKWGVVMLDPGTQSVISGLISDNKVPASFQGRPSAYDSGDVLKVLIVMSDGEN 355

Query: 187 KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
            + +  N +             +  +      N  N+         N         +   
Sbjct: 356 TNQYMLNPSLRDGDSPVWYNAAEDVISGSPDNNTTNAFSIYHDNGNNSYYWPDQNRWADH 415

Query: 247 IVGNQCTPL-SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS-TRL 304
             GN  +     N +   S   +  P        A+   Y EL+ +   ++N   +    
Sbjct: 416 PYGNGQSEACGYNSSGYYSCAMRDEPG------EAVRLTYAELFAKVSLAYNAYYNFEFN 469

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
                       +   A      T  +C+  ++ G+ +Y+V   AP  G+ +L++C  S 
Sbjct: 470 SNAWAEWYTAAMTHKEASAKDQRTDHVCDAAKDEGIIVYTVGFEAPYSGRRVLKRCASSD 529

Query: 365 GQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++   D  E+ ++F  I   I++  + 
Sbjct: 530 SHYYDA-DGLEISDAFTSIASSIRKLRLT 557


>gi|254466920|ref|ZP_05080331.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687828|gb|EDZ48310.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 550

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/376 (12%), Positives = 92/376 (24%), Gaps = 68/376 (18%)

Query: 6   ISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFK 65
                      +DL  +   R ++Q  LD AVL+          +               
Sbjct: 42  FLAMLAVGGIGVDLMRMERDRTELQYTLDRAVLAAA-------DLDQSLDADAVVLDYLT 94

Query: 66  KQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP 125
           K   +        ++  G  + +A I+   +                      +L     
Sbjct: 95  KAGLEQYYSDPDDQKGLGYKSVEATIDTDFEA---------------------YLLKFAG 133

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
               +L   S           ++ I MVLD+S SM       +      +    +     
Sbjct: 134 GDNMSLYANSRAEEII----GSVEISMVLDISGSMNSGNRLVNLQAAAKSFVTQITSNTD 189

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKI------DVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
             +        +    A      K                + +   K    +    +R  
Sbjct: 190 VSNLSISIIPYATQVNAGEKLLSKYTKVSQEHDYSYCVNFIKDQFSKHTLNQNEDLIRTA 249

Query: 240 TIAYNIGI------------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
                                G+   P +N+  ++ + ++ L    NT+    M      
Sbjct: 250 HFDTFTYSMNMIDRPVCPTRPGSAILPFTNDAAKLHAYIDSLTASGNTSIDIGMKWGSAL 309

Query: 288 LYNEKE-----------------SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           L    +                       GS    K +I ++DG+ +      N      
Sbjct: 310 LDPTAQPVVNALVDDKVISENFRGRPKAYGSGDTLKIIILMSDGQ-NTNQYMVNEHRRDG 368

Query: 331 ICEYMRNAGMKIYSVA 346
           I +   N    ++SV 
Sbjct: 369 ISDVWYNEEADVFSVY 384


>gi|325106974|ref|YP_004268042.1| von Willebrand factor A [Planctomyces brasiliensis DSM 5305]
 gi|324967242|gb|ADY58020.1| von Willebrand factor type A [Planctomyces brasiliensis DSM 5305]
          Length = 396

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/407 (13%), Positives = 124/407 (30%), Gaps = 59/407 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++SV  + + +  D+A++  +R Q+  + DAA  +G  ++    +           
Sbjct: 23  LIAALLSVMLILVVFTTDVAYMQLVRTQLHVSTDAAAKAGMEALARTESRGQARVVAKDI 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ-----YEIPT 115
            +      ++       I     D           ++                      +
Sbjct: 83  FSKNLIGGRELKLHNKDIEFGRTDANPDGTWEFLPNERPFQAIRISVNLDDNRQKGRNGS 142

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
             L    ++  +    +  S         NL   I + LD S SM               
Sbjct: 143 VPLLFGKVLGQSSFATNHSSVA------ANLVHEIVLCLDRSHSMCFDETG--------- 187

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK--------A 227
              Y  PP             + Y   P P   +   L  +    V+++           
Sbjct: 188 -VDYAYPPGTPS-------YPAGYITPPNPVGSRWAKLQGAIQVFVDTLDDLQIVPDVGV 239

Query: 228 IQEKKNLSVRIGTIAYNIGIVGN--QCTPLSNNLN----EVKSRLNKLNPYENTNTYPAM 281
           +    ++++      +            PL  NLN     + ++L  +     TN    +
Sbjct: 240 VTWGSDITLSWSWYPFQGRSFPAVMVDVPLGQNLNLVSPAIAAKLGDIM-MGGTNMSSGI 298

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMK 341
             +   L             +  +K +I ++DG+ +         N L       +  + 
Sbjct: 299 DRSVSLLT-------ANGTHSLAQKTIILMSDGQWNAGR------NPLDAANDAADKNIT 345

Query: 342 IYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
           I+++A       Q ++R+  + + G+FF   D   L ++F ++   +
Sbjct: 346 IHTIAFLNG--DQSVMRQIAERTGGKFFNAPDGESLEDTFKELAKML 390


>gi|13473479|ref|NP_105046.1| hypothetical protein mll4092 [Mesorhizobium loti MAFF303099]
 gi|14024228|dbj|BAB50832.1| mll4092 [Mesorhizobium loti MAFF303099]
          Length = 477

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/473 (12%), Positives = 124/473 (26%), Gaps = 103/473 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +     SV  L   +++D++ +   ++ +Q  +DAAV S    + +    +   +K  Q 
Sbjct: 25  LFGFAASVLALAAGFSVDISQLYNAKSGLQGVVDAAVTSTARDLTTGVIKEADASKAVQN 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +              +     D                         Q +   +    
Sbjct: 85  FLVANSMAGILQPDQIVLDRLVVDRTAN-------------------TVQADAHVDVALF 125

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND---------N 171
             +     T    R T        +  I + M+LDV+ SM   +  K +           
Sbjct: 126 FPVFGMGNTQ---RVTASTTSLYSDKTIEVAMMLDVTGSMAANWWAKTDKIGDLQAAAST 182

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYA-----------------------------PA 202
                    + P   +   +                                      P 
Sbjct: 183 AVENLLDNNIDPNNPRVRVAIVPYAEAVNTGGLADSVFVEQAGGSNLPPPVPSAGAPIPV 242

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN---------IGIVGNQCT 253
            +    + D       +       +      L        Y                +  
Sbjct: 243 GSSVTLRPDKCATERKDKDGYADYSSDGPSELRRNNQNQEYLAKVNRDDRMGTCPKPELI 302

Query: 254 PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES---------SHNTIGSTRL 304
           PL+ +  ++   +        T    A+   Y  L     S               + ++
Sbjct: 303 PLTADKQKLLDTIADFKAAGVTAGGIAVQWGYYMLSPSWRSTIVNARLGSGPANFDNRKV 362

Query: 305 KKFVIFITDGENSGASAYQ------------NTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
            K  I +TDG+ + A A              +  N   IC+ M+  G++I+++       
Sbjct: 363 GKVAILMTDGQFNTAFAAGRGAPRSQNAGQMSRSNAESICDNMKRDGIEIFTIGFDLDDP 422

Query: 353 G---------QDLLRKCTDSS----GQFFAVNDSRELLESFDKITDKIQEQSV 392
                     + +L+ C+ +       ++      EL E+F+ I   I+  ++
Sbjct: 423 SMTSTERDQAKSVLQDCSTADTSTLKHYYEAATGPELDEAFNAIVQNIERLTI 475


>gi|116252440|ref|YP_768278.1| hypothetical protein RL2693 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257088|emb|CAK08182.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 427

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/437 (13%), Positives = 134/437 (30%), Gaps = 73/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++   F     A+D AH + +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMSGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 KD    IF  Q+   L            +     IN+TK  N     +      
Sbjct: 79  SLG---KDDARNIFMSQMSGELTD----------VHIDLGINVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       ++      +S  +T           +   ++LD + SM          
Sbjct: 120 SFSATVPTTFMRILGRDSITISGAATA---EYQTAAFMDFYILLDNTPSMGVGATANDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +          +S  +                 +IDV+ ++   L ++ +     
Sbjct: 177 KLQAKTGCAFACHQMDQSTNNYTI------AKGLGVAMRIDVVRQATQALTDTAKTERVS 230

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHH 283
                + + T             +  +++L +VK+  + ++         N +   +   
Sbjct: 231 SDQFRMGVYTFGTKAEDAKLTTISSPTSDLTKVKNYTDTVDLMTIPYQNYNQDQLTSFDS 290

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------ICE 333
           A  ++    + + +   +   +K + F++DG          T  T             C+
Sbjct: 291 ALTQMNTIIDPAGDGTSNISPEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCK 350

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++ G+KI   Y+  +  P                   ++ C    G +F V  +  + 
Sbjct: 351 PLKDRGVKIAVLYTTYLPLPSNDWYNKWISPFQSEIPTKMQACAS-PGFYFEVTPTEGIT 409

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 410 DAMKALFLKVIRSPRIT 426


>gi|85859126|ref|YP_461328.1| von Willebrand factor type A domain-containing protein [Syntrophus
           aciditrophicus SB]
 gi|85722217|gb|ABC77160.1| von Willebrand factor type A domain protein [Syntrophus
           aciditrophicus SB]
          Length = 447

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/456 (12%), Positives = 138/456 (30%), Gaps = 86/456 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V   F   A+D+      R+++  ++DA  ++G  +I +    +D   +    
Sbjct: 15  IFALLLIVLLGFTALAVDVGRWYTTRSELSKSVDAGAIAGAKNISNPYLGEDGHLR---- 70

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + ++  +++   G  +  ++G   + A      D+++ ++      +          L
Sbjct: 71  --LAEEVARENFSAGYLMTPDSG--ERSATFTAYADEDHRIRVEGTVSS-------PGNL 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM------ 174
            GL        S           +   + I +VLD S SM+   +               
Sbjct: 120 AGLFGVDWVATSAMGVA------KKNEVEIMLVLDRSGSMDGTPMNDLKKAARSFVSFFE 173

Query: 175 -----------TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                      +    +    P  + +  + T    A     A    D L ++       
Sbjct: 174 ETQDQDKMGLVSFATSVKVDVPLGNNYVSSMTSKINAMDAVGATNAEDSLSQAGNPAKGG 233

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL----------------- 266
           +        N  V+   I ++ G           N  +    +                 
Sbjct: 234 LTDQSGVPGNKRVQQFVIFFSDGNPTAFRGKFKYNGTDNIDAVVCGTGNDCGTVYTKLGK 293

Query: 267 -----------------NKLNPYENTN------TYPAMHHAYRELYNEKESSHNTIGSTR 303
                                P   T+          ++     + ++ +      G+T 
Sbjct: 294 PEREEWLSYNPRFTGDGKPKPPGTGTSKCTTRYGGSYVNTTKWYVLDDPDYRLTYRGTTY 353

Query: 304 LKKFVIFITDGENSG----ASAYQNTLNTLQI--CEYMRNAGMKIYSVAVSAPPEGQDLL 357
             +     T G ++     ++    T   + +   + +++  +KIY++ +      +D L
Sbjct: 354 NSESCFIPTVGSSNTTAPLSTYICTTARGMAVEHAQELKDNNVKIYTIGLG--NIDRDFL 411

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            +        F    S EL   F+KI   I+ + V+
Sbjct: 412 SQIASGPSFEFYAPTSGELQAIFNKIAKDIKLRLVQ 447


>gi|254292617|ref|YP_003058640.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
 gi|254041148|gb|ACT57943.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
          Length = 514

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 76/509 (14%), Positives = 153/509 (30%), Gaps = 137/509 (26%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ ++V    I + ID   +   +  +Q+A D+AVL+   + ++       T +++ +
Sbjct: 22  MFALFLTVILFIIGFTIDFRRMDSAKMHLQAATDSAVLAAARAYLTSSVQVKETKRQEDS 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I    +  +L   S   EN        QI +   ++  +   A +K +       L  
Sbjct: 82  QKIASDYLTANLLSSSNNFENN-------QIQLVFKEDGEIVGNASTKIK-------LIF 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL   +   L   +   +  S +   + I +VLD S SM      K     ++     +
Sbjct: 128 GGLFGKSDVVLPALAAATVGDSRK---LEIVLVLDTSGSMSSQNRMKQLRTASINFVNSV 184

Query: 181 LP-------------PPPKKSF--------WSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
                          P              W  +   + +         ++    +   N
Sbjct: 185 FDNAVYERTVQVGVVPWNATVNINMDRPGTWDASPGPAIHNSNYGNGTNQVTSFQDFTEN 244

Query: 220 L-------------------------------------------VNSIQKAIQEKKNLSV 236
           L                                           V  +      K     
Sbjct: 245 LYPPGFSDFGSYSDSDIDDDFGSSGWLGCITATKDERKISSSGNVTPLTDVPPSKMKWPA 304

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN------ 290
           R            +    +S +  ++  +LN+LNP  NT+    +   YR          
Sbjct: 305 RKVAGWDPNSDCPSPMLAMSQSRPQIIKKLNQLNPSGNTHADIGLMWGYRMFSQQANWNN 364

Query: 291 ----EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN------------------- 327
                 ++  ++  ST+ +K +I +TDGEN+  ++   +                     
Sbjct: 365 FFGYNSDTKPDSFHSTKSRKIMIMLTDGENTATNSEGYSYYGWCTYTNHYNKWGRYTGST 424

Query: 328 ----------------------TLQICEYMRNAGMKIYSVAVS----APPEGQDLLRKCT 361
                                  L  CE +R+  ++++++A+            LLR+C 
Sbjct: 425 KDCEVPKGINKDEISNNDLNSLMLDACEVIRSKDVELFTIALDLHSYYDSTAIALLRECA 484

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            S    + +    EL E+F ++  K    
Sbjct: 485 GSDSHAYNIK-GNELDETFQELASKALRL 512


>gi|90424817|ref|YP_533187.1| hypothetical protein RPC_3326 [Rhodopseudomonas palustris BisB18]
 gi|90106831|gb|ABD88868.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 479

 Score =  127 bits (319), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/451 (13%), Positives = 136/451 (30%), Gaps = 60/451 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCA------------------ 42
           +  I +     F+  A+D +     R+ MQ A D+A L                      
Sbjct: 28  LFGIAVIPLISFVGVAVDYSRATAARSAMQGAADSATLMVSKDYAAGVIRASDIQATAEK 87

Query: 43  ---SIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
              ++ +   I + T     T+          +     +  +   +A    +  T    +
Sbjct: 88  YFKALYTSPGINNVTVTATYTARSANGSSTVVMNTSGSMPTSFLKVAGFTALPFTASSTS 147

Query: 100 PLQYI-AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL---AISICMVLD 155
                        ++     +   L       + L +T     S++     +I    V+ 
Sbjct: 148 TWGATRLRVAMALDVTGSMDWDDKLTAMKTAAIKLVNTLKATASTDADVYISIIPFNVMV 207

Query: 156 VSRSMEDLYLQKHNDNN------NMTSNKYLLPPPPKKSFWSKNTT--KSKYAPAPAPAN 207
              +          D +      N T+           S+W+ + T   ++ +   A   
Sbjct: 208 NVGTANKDAEWLDWDTDYGSCKSNRTTQNSCQAAGETWSWWANSCTSRYTRKSTCVAGGE 267

Query: 208 RKIDVLIESAGNLVNSIQKAIQE---KKNLSVRIGTIAYNIGIVGNQCTPL--------- 255
             I   + +    V     +      K   +       +           L         
Sbjct: 268 TWIPSGVSNWKGCVTDRTTSNDYDVIKTPPTTATPATLFLAKSYSACPLSLLPMKAAYSS 327

Query: 256 -----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTR-LKKFVI 309
                S   + +K ++NKL+   NTN    +  A+  L      +     +       +I
Sbjct: 328 NESDTSTAESTLKGKINKLDAEGNTNQPIGLFWAWMSLQTGVPLNTPAKDTEYKYTDAII 387

Query: 310 FITDGEN----SGASAYQNTLNTLQICEYMRN--AG-MKIYSVAVSAPPEGQ-DLLRKCT 361
            ++DG+N    +  S         ++C+ +++   G   I+++ V+   + +  +L+ C 
Sbjct: 388 LLSDGDNTQSGNSNSVSAIDARQKKLCDNIKDPLNGTTTIFTIQVNTDGDDESAVLKYCA 447

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              GQFF    + ++  +F  I   + +  +
Sbjct: 448 S-DGQFFQSTTADQIEIAFQSIGSSLTKLRL 477


>gi|163738634|ref|ZP_02146048.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
 gi|161387962|gb|EDQ12317.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
          Length = 558

 Score =  127 bits (319), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/362 (11%), Positives = 77/362 (21%), Gaps = 74/362 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   ++S         +DL  +   R  +Q  LD AVL+          +  P       
Sbjct: 40  MVGFLLS-MLAVGGIGVDLMRMERDRTILQYTLDRAVLAAA-------DLDQPLPPAAVV 91

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K                G    ++ I+ T                        F 
Sbjct: 92  QDYLSKAGLNKYYTPPVAETGLGFKKVQSTIDTT------------------------FE 127

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  +     +              + I +VLDVS SM       +           +
Sbjct: 128 THMLKFSSGQ-DMPLYATSRAEESIDGLEISLVLDVSGSMGSNSRLANLKVAAKDFVDTM 186

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKI-----DVLIESAGNLVNSIQKAIQEKKNLS 235
           +               +     P     +               + +  Q          
Sbjct: 187 IANTIDNKMSISIIPYATQVSLPTELMDQYNTTDEHAYSNCVNFVGSHFQTTALSTTQEL 246

Query: 236 VRIGTIAYNI-----------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            R    +                         +  P   + N +K  ++ L    NT+  
Sbjct: 247 DRTMHFSVWSGSDYRASANPLDSPTCEDSANREILPFQKDANTLKGFIDGLQAEGNTSID 306

Query: 279 PAMHHAYRELYNE-------------------KESSHNTIGSTRLKKFVIFITDGENSGA 319
             M      L                        +           K ++ +TDG+N+  
Sbjct: 307 VGMKWGTALLDPSARPAISALASGGGAMVPATFNNRPAAFNDHETVKVIVLMTDGKNTNQ 366

Query: 320 SA 321
             
Sbjct: 367 YY 368



 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 42/115 (36%), Gaps = 10/115 (8%)

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
            ++ + Y+ LY +     +                G     +       T  +C   +N 
Sbjct: 453 TSLKYLYKYLYGDWMGQSSARSVWYY---------GVYDYWNTSTKDARTRAVCNAAKNQ 503

Query: 339 GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           G+ +Y++   AP  G  +L+ C  S    F V    E+ ++F  I   I++  + 
Sbjct: 504 GIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVRGL-EIRDAFASIATSIRQLRLT 557


>gi|110634434|ref|YP_674642.1| hypothetical protein Meso_2084 [Mesorhizobium sp. BNC1]
 gi|110285418|gb|ABG63477.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 549

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 60/523 (11%), Positives = 132/523 (25%), Gaps = 131/523 (25%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS---------------ALDAAVLS-GCASI 44
           + A+     F     A+D  ++   R+++Q+                 DA   S   + +
Sbjct: 25  ILALSALPVFGAAGLAVDYTNMSRTRSELQNALDAAVLAVAQRGDKISDAEARSIAASFL 84

Query: 45  VSDRTIKDPTTKKDQTSTIFKKQIKKHLK---------------QGSYIRENAGDIAQKA 89
             + +        ++  T  K   +  +                  S             
Sbjct: 85  TGNLSSAYKNMAVERNGTSVKLSAEATMPLSFGGLIGRKEATVGASSTADMAFAYYEIAL 144

Query: 90  QINITKDKNNPL---------------QYIAESKAQYEIPTENLFLKGLIP-------SA 127
            ++ T                            K + +           +          
Sbjct: 145 VLDTTGSMRGGKLQAMKEAVNGLIDDLSSRVTDKERLKFALVPFASFVNVGPQFGPEFDR 204

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLD------VSRSMEDLYLQKHNDNNNMTSNKYLL 181
              +   +            IS   +L       V+  +   +          +S+ Y +
Sbjct: 205 NGRIVPGTGADWLDLQGISPISQLDLLPGLSRFEVAHHLGQDWKGCVETRMPTSSSAYDV 264

Query: 182 P---------------------PPPKKSFWSKNTTKSKYAPAPAPAN-----RKIDVLIE 215
                                 P   + + +     +  A   +         +  +   
Sbjct: 265 DDAPVVATDRYSLFVPTFAIDEPDGGRLYANNYIASNTSAFGNSAVAIARRLLRYGLDDA 324

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG------IVGNQCTPLSNNLNEVKSRLNKL 269
           +   L  +      + +    R     Y+ G       +    TPLSN+   +K  +++ 
Sbjct: 325 AQAALTGATNLIGLDIRPERWRKVEHEYSDGRGPAYGCLSRPITPLSNDYAALKREVSRF 384

Query: 270 NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT---- 325
               NTN    +    R L   +  +     ++ ++K +I +TDG N+   +        
Sbjct: 385 TADGNTNIMEGVAWGMRVLSPREPFTEGKEPASDVEKIMIVLTDGANNMGLSNNRNHALG 444

Query: 326 ----------------------------LNTLQICEYMR-------NAGMKIYSVAVSAP 350
                                         TL  CE  +          + IY++ +  P
Sbjct: 445 SSYSSFGYLVEDRLTRERSQRRVTEEMNRRTLAACENAKREYTPSKEDDVTIYTIRLEEP 504

Query: 351 PEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                 LL++C    G +F      +L   F +I D I +  +
Sbjct: 505 DVATGTLLQECATGPGYYFDSPSRTQLNAIFKEIRDGITKLRL 547


>gi|163742980|ref|ZP_02150363.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
 gi|161383663|gb|EDQ08049.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
          Length = 560

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/362 (11%), Positives = 79/362 (21%), Gaps = 74/362 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M   ++S         +DL  +   R  +Q  LD AVL+          +  P       
Sbjct: 42  MVGFLLS-MLAVGGIGVDLMRMERDRTILQYTLDRAVLAAA-------DLDQPLPPAAVV 93

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K                G    ++ I+ T                        F 
Sbjct: 94  QDYLSKAGLNKYYTPPVAETGLGFKKVQSTIDTT------------------------FE 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  +     +              + I +VLDVS SM       +           +
Sbjct: 130 THMLKFSSGQ-DMPLYATSRAEESIDGLEISLVLDVSGSMGSNSRLANLKVAAKDFVDTM 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKI-----DVLIESAGNLVNSIQKAIQEKKNLS 235
           +               +     P     +               + +  Q          
Sbjct: 189 IANTIDNKMSISIIPYATQVSLPTELMDQYNTTDEHAYSNCVNFVGSHFQTTALSTTEEL 248

Query: 236 VRIGTIAYNIGIVG-----------------NQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            R    +   G                     +  P   + N +K  ++ L+   NT+  
Sbjct: 249 DRTMHFSVWSGSDYRASANPLGSPTCEDRADREILPFQKDANTLKGFIDGLSAKGNTSID 308

Query: 279 PAMHHAYRELYNE-------------------KESSHNTIGSTRLKKFVIFITDGENSGA 319
             M      L                        +           K ++ +TDG+N+  
Sbjct: 309 VGMKWGTALLDPSARPAISALASGGGAMVPATFNNRPAAFNDHETVKVIVLMTDGKNTNQ 368

Query: 320 SA 321
             
Sbjct: 369 YY 370



 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 42/115 (36%), Gaps = 10/115 (8%)

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
            ++ + Y+ LY +     +                G     +       T  +C   +N 
Sbjct: 455 TSLKYLYKYLYGDWMGQSSARSVWYY---------GVYDYWNTSTKDARTRAVCNAAKNQ 505

Query: 339 GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           G+ +Y++   AP  G  +L+ C  S    F V    E+ ++F  I   I++  + 
Sbjct: 506 GIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVRGL-EIRDAFASIATSIRQLRLT 559


>gi|190892054|ref|YP_001978596.1| hypothetical protein RHECIAT_CH0002466 [Rhizobium etli CIAT 652]
 gi|190697333|gb|ACE91418.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 427

 Score =  126 bits (315), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 62/437 (14%), Positives = 136/437 (31%), Gaps = 73/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH + +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMAMNGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 K     IF  Q+   L +          +     I++TK  N     +      
Sbjct: 79  SLG---KTDARNIFMSQVSGELAE----------VHVDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T           +   ++LD + SM          
Sbjct: 120 SFTATVPTTFMQIFGRDSITISGTATA---EYQTAAFMDFYILLDNTPSMGVGATPSDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                           KS  +    KS           +IDV+ ++   L ++ +     
Sbjct: 177 KLEAKVGCAFACHQMDKSTNNYTIAKS------LGVAMRIDVVRQATQALTDTAKTERVS 230

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHH 283
                + + T             + L+++L +VKS  + ++         N++       
Sbjct: 231 SDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKSYTDAVDLMTIPYQNYNSDQITNFDS 290

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------ICE 333
           A  ++    + + +   +T  +K + F++DG          T  T             C+
Sbjct: 291 AMTQMNTIIDPAGDGTSNTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCK 350

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++ G+KI   Y+  +  P                   ++ C    G +F V+ +  + 
Sbjct: 351 PLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQSEIPTKMQACAS-PGFYFEVSPTDGIT 409

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 410 DAMKALFLKVIRAPRIT 426


>gi|218528586|ref|YP_002419402.1| hypothetical protein Mchl_0543 [Methylobacterium chloromethanicum
           CM4]
 gi|218520889|gb|ACK81474.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 518

 Score =  126 bits (315), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 70/491 (14%), Positives = 134/491 (27%), Gaps = 99/491 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +          ID A    +R Q Q A+DA  L+     +           + Q 
Sbjct: 26  IFALALVPMAFLAGMTIDYAQNTNLRQQAQVAVDATALALAKLPLDTTDKDLAAKAEAQV 85

Query: 61  STIFK----KQIKKHLKQGSYIRENAGDIAQKAQIN----ITKDKNNPLQYIAESKAQYE 112
            T  K      +   ++    + E A   A    +           +       S    E
Sbjct: 86  LTALKGLPIDALTVTMRHNGDLIEVAAKGATPTSLTRLAGFMSMPLSVSAISNRSMTNLE 145

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIERSSENLA-----------ISICMVLDVSRSME 161
           I         +  + LTNL   +  ++    +              +   M ++V     
Sbjct: 146 IALVLDNTGSMKGTKLTNLKAAARDLVTSLFQQADPAKPNALKIGVVPFSMTVNVGSGFA 205

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA------------------- 202
                  N  + +    +     P   F         +A                     
Sbjct: 206 GSDWLDINAKSPIHQQIFNAQGVPANRFSLFADMGKPWAGCVESRPAPYDVQDTAPSQAT 265

Query: 203 ------PAPANRKIDVLIESAGNLVNSIQ----------------KAIQEKKNLSVRI-- 238
                 P  A  + D    +  + +  +                  A  +K    V    
Sbjct: 266 PSTLFVPFFAPDESDNDSRAVNDYMADLPSGGSAGGASNRQLQGMTAKYDKNAFKVSTTA 325

Query: 239 ------GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                      N G      T L+ +  ++ + +  +    +TN    +   +  L    
Sbjct: 326 RQDGTNYLFGPNAGCEIQPLTRLTTSQTQLTNAIAAMTVIGDTNIPIGLAWGWHLLSPNG 385

Query: 293 E-SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ--------------------- 330
                   G  + KKF++ +TDG+N  A +  +  +                        
Sbjct: 386 PFKDGVAYGEIKTKKFIVLMTDGQNQSAVSSSDNRSYYSGLGFIWQNRIGTTSNDNAVRT 445

Query: 331 ---------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFD 381
                    +C+ +R A +++++V V        +L+ C  S   FF V +S  L   F 
Sbjct: 446 KAIDTRLTLLCDNIRKARIQVFAVRVEVNDGDSAVLKACATSPNMFFDVKNSSGLPAVFR 505

Query: 382 KITDKIQEQSV 392
            I D+I E  +
Sbjct: 506 AIADQISELRI 516


>gi|146337718|ref|YP_001202766.1| hypothetical protein BRADO0587 [Bradyrhizobium sp. ORS278]
 gi|146190524|emb|CAL74523.1| conserved hypothetical protein; putative vWFA domain
           [Bradyrhizobium sp. ORS278]
          Length = 442

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/430 (13%), Positives = 121/430 (28%), Gaps = 60/430 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            AI+       +   +D +    +R ++Q+A+DAA + G  S  S   I       D   
Sbjct: 23  FAIVCVPVITAVGCGVDYSRTNQMRAKLQAAVDAASV-GAVSRTSPAFIAAGAMTTDGVI 81

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                  +K               +   ++            +  +   +   T      
Sbjct: 82  AAGNDDARKIFNGNMSGTTGYTLDSLTPEV-------KKTGSVLTATVSFS-ATVPTLFM 133

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            ++     +L   ST           I   ++LD S SM               ++    
Sbjct: 134 SIVGYKTMSLQGSSTAKAS---MPKYIDFYLLLDNSPSMGVAATPADVTKMVSATSDKCA 190

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                 +  +     +K          +IDVL  +   L+++ Q+         + I   
Sbjct: 191 FACHDYNDANNYYNLAK----TLGVTTRIDVLRSATQQLMDTAQQTQTYSNQFRMAIYDF 246

Query: 242 AYNIGI-VGNQCTPLSNNLNEVKSRLNKLNPYE----NTNTYPAMHHAYRELYNEKESS- 295
             +           LS++L   KS    ++       N +        Y        +  
Sbjct: 247 GASSKTIGLRALFALSSSLTSAKSAAGNIDLMGVYGNNDSFTADKDTPYTTALPAINNEI 306

Query: 296 --HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL----------QICEYMRNAGMKIY 343
                  S    K++ F++DG    ++A                   +C  ++N G+KI 
Sbjct: 307 ATPGDGTSGSPLKYLFFVSDGVADESNAACLKPKASGNRCQSPINPALCTALKNRGIKIA 366

Query: 344 SVA-----------------------VSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELLE 378
            +                            P  +    ++ C    G +F V+ ++ + +
Sbjct: 367 VLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQACAS-DGFYFEVSPTQGIAD 425

Query: 379 SFDKITDKIQ 388
           + + +  K  
Sbjct: 426 AMNALFKKAV 435


>gi|327190622|gb|EGE57710.1| hypothetical protein RHECNPAF_409007 [Rhizobium etli CNPAF512]
          Length = 427

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 61/437 (13%), Positives = 136/437 (31%), Gaps = 73/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH + +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMAMNGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 K     IF  Q+   L +          +     I++TK  N     +      
Sbjct: 79  SLG---KTDARDIFMSQVSGELAE----------VHVDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T           +   ++LD + SM          
Sbjct: 120 SFTATVPTTFMRIFGRDSITISGTATA---EYQTAAFMDFYILLDNTPSMGVGATPSDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                           KS  +    KS           +IDV+ ++   L ++ +     
Sbjct: 177 KLEAKVGCAFACHQMDKSTNNYTIAKS------LGVAMRIDVVRQATQALTDTAKTERVS 230

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHH 283
                + + T             + L+++L +VK+  + ++         N++       
Sbjct: 231 SDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKNYTDAVDLMTIPYQNYNSDQITNFDS 290

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------ICE 333
           A  ++    + + +   +T  +K + F++DG          T  T             C+
Sbjct: 291 AMTQMNTIIDLAGDGTSNTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCK 350

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++ G+KI   Y+  +  P                   ++ C    G +F V+ +  + 
Sbjct: 351 PLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQSEIPTKMQACAS-PGFYFEVSPTDGIT 409

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 410 DAMKALFLKVIRAPRIT 426


>gi|32477945|ref|NP_870939.1| hypothetical protein RB13237 [Rhodopirellula baltica SH 1]
 gi|32448502|emb|CAD78017.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 388

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/396 (13%), Positives = 129/396 (32%), Gaps = 49/396 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I++ V      Y I++ ++   R ++Q + D A  +    +       +     ++ 
Sbjct: 39  MLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAAGRVLAVTGDKAEAIEAAER- 97

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 +   +L +   I +      +  +    +           S +      +++ +
Sbjct: 98  ----LLEANPYLDRTLSIGDADIIFGKSNRTEENRRYEFTPDKKVNSVSLRAFGADDVPM 153

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                     + +    I +  +  + + I +VLD S SM                    
Sbjct: 154 L----FPTMGVPIEFRPIKQAVATQVELDIAIVLDRSGSMAFS----------------- 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                K    S      K   A     R +D +  +    ++ ++ +  +      R+  
Sbjct: 193 HDEVAKNGSPSSAPPGWKMGHAVPENARWLDTV-AAVNGFLDIMEDSSHD-----ERVSL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKESSHN 297
             Y+          L+ +  E+++ +N  +       TN    +      L ++K +   
Sbjct: 247 STYSDK--SKADVKLTGDYTEIRAAMNAHSTKFKGGATNIGSGILEGGATLGDKKLAR-- 302

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
               +   + +I ++DG ++        +  +   + + N  + I++V  S     Q++ 
Sbjct: 303 ----SWASRVLIVMSDGIHNTG------IEPIPAAQQVANEKIMIFTVTFSDEANVQEME 352

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +      GQ F   DS++L E+F KI   +      
Sbjct: 353 KVAVSGGGQHFHAKDSQQLTEAFRKIAKSLPTLITF 388


>gi|37680183|ref|NP_934792.1| hypothetical protein VV1999 [Vibrio vulnificus YJ016]
 gi|37198930|dbj|BAC94763.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 481

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/456 (11%), Positives = 129/456 (28%), Gaps = 69/456 (15%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             +++    +F  + +D+  I  + NQM +A DAA L+         +        + TS
Sbjct: 28  MLVLLMSMLVFAAWVMDVMRIYSVHNQMANATDAA-LASAIISEVPESTAVELLHANLTS 86

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT-------KDKNNPLQYIAESKAQYEIP 114
                 +++         +          +  +                   S  + EI 
Sbjct: 87  GAASPYVEEVRLTHLRDEQEESLQVVLDFVPNSLNIAAQESVPIRTNAKAGISSNKAEIV 146

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                   +    +           ++       +   V+ +  +  ++      +    
Sbjct: 147 FMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEIYLG 206

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE------------------- 215
           +  +Y      +++ WS    ++       P  ++  +  +                   
Sbjct: 207 SFRRYDHAQVKRENRWSDMFDRASGRTPAVPGRQRNAMCRDLDFEGNNPATLGLRYFRNL 266

Query: 216 ---------------------SAGNL-----VNSIQKAIQEKKNLSVRIG---TIAYNIG 246
                                +  +      ++          N          I  +I 
Sbjct: 267 EKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAIFDDIE 326

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT-------- 298
              N   P        +S + +L P  NTN    M  A R L    +   +         
Sbjct: 327 CHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRPELPRR 386

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPPEGQDL 356
                  K+++  +DG +    A+++      IC  ++    G+K+ +V        + L
Sbjct: 387 YSDETSNKYLVMFSDGNHLIDPAFRDKK-MKLICTQLKQPGRGVKVMTVNFG-GAASERL 444

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           ++ C     +++ V     + + F++I +++   S+
Sbjct: 445 MQSCASGP-EYYHVASLFSVEKVFEQIAEQVISSSL 479


>gi|323493494|ref|ZP_08098616.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
 gi|323312317|gb|EGA65459.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
          Length = 393

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/393 (13%), Positives = 138/393 (35%), Gaps = 44/393 (11%)

Query: 5   IISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIF 64
           ++    +     I + + + + N+   A+D A L+                + +   +I 
Sbjct: 21  MLIPMIIAAASTIVIGYQVLLSNRAMQAVDTASLAC-------------EFRGEYDRSIA 67

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           +  +  +  +   +    G  +                   + +  Y   +    L    
Sbjct: 68  QGYLDYYKPKIDKVTATLGASSGC-----------------KVELGYSYSSIFTSLTFSD 110

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH---NDNNNMTSNKYLL 181
            S +  ++      +   +++  I + +VLD+S SM     +     N       ++   
Sbjct: 111 ASYVAGVTASQKVYVTEVTDSDPIELVLVLDISGSMMGALDELKSILNRGLTTLRSQQAN 170

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPA-----NRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                    S     +  +   AP         +D  + S G+   +   A  +  +   
Sbjct: 171 VAGQDHIKVSIVPFSNGVSVTDAPWLKSGGTLCVDATVNSGGSFSPANTVANLDVTHDQA 230

Query: 237 RIGTIAYNIGIVGNQ-CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS 295
            + T + +          PL++NLN+V   +N+L    +T +Y  +    R+L    +S+
Sbjct: 231 PVTTSSSSSDCSLTSVILPLTSNLNDVVDAVNRLQTIGSTASYQGLLWGLRQLTPNWQSA 290

Query: 296 HN---TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                      +++ ++ +TDG     +++ + L    +C   ++ G+++  +       
Sbjct: 291 WRVGPNRNQDNVQRKLVLMTDGM--DDNSHLDELINAGLCTRAKDLGIELNFIGFGVQSW 348

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
             +   +C  S+G  F+ N++++L + F ++  
Sbjct: 349 RLEQFTRCAGSAGAVFSANNTQDLDDYFSQLLS 381


>gi|87311197|ref|ZP_01093320.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
 gi|87286105|gb|EAQ78016.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
          Length = 373

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/400 (13%), Positives = 117/400 (29%), Gaps = 60/400 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V      + +D+A++   R +++ A D+A  +G  ++  ++            
Sbjct: 25  LIAVLLPVILWMAAFCVDVAYMQLTRTELRIATDSAARAGARTLSLEQDASLAHKSA--I 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKA-----QINITKDKNNPLQYIAESKAQYEIPT 115
               K  +  +    +      G   +         +      N +        Q     
Sbjct: 83  EYAAKNNVAGNTLTLADSDVQIGLSVRTDDVGRFTFSSGGKLLNSVNVTGRRTQQAPDGA 142

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
             L+L  +           +T         +   I +V+D S SM               
Sbjct: 143 VRLYLTPIFGHEFFQPVADATA------SQIDRDIALVVDRSGSMTFRIN---------- 186

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                            +         P P+  +   L++S    +  +           
Sbjct: 187 ---------------RNSYESGWRNNDPVPSRARWWALVDSVDGFLTELGSTP-----QL 226

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEK 292
             +    YN     ++   L++  + ++  L+  +   P  +TN    M      L N+K
Sbjct: 227 ELVSLSTYNSSAKIDEQ--LTDKYSRIEDALDDYSRRYPDGSTNITAGMDRGISTLQNKK 284

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
            +           K ++ +TDG ++  S+  N            +  + ++++  S    
Sbjct: 285 YARP------YASKTMVVMTDGNHNYGSSPTN------AAYDAASDDIVVHTITYSDGAN 332

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              +        GQ +   D  EL E F +I         
Sbjct: 333 QSLMREVARIGGGQHWHAPDGDELEEIFREIARNAPTLLT 372


>gi|126738776|ref|ZP_01754472.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
 gi|126719957|gb|EBA16664.1| hypothetical protein RSK20926_02629 [Roseobacter sp. SK209-2-6]
          Length = 530

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/366 (11%), Positives = 77/366 (21%), Gaps = 71/366 (19%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           T              +DL  +   R  +Q  LD AVL+          +           
Sbjct: 38  TIAFFLAMLAVGGVGVDLMRLERDRTVLQYTLDRAVLAAA-------DLDQTQEPAVVVQ 90

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               K       +   +    G    KA I+ T D                       L 
Sbjct: 91  DYLNKAGLGEYYEAPEVETGLGYKKVKATIDATFDA---------------------HLL 129

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                +   +   ST           + I +VLDVS SM       +           ++
Sbjct: 130 QFAGGSDLPVYASSTAEESI----DGLEISLVLDVSGSMNSNSRLSNLKVAARDFIDTMV 185

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI-----ESAGNLVNSIQKAIQEKKNLSV 236
                          +           +                 +          +   
Sbjct: 186 ENTTDGRMSISIVPYATQVSVSDELFDEYTTSGTNNFANCINFETSDYSTTALSTTSERE 245

Query: 237 RIGTIAYN-----------------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYP 279
           R    +                         +  PL  +   +KS +  L  + NT+   
Sbjct: 246 RTMHFSPWYTSNTRASGSPIDYEICDDRSSREILPLQKDATTLKSFITNLTAWGNTSIDI 305

Query: 280 AMHHAYRELYNEKESS-----------------HNTIGSTRLKKFVIFITDGENSGASAY 322
            M      L      +                           K ++ +TDG+N+     
Sbjct: 306 GMKWGVALLDPSARPAISSLASGASVPSEFSVRPVDYSDPDTLKIIVLMTDGQNTSQYYV 365

Query: 323 QNTLNT 328
           ++    
Sbjct: 366 EDDHRA 371



 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/403 (8%), Positives = 99/403 (24%), Gaps = 49/403 (12%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL 72
           I+  +D++  M   +++ +      ++    I +                   +      
Sbjct: 154 ISLVLDVSGSMNSNSRLSNL----KVAARDFIDTMVENTTDGRMSISIVPYATQVSVSDE 209

Query: 73  KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA----- 127
               Y      + A       +      L   +E +                 S      
Sbjct: 210 LFDEYTTSGTNNFANCINFETSDYSTTALSTTSERERTMHFSPWYTSNTRASGSPIDYEI 269

Query: 128 -----------------LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                                 + +      +S ++ +   + L    +   +       
Sbjct: 270 CDDRSSREILPLQKDATTLKSFITNLTAWGNTSIDIGMKWGVALLDPSARPAISSLASGA 329

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
           +     +   +      +             +             +     ++ + +   
Sbjct: 330 SVPSEFSVRPVDYSDPDTLKIIVLMTDGQNTSQYYVEDDHRAGDSNVWYDFSANRYSTYN 389

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN 290
             N        +Y              +  ++ +             Y ++ + Y+ +Y 
Sbjct: 390 PDNGYYWRDGYSYWYSSPYGGNNAQQLSYPDLFA-------------YTSLKYLYKYIYA 436

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
           +   S++                G             T  +C   +  G+ +Y++   AP
Sbjct: 437 DWMGSYSARSEWYY---------GVYDYHGNSTKNTRTSNVCSAAKAQGIIVYTIGFEAP 487

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             G  +L+ C  S   +F V D  E+ ++F+ I   I++  + 
Sbjct: 488 SNGVAVLQDCASSDSHYFDV-DGLEIRDAFESIATSIRKLRLT 529


>gi|327538644|gb|EGF25299.1| protein containing von Willebrand factor, type A domains
           [Rhodopirellula baltica WH47]
          Length = 388

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/396 (13%), Positives = 127/396 (32%), Gaps = 49/396 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  I++ V      Y I++ ++   R ++Q + D A  +    +       +     ++ 
Sbjct: 39  MLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAAGRVLAVTGDKAEAIEAAER- 97

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 +   +L +   I +      +  +    +           S        +++ +
Sbjct: 98  ----LLEANPYLDRTLSIGDADIIFGKSNRTEENRRYEFTPDKKVNSVGLRAFGADDVPM 153

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                     + +    I +  +  + + I +VLD S SM                    
Sbjct: 154 L----FPTMGVPIEFRPIKQAVATQVELDIAIVLDRSGSMAFS----------------- 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                K    S      K   A     R +D +  +    ++ ++ +  +      R+  
Sbjct: 193 HDEVAKNGSPSSAPPGWKMGHAVPKNARWLDTV-AAVNGFLDIMEDSSHD-----ERVSL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKESSHN 297
             Y+          L+ +  E+++ +N  +       TN    +      L ++  +   
Sbjct: 247 STYSDK--SKADVKLTGDYTEIRAAMNAHSTNFKGGATNIGSGILEGGATLGDKNLAR-- 302

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
               +   + +I ++DG ++        +  +   + + N  + I++V  S     Q++ 
Sbjct: 303 ----SWASRVLIVMSDGIHNTG------IEPIPAAQQVANEKIMIFTVTFSNEANVQEME 352

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +      GQ F   DS++L E+F KI   +      
Sbjct: 353 KVAVSGGGQHFHAKDSQQLAEAFRKIAKSLPTLITF 388


>gi|262275460|ref|ZP_06053270.1| protein TadG associated with Flp pilus assembly [Grimontia hollisae
           CIP 101886]
 gi|262220705|gb|EEY72020.1| protein TadG associated with Flp pilus assembly [Grimontia hollisae
           CIP 101886]
          Length = 453

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 55/445 (12%), Positives = 118/445 (26%), Gaps = 70/445 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I   + F     A++    +    ++   ++ A L+  A+I SD T ++ T  K+  
Sbjct: 17  IFVIAYPLLFGVFVLAVESTRYLQTHARIGDGVEVASLAVAANISSDIT-ENKTLAKNYV 75

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                             +        +  +    D+   +    +     E  +     
Sbjct: 76  DGFVPDGTISLADINIERKSCDEIYGSQCGVAGVYDEEGLVFTQYKVTLSSEFESWYPED 135

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL--------------- 165
                     +       + R  +   I +  V D S SM+  +                
Sbjct: 136 DFAPGFE--EIVELGGTAVARKYQGFTIDVAFVADFSGSMQQTWNREIKYKGVVNVISDI 193

Query: 166 ---------------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
                                N +    Y   P    +F+S    K+ Y+         I
Sbjct: 194 TRKLETFNDHTEQELNGKKVANKVAFIGYNFYPHNGSTFYSNVDYKANYSRLSYKWQENI 253

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
             +               +          TI             L++N  + ++ ++   
Sbjct: 254 PEIN--YRRTARDPINNKRTPIIGRYVNNTIPLYSDDSYFYTLDLTDNFTQFRNTISTFY 311

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS-GASAYQNTLNTL 329
           P   T +Y  +  A + +               ++K +I ++DGE+S   +   +     
Sbjct: 312 PDYGTASYEGIIEAAKIVN----------NGENIRKLIIVLSDGEDSINENNPYDNRYPG 361

Query: 330 QIC------------------EYMRNAGM--KIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
            I                   + +    +  KI+ +      E    L+ C         
Sbjct: 362 FIAPLIYQSGLCQNIINDLESKEINGRNVEAKIFVIGFGYDLEKNPGLKICAGEEN---- 417

Query: 370 VNDSRELLESFDKITDKIQEQSVRI 394
           V  +    E FD +   I E+   +
Sbjct: 418 VQSADSYQEIFDTVLQLISEEVGHL 442


>gi|209549601|ref|YP_002281518.1| hypothetical protein Rleg2_2008 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535357|gb|ACI55292.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 429

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 55/437 (12%), Positives = 138/437 (31%), Gaps = 71/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH M +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLMVPLLGTAGMAVDFAHAMSLRTQLFAAADAAAVGSIAEKSGAVAAAMTMTGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 K    +IF  Q+   L   +              I++TK  N     +      
Sbjct: 79  SLG---KTDARSIFLSQVSGELADVN----------VDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                       ++      +S  +T           +   ++LD + SM      K   
Sbjct: 120 SFTAVVPTTFMRVLGKDSITISGTATA---EYLTASFMDFYILLDNTPSMGVGATAKDVA 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                ++        +    +     +K        + +IDV+ ++   L  + +     
Sbjct: 177 TMEKNTSDSCAFACHETENKNNYYNLAK----TLGVSMRIDVVRQATKELTLTAKSTRVS 232

Query: 231 KKNLSVRIGTI-AYNIGIVGNQCTPLSNNLNEVKSRLNKLNP------YENTNTYPAMHH 283
                + + T             +  +++L++V++  + ++         N +   +  +
Sbjct: 233 TNQFRMGVYTFGTKAEDANLTTISDPTDDLDKVRTYTDAVDLMTIPKQGYNNDQQTSFDN 292

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------ICE 333
           A  ++ +   +  +   +T  +K + F++DG          T                C+
Sbjct: 293 ALTQMKDIITTPGDGSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDTSFCK 352

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++ G++I   Y+  +  P                   +++C    G +F V  +  + 
Sbjct: 353 PLKDKGIRIAVLYTTYLPLPKNSWYNTWISPFQSQIPTKMQECAS-PGLYFEVTPTEGIA 411

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 412 DAMKALFLKAIRAPRIT 428


>gi|86357991|ref|YP_469883.1| hypothetical protein RHE_CH02376 [Rhizobium etli CFN 42]
 gi|86282093|gb|ABC91156.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 427

 Score =  123 bits (308), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 60/437 (13%), Positives = 134/437 (30%), Gaps = 73/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D+AH + +R Q+            A  +  ++   ++  + T+
Sbjct: 19  MTALLMVPLMGAAGMAVDVAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMNGNGTV 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 K     IF  Q    L            I     I++TK  N     +      
Sbjct: 79  SLG---KTDARNIFMSQTSGELTD----------IHIDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       +       +S  +T           +   ++LD + SM          
Sbjct: 120 SFTATVPTTFMRIFGRDSIIISGTATA---EYQTAAFMDFYILLDNTPSMGVGATASDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +          +S  +    KS           +IDV+ ++   L ++ +     
Sbjct: 177 KLQAKTGCAFACHQMDQSTNNYTIAKS------LGVTMRIDVVRQATQALTDTAKAERVS 230

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHH 283
                + + T             + L+++L +VK+  N ++         N++   +   
Sbjct: 231 SDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKNYTNAVDLMTIPYQNYNSDQLTSFDS 290

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT----------LQICE 333
           A  ++    + + +   +   +K + F+ DG          T  T             C+
Sbjct: 291 AMTQINTIIDPAGDGTSNISPEKILFFVADGVGDSYKPSTCTKKTTGGRCQEPIDTTFCK 350

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++ G+KI   Y+  +  P                   ++ C    G +F V  +  + 
Sbjct: 351 PLKDRGVKIAVLYTTYLPLPSNSWYNTWIKPFQNEIPTKMQACAS-PGLYFEVTPTDGIA 409

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 410 DAMKALFLKVIRAPRIT 426


>gi|27365660|ref|NP_761188.1| hypothetical protein VV1_2340 [Vibrio vulnificus CMCP6]
 gi|27361808|gb|AAO10715.1| hypothetical protein VV1_2340 [Vibrio vulnificus CMCP6]
          Length = 465

 Score =  122 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/456 (11%), Positives = 128/456 (28%), Gaps = 69/456 (15%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             +++    +F  +  D+  I  + NQM +A DAA L+         +        + TS
Sbjct: 12  MLVLLMSMLVFAAWVTDVMRIYSVHNQMANATDAA-LASAIISEVPESTAVELLHANLTS 70

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT-------KDKNNPLQYIAESKAQYEIP 114
                 +++         +          +  +                   S  + EI 
Sbjct: 71  GAASPYVEEVRLTHLRDEQEESLQVALDFVPNSLNIAAQESVPIRTNAKAGISSNKAEIV 130

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                   +    +           ++       +   V+ +  +  ++      +    
Sbjct: 131 FMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEIYLG 190

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE------------------- 215
           +  +Y      +++ WS    ++       P  ++  +  +                   
Sbjct: 191 SFRRYDHAQVKRENRWSDMFDRASGRTPAVPGRQRNAMCRDLDFEGNNPATLGLRYFRNL 250

Query: 216 ---------------------SAGNL-----VNSIQKAIQEKKNLSVRIG---TIAYNIG 246
                                +  +      ++          N          I  +I 
Sbjct: 251 EKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAIFDDIE 310

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT-------- 298
              N   P        +S + +L P  NTN    M  A R L    +   +         
Sbjct: 311 CHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRPELPRR 370

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPPEGQDL 356
                  K+++  +DG +    A+++      IC  ++    G+K+ +V        + L
Sbjct: 371 YSDETSNKYLVMFSDGNHLIDPAFRDKK-MKLICTQLKQPGRGVKVMTVNFG-GAASERL 428

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           ++ C     +++ V     + + F++I +++   S+
Sbjct: 429 MQSCASGP-EYYHVASLFSVEKVFEQIAEQVISSSL 463


>gi|86137906|ref|ZP_01056482.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
 gi|85825498|gb|EAQ45697.1| hypothetical protein MED193_08588 [Roseobacter sp. MED193]
          Length = 543

 Score =  122 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 42/370 (11%), Positives = 76/370 (20%), Gaps = 78/370 (21%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           T              +DL  +   R  +Q  LD AVL+          +           
Sbjct: 38  TVAFFLAMLAVGGIGVDLMRMERDRTVLQYTLDRAVLAAA-------DLDQTQPPAVVVQ 90

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
               K       Q   +    G    +A I+ T +                       L 
Sbjct: 91  DYLNKAGLGEYYQEPIVESGLGYKRVQATIDATFEA---------------------HLL 129

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                    +   S            + I +VLDVS SM       +           ++
Sbjct: 130 RFSNGNDLPVFATSKAEESI----DGLEISLVLDVSGSMNSNSRLSNLKVAAKDFIDTMV 185

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL-----IESAGNLVNSIQKAIQEKKNLSV 236
                          +     P     +   +                  A     +   
Sbjct: 186 ANTTDGKMSISVVPYATQVSLPDDLIDQYTTVGENPYSNCINFEAAEYNSASLSTLDTLE 245

Query: 237 RIGTIAYN----------------------IGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
           R                                   +  PL  +   +K+ +  L+   N
Sbjct: 246 RSMHFTPWGYSNRDMRTYYSSPRLVRSPVCDERASREVLPLQKDATTLKNFIQNLSAGGN 305

Query: 275 TNTYPAMHHAYRELYNEKESS-------------------HNTIGSTRLKKFVIFITDGE 315
           T+    M      L      +                         +   K ++ +TDG+
Sbjct: 306 TSIDVGMKWGTALLDPSARPAISAISTGIGASVPGDFSDRPAEYSDSDTIKIIVLMTDGQ 365

Query: 316 NSGASAYQNT 325
           N+      + 
Sbjct: 366 NTSQYYVDDD 375



 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 58/396 (14%), Positives = 102/396 (25%), Gaps = 49/396 (12%)

Query: 37  VLSGCASIVSDRTIKDPT-TKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           VL    S+ S+  + +     KD   T+        +            +        T 
Sbjct: 157 VLDVSGSMNSNSRLSNLKVAAKDFIDTMVANTTDGKMSISVVPYATQVSLPDDLIDQYTT 216

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
              NP       +A          L  L  S        S   +     +  +    V D
Sbjct: 217 VGENPYSNCINFEAAEYNSASLSTLDTLERSMHFTPWGYSNRDMRTYYSSPRLVRSPVCD 276

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF---------------WSKNTTKSKYA 200
              S E L LQK                                          +    A
Sbjct: 277 ERASREVLPLQKDATTLKNFIQNLSAGGNTSIDVGMKWGTALLDPSARPAISAISTGIGA 336

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT------IAYNIGIVGNQCTP 254
             P   + +     +S    +  +    Q      V          + YN          
Sbjct: 337 SVPGDFSDRPAEYSDSDTIKIIVLMTDGQNTSQYYVDDDHRDGPSGVWYNSHYKSYSTYD 396

Query: 255 LSNNLNEVKSRLNKL--NPYENTNTYPA---------------MHHAYRELYNEKESSHN 297
                       N     PY N +                   + + YR ++ E  + ++
Sbjct: 397 SRYGGRYFFHYNNNWYNEPYGNGSGQSGTAVELNYAELFARTSLKYIYRYIFYEWMNFYD 456

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                      I+ + G ++          T  +CE  +  G+ +Y++   AP  G  +L
Sbjct: 457 ARDDWYYG---IYSSHGNST------KNARTRSVCEAAKAKGIVVYTIGFEAPSNGVAVL 507

Query: 358 RKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           R C  S   +F V D  E+ ++F  I   I++  + 
Sbjct: 508 RDCASSDAHYFDV-DGLEIKDAFASIATSIRQLRLT 542


>gi|241204947|ref|YP_002976043.1| hypothetical protein Rleg_2227 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858837|gb|ACS56504.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 429

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 57/437 (13%), Positives = 136/437 (31%), Gaps = 71/437 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++   F     A+D AH + +R Q+            A  +  ++   ++  + TI
Sbjct: 19  MTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMTMSGNGTI 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 KD   +IF  QI   L            +     I++TK  N     +      
Sbjct: 79  SLG---KDDARSIFMSQISGELTD----------VQVDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       ++      +S  +T           +   ++LD + SM          
Sbjct: 120 SFSATVPTTFMRVLGRDSITISGTATA---EYQTASFMDFYILLDNTPSMGVGATATDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                ++        +    +     +K        + +IDV+ ++   L  + +     
Sbjct: 177 TMEKNTSDTCAFACHETQNNNNYYNLAK----KLGVSMRIDVVRQATKELTVTAKSTRVS 232

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNP------YENTNTYPAMHH 283
                + + T             +  +++L++V+S  + ++         N +   +   
Sbjct: 233 SNQFRMGVYTFGTKAEDAKLTTISDPTDDLDKVRSYTDAVDLMTIPFQGYNNDQQTSFDS 292

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------ICE 333
           A  ++     +  +   +T  +K + F++DG          T                C+
Sbjct: 293 ALTQMKTIITTPGDGSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDTSFCQ 352

Query: 334 YMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELL 377
            +++  ++I   Y+  +  P                   ++ C    G +F V  +  + 
Sbjct: 353 PLKDKSIRIAVLYTTYLPLPKNSWYNTWIKPFQGEIPTKMQACAS-PGLYFEVTPTEGIA 411

Query: 378 ESFDKIT-DKIQEQSVR 393
           ++   +    I+   + 
Sbjct: 412 DAMKALFLKVIRAPRIT 428


>gi|123443829|ref|YP_001007800.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090790|emb|CAL13672.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 459

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/450 (12%), Positives = 127/450 (28%), Gaps = 72/450 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             II+      I    +++H +  + ++  A++ A L+      +              +
Sbjct: 29  FMIILPFFIALIFITFEISHYLQRKAKLSDAIEQATLALTIENNAIPDEPQQIK----NN 84

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            +       +L    +             + I    +N       +      P + L   
Sbjct: 85  ALVLSYANAYLPSKEF------------SVPIININDNTYYLEYNAAVTMAYPAKFLTQT 132

Query: 122 GLIP-SALTNLSLRSTGIIERSSENLAI-SICMVLDVSRSMEDLY--------------- 164
            L       N++     I  ++ E   +  +  V D S SM   +               
Sbjct: 133 SLTNAITDINITDNGVAIKNKAIEASDLTDVIFVADYSGSMLYNFDVNEPNDHERINALR 192

Query: 165 ----LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNL 220
                      NN   N     P    +       + +      P + KI         L
Sbjct: 193 SAFRKLHDIIMNNSNINAIGYIPFSWGTKRIVFENQQQKIYCHFPFSSKIYKPKG--NYL 250

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYN------IGIVGNQCTPLSNNLNE------------- 261
            + I+K+      L      I Y+       G       P+S+   +             
Sbjct: 251 SDEIKKSSNALLLLDYIGDIIDYDKTIESITGNAQPIDIPMSDVRTKNVCLQASNAYSLE 310

Query: 262 VKSRLNKLN------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
            +  +N ++      PY  T     +  A      E  + H  +          +  +  
Sbjct: 311 QEQYINNIDNIIKMEPYGWTLISSGILSANNLFKKEANNRHRKLMIILSDGVDTYQDNFL 370

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ------DLLRKCTDSSGQFFA 369
            +       TL    +CE + ++G+++  +A++  P+           R+C      ++ 
Sbjct: 371 PNKGLFISKTLVEKGMCERVISSGIQMAFIAIAYSPDDDVNEPEYINWRQCVGKD-NYYE 429

Query: 370 VNDSREL-LESFDKITDKIQEQSVRIAPNR 398
            +++ EL  +    I+     +  R  P +
Sbjct: 430 AHNADELMRDIQQAISKSATSEVGRNTPKK 459


>gi|320156062|ref|YP_004188441.1| hypothetical protein VVM_02402 [Vibrio vulnificus MO6-24/O]
 gi|319931374|gb|ADV86238.1| hypothetical protein VVMO6_01216 [Vibrio vulnificus MO6-24/O]
          Length = 465

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/456 (11%), Positives = 128/456 (28%), Gaps = 69/456 (15%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             +++    +F  +  D+  I  + NQ+ +A DAA L+         +        + TS
Sbjct: 12  MLVLLMSMLVFAAWVTDVMRIYSVHNQIANATDAA-LASAIISEVPESTAVELLHANLTS 70

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT-------KDKNNPLQYIAESKAQYEIP 114
                 +++         +          +  +                   S  + EI 
Sbjct: 71  GAASPYVEEVRLTHLRDEQEESLQVALDFVPNSLNIAAQESVPIRTNAKAGISSNKAEIV 130

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                   +    +           ++       +   V+ +  +  ++      +    
Sbjct: 131 FMLDVSNSMSGEPMNKTKEALLAFADKLYARGNRNQNYVVSIVPASGNVNTGPMEEIYLG 190

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE------------------- 215
           +  +Y      +++ WS    K+       P  ++  +  +                   
Sbjct: 191 SFRRYDHAQVKRENRWSDMFDKASGRTPAVPGRQRNAMCRDLDFEGNNPATLGLRYFRNL 250

Query: 216 ---------------------SAGNL-----VNSIQKAIQEKKNLSVRIG---TIAYNIG 246
                                +  +      ++          N          I  +I 
Sbjct: 251 EKAPQFASNNSKRIIRPIHKPAVLHFDDGTPLDPPVYPSTNPSNNYRPFHEDKAIFDDIE 310

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT-------- 298
              N   P        +S + +L P  NTN    M  A R L    +   +         
Sbjct: 311 CHVNPIVPFITERRHFESTVQRLVPGMNTNNAEGMVWAMRLLSPYWQGIWDKTRPELPRR 370

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN--AGMKIYSVAVSAPPEGQDL 356
                  K+++  +DG +    A+++      IC  ++    G+K+ +V        + L
Sbjct: 371 YSDETSNKYLVMFSDGNHLIDPAFRDKK-MKLICTQLKQPGRGVKVMTVNFG-GAASERL 428

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           ++ C     +++ V     + + F++I +++   S+
Sbjct: 429 MQSCASGP-EYYHVASLFSVEKVFEQIAEQVISSSL 463


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 86/420 (20%), Positives = 159/420 (37%), Gaps = 62/420 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIK--------- 51
           + A+ +    L I + I +    Y +N M+SA +AA+L+G + +VS+ +           
Sbjct: 25  IFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISN 84

Query: 52  -DPTTKKDQTSTIFKKQIKKHLK--QGSYIRENAGDIAQKAQINIT-------KDKNNPL 101
                  D      K  IK+ L      +      +I   ++I++T          NN +
Sbjct: 85  HAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTI 144

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
            Y  +    Y+   + +            +S     +     E     I +V+D+S SM 
Sbjct: 145 FYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMH 204

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                   D N+                                   K+  L  +    +
Sbjct: 205 CAMNSDPEDVNSAPI-------------------------CQDKKRTKMAALKNALLLFL 239

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTY 278
           +SI           V +G I Y   +  N     S    +V+  + +       + T++ 
Sbjct: 240 DSIDL--LSHVKEDVYMGLIGYTTRVEKNIEP--SWGTEKVRQYVTRDMDSLILKPTDST 295

Query: 279 PAMHHAYRELYNEKESS--------HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           PAM  AY+ L ++K+ S           I S   +KF+IF+TDGEN+      + +NT++
Sbjct: 296 PAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFK---SNVNTIK 352

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           IC+  +   +KI +++++A P GQ LL+ C  S    + V ++  L+  F  I+  +  +
Sbjct: 353 ICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHR 412


>gi|159044810|ref|YP_001533604.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
 gi|157912570|gb|ABV94003.1| hypothetical protein Dshi_2267 [Dinoroseobacter shibae DFL 12]
          Length = 553

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/408 (11%), Positives = 97/408 (23%), Gaps = 90/408 (22%)

Query: 1   MTAIII---SVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           +T   +    +  +     IDL     +R ++Q+  D AVL+          +   T  K
Sbjct: 32  LTGFSLYIFILMMMIAGLTIDLMRYEAVRTRLQATSDRAVLAAA-------DLDQTTNAK 84

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                 F K        G  + +       +AQ++ T                       
Sbjct: 85  AVVEDYFAKAGMSQYLDGVQVSKGLNFKEVEAQVSAT---------------------IP 123

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
            +   +      +   RS            I + +VLD+S SM       +         
Sbjct: 124 TWFMNMSGIETLDAFARSKAEERIQ----NIEVSLVLDISGSMGWDGKLANMRTAADQFV 179

Query: 178 KYLLPPPP------KKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQK 226
           + ++                           P     +  V     +           Q 
Sbjct: 180 RTMMAGNDNVAADGTGLTSVSIIPYHAVVNVPDELLDEYAVSTQQTVSNCVRFTATDFQS 239

Query: 227 AIQEKKNLSVRIGTIA------------------YNIGIVGNQCTPLSNNLNEVKSRLNK 268
              ++     R+                      +          P S ++ ++ +++ +
Sbjct: 240 ISIDRTKTLDRLAHFDRNNSNLHTFNGDRLIGRPWCQVGTYGAILPWSTSVTDLTNKVAE 299

Query: 269 LNPYENTNTYPAMHHAYRELYNEKES-----------------SHNTIGSTRLKKFVIFI 311
           L    NT T   M  A   L    ++                            K V+ +
Sbjct: 300 LGASGNTATDIGMKWAAALLDPGTQNIVDDMIDGGHLEADLAGRPVLYSDPETIKVVVLM 359

Query: 312 TDGENSGASAYQNTLNTLQIC----EYMRNAGMKIYSVAVSAPPEGQD 355
           TDGE + +           +     +   ++    Y V          
Sbjct: 360 TDGE-NTSQYDLKNEFKGTMSPVWWDEASDS----YFVYFQNRANNDK 402



 Score = 77.3 bits (188), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL 377
                     T QIC+ ++   + I+++   AP  GQDL+R C  SSG +F V    E+ 
Sbjct: 478 YTGNSTADGYTEQICDQLKAQDVVIFTIGFEAPQRGQDLMRYCASSSGHYFDVEGV-EIS 536

Query: 378 ESFDKITDKIQEQSVRI 394
           E+F  I + IQ+  + +
Sbjct: 537 EAFSSIANTIQQLRLSL 553


>gi|260434111|ref|ZP_05788082.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417939|gb|EEX11198.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 600

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/382 (13%), Positives = 94/382 (24%), Gaps = 78/382 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +T  +I + F+   +A+D+      R ++Q ALD AVL+          +      KD  
Sbjct: 36  LTLFLIMIVFVASGFAVDVMRYDRERAKLQYALDRAVLAAA-------DLDQELCPKDVV 88

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                     +LK+    +   GD   +  +  +           E+ A  +I    +  
Sbjct: 89  ID--------YLKKEGLDKYLTGDPKVEPDVCGSTAAVLKGYRRVEANADMDIE---MHF 137

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                      +  S            + I +VLDVS SM      ++           +
Sbjct: 138 MKWRGIETIASAATSVAEESI----GNVEISLVLDVSGSMRGS-KLENLKKAANLFIDDM 192

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQE----- 230
                           S+    P     K++      +                      
Sbjct: 193 FAKTEDGKVSISIVPYSEQVSIPDYLMNKLNTQGTNSIANCVDFASADFATTRFTAFDVT 252

Query: 231 ----------------------------KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
                                         N  V       N      + T L  +   +
Sbjct: 253 DPVTGIVTPGTTLARTIHHDIGDGSDRRPYNGFVSSTICRPNTSTNHREITILQKDPVAL 312

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKES-----------------SHNTIGSTRLK 305
           K  +N LN    T+           L +  +                    +        
Sbjct: 313 KKEINLLNASGWTSIDVGAKWGVTLLDDSFQPLTKKLVTESKVPSIFKDRPDQNKGYDTM 372

Query: 306 KFVIFITDGENSGASAYQNTLN 327
           K +I +TDGEN+         N
Sbjct: 373 KVMILMTDGENTKQHKVNPPYN 394



 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVN 371
            +   +  +  Q       IC+  ++  + I+S+A  AP   + LL+ C    G ++   
Sbjct: 517 YNTSTTVLNQVQKDPRLTSICQKAKDEKIIIFSIAFDAPDGVKPLLKGCVSDDGAYYEAK 576

Query: 372 DSR-ELLESFDKITDKIQEQSVR 393
           D+  +++  F  I   IQ   + 
Sbjct: 577 DNDKDIISVFSSIGSTIQNLRLT 599


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 82/402 (20%), Positives = 157/402 (39%), Gaps = 31/402 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TAI I V       A+D+ ++    +Q+Q A         A++ +   + +        
Sbjct: 25  LTAIAIPVVAATAGVAVDVTNMTVSNSQLQQAT------DAAALATATALANGNATTSNA 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNP---LQYIAESKAQYEIPTEN 117
             +  + +   +        N  D  +           N      Y     A Y++    
Sbjct: 79  QQLATQFVTGQMSNYLSGDTNTADALKAGTTANVTSATNSSGGTSYTVAVNASYDMSVNG 138

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           +     I +   + +  ST     +++  A+S+ + LD S SM               ++
Sbjct: 139 MSQLLGIKTMHVSAASTSTSGSAAAAKQAALSMEIALDKSGSMLLN------------TD 186

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAP-ANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                      ++++     +Y  A +P   +KI  L  + G L++ +  A  + K+  V
Sbjct: 187 VIDTSQKSCTQYYTEGNYLYQYPKAKSPCYIKKIAALKTAVGTLLDQLDSA--DPKSQYV 244

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSR-LNKLNPYENTNTYPAMHHAYRELYNEKE-S 294
           R   I        +  + L+      +S  ++ LN    T +   M  AY+ +    E +
Sbjct: 245 RTAAI--AWSSEVDSSSALAWGTTTTRSNVISGLNANGGTESSAPMALAYKNVSASSEAT 302

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
           +    G+T  +K ++ +TDGEN+  S+   TL T   C+  ++AG+ IYSVA  AP  GQ
Sbjct: 303 AQAAKGNTTFQKIIVLMTDGENNATSSDTKTLAT---CKAAKDAGVLIYSVAFMAPDRGQ 359

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
            LL+ C  S   +F      +L+ +F  I ++  +Q   +  
Sbjct: 360 TLLKNCASSPSNYFDAQQMSDLIAAFKTIGNQASKQITLLTK 401


>gi|218461471|ref|ZP_03501562.1| von Willebrand factor type A [Rhizobium etli Kim 5]
          Length = 459

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 54/446 (12%), Positives = 122/446 (27%), Gaps = 53/446 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQ---------------SALDAAVLSGCASIV 45
           +  ++     L +  +ID       R ++Q               S +  A ++   +  
Sbjct: 15  IVILVAVPMLLAVGASIDYIRAYNGRTELQAAADSAVLAAAAKYKSGMPEATIAKTINAF 74

Query: 46  SDRTIKDPTTKKDQTSTI---------FKKQIKKHLKQGSYIRENAGDIAQKAQINITKD 96
                +  T    +                 +     + + I+     I   A +   K 
Sbjct: 75  LSANGEFETAVAGKPQVASDESELCLDVADAVPTTFMKLANIQSVPISIRSCAALPGVKQ 134

Query: 97  KNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDV 156
               L     S    E     +           + +       + S    +  +   L  
Sbjct: 135 LEIALVLDVSSSMIEENRFTPMQTAVAGFLQAFSSNTSLVDKTKISIVPFSSRVNFGLAN 194

Query: 157 SRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN----RKIDV 212
           +  ++                        K S+W    T                 + DV
Sbjct: 195 TAWLKSYNGTAAVPKRWTDPESVYTSSGYKLSYWIDGVTPVMSTSKNYYWMGCIEPRADV 254

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
            +   G + + +  A                         TPL+ +   +KS +  L   
Sbjct: 255 EVRDTGAIGDGMGDAPPSTSAFVAMDANPKSGTSFCPPPVTPLTGDFAYLKSVVKNLTSE 314

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRL-----KKFVIFITDGENSGASAYQNTLN 327
            +T     +   +  L  + +       S         K ++F+TDGE +      +  +
Sbjct: 315 GSTRLDAGVVAGWYTLSPKWQGVWGDQSSPAPVSDSVHKVMVFMTDGEMNTKYDPNDKFD 374

Query: 328 TL------------------QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
            +                    C  M+ +G++IY+++ SA  +  ++ R C  ++  FF 
Sbjct: 375 WICSQTQSSACNAFATAARQTACTAMKKSGIEIYTLSYSADADVVNI-RNCATNTAHFFT 433

Query: 370 VNDSRELLESFDKITDKIQEQSVRIA 395
                 +   ++ I   I+  ++R+ 
Sbjct: 434 A-SPATIKTVYETIAAAIRGDTLRLT 458


>gi|254477542|ref|ZP_05090928.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214031785|gb|EEB72620.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 523

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 47/361 (13%), Positives = 77/361 (21%), Gaps = 73/361 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A ++S         IDL  +   R  +Q  LD AVL+          +  P       
Sbjct: 6   MIAFLLS-MVAVGGIGIDLMRMERDRTILQYTLDRAVLAAA-------DLDQPLPPDVVV 57

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K       Q        G    ++ I+ T +                        
Sbjct: 58  QDYLNKANLSEYYQPPIAETGIGYKRVESTIDTTFETQW--------------------- 96

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                     L   S            + I +VLDVS SM       +  N        +
Sbjct: 97  LDFSGGQDMPLYANSRAEESI----DGLEISLVLDVSGSMNSNSRLYNLKNAARDFIDTM 152

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLS 235
           +               +     P     + +V                            
Sbjct: 153 VANTADNKMSVSIVPYATQVSLPKDMLDQYNVTDEHEYSNCVNFTGTHFTSTGLSTTASL 212

Query: 236 VRIGTIAYNIGI-----------------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            R                              +  P   + N +K  +  L  + NT+  
Sbjct: 213 NRTMHFTPWWSGDARPSNGLIQYPVCDERAHREVMPFQKDANRLKDFIQNLQAWGNTSID 272

Query: 279 PAMHHAYRELYNEKES------------------SHNTIGSTRLKKFVIFITDGENSGAS 320
             M      L    +                          T   K ++ +TDG+N+   
Sbjct: 273 VGMKWGTVLLDPSAQPVISALTSSSVNVPGVFADRPAAYNDTETVKVIVLMTDGQNTSQY 332

Query: 321 A 321
            
Sbjct: 333 Y 333



 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/410 (10%), Positives = 98/410 (23%), Gaps = 59/410 (14%)

Query: 20  AHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
           + +  ++N  +  +D                 D            +  + K +     + 
Sbjct: 136 SRLYNLKNAARDFID----------TMVANTADNKMSVSIVPYATQVSLPKDMLDQYNVT 185

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
           +          +N T            +     +     +     PS             
Sbjct: 186 DEHEY---SNCVNFTGTHFTSTGLSTTASLNRTMHFTPWWSGDARPSNGLIQYPVCDERA 242

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKS-FWSKNTTKSK 198
            R           + D  ++++       +      +        P  S   S +     
Sbjct: 243 HREVMPFQKDANRLKDFIQNLQAWGNTSIDVGMKWGTVLLDPSAQPVISALTSSSVNVPG 302

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  A    + +                 + +       + YN     ++    + N
Sbjct: 303 VFADRPAAYNDTETVKVIVLMTDGQNTSQYYVESDHRGGNAPVFYNSAASSDKARYSTYN 362

Query: 259 LNEVKSRLNKLN-----PYE------------------NTNTY------------PAMHH 283
               +   +K+N      Y                    T                ++ +
Sbjct: 363 PGNQRYYWDKMNRWEDHAYGQGEYRECGYYNCWWQDEQGTPATVTQLTHAELFARTSLRY 422

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
            Y+ L+ +   +     S            G             T  IC+  +  G+ +Y
Sbjct: 423 VYQRLFADWMGNSAAKNSWYY---------GVYDSWGTSTKNARTKAICDAAKARGIVVY 473

Query: 344 SVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++   AP  G  +L+ C  S   +F V    E+ ++F  I   I++  + 
Sbjct: 474 TIGFEAPSGGVSVLKDCASSDAHYFDVQGL-EISDAFASIATSIRQLRLT 522


>gi|260466792|ref|ZP_05812977.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029404|gb|EEW30695.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 492

 Score =  120 bits (299), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/463 (9%), Positives = 117/463 (25%), Gaps = 74/463 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +     SV  L   ++++++ +   ++ +Q  +DAAV S    + +    +       + 
Sbjct: 25  LFGFAASVLALAAGFSVNISQLYNAKSSLQGVVDAAVTSTARDLTTGVIKEADADNSVKA 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNP-------------------- 100
             +              + +   D   K                                
Sbjct: 85  FLVANSAAGILQPDQVVLDKLIVDKTAKTVQANVHVDVALYFPLFGIGDMQRVAASTTAL 144

Query: 101 -LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS 159
                 E     +I         +        + R+       +++       V  V  +
Sbjct: 145 YSDKTVEVAMMLDITGSMAKRGNVDKIGDLRAAARNAVQTMLQNQDPKRPRIRVAIVPYA 204

Query: 160 MEDLY---------LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
                           + +      +   LL     K+     +       A  P     
Sbjct: 205 SGVNAGKLAENVYAETQGSSELPPVAGSSLLVAKTGKALLPSFSDYISIVGAAMPHPDNC 264

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG-----------IVGNQCTPLSNNL 259
               ++     +         +         A                   +  PL+ + 
Sbjct: 265 TTERKNKNGDADLSADGPDTVRTDRNGKKYYALVNRDDHLDGGGMNRCPDAEVIPLTADS 324

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT---------IGSTRLKKFVIF 310
           + +   ++       T    A+   Y  L  +  ++              + ++ K  I 
Sbjct: 325 DALLDSIDDFRAAGYTAGAIAIQWTYYMLSPQWRAAIKNVGLGNGASDANAKKIAKVAIL 384

Query: 311 ITDGENS----------GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG------- 353
           +TDG+ +                   N   +C  M+N G++I+++      +        
Sbjct: 385 MTDGQFNTAFAGAGGSYNGQGDLARGNAEALCGNMKNDGIEIFTIGFDLNDKDMSATERD 444

Query: 354 --QDLLRKCTDSSG-----QFFAVNDSRELLESFDKITDKIQE 389
             + +L+ C+          +F  +   EL  +F +I    ++
Sbjct: 445 QAKAVLKGCSSKDASAAERHYFEASTGAELDAAFQEIIRNTEK 487


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 77/387 (19%), Positives = 163/387 (42%), Gaps = 54/387 (13%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           AII  +  + +    ++++I   + ++Q+ +D A+L    +++  + I+D        +T
Sbjct: 22  AIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALL-DTVTMIKLKNIEDVVKNVGPVNT 80

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
           I+ K +K  L+   +  +    I   +     +  +N       + +QY++P +   +  
Sbjct: 81  IWTKNLKYELEHSDFSSDVQNVIDDTSMK--LESDSNFKTLSITAISQYKMPFKICNIHL 138

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLP 182
           L P          + +    +E   I + +VLDVS SM+D +               + P
Sbjct: 139 LCPKNKYVTVPVLSSMKIGRNEGSDIDLMIVLDVSSSMDDNF---------------MKP 183

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA 242
                S                    +++V  +S   ++   +K          R G++ 
Sbjct: 184 EEAPCS--------------------RLEVAKKSIRKMLEDFRKVPNYANVF--RTGSVG 221

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
           +N   +     PL   L  + + + K   + +TN+Y  M +A+ +LY   +       + 
Sbjct: 222 FND--MVQFPMPLKRGLKRIYNDIKKYRAFGSTNSYVGMKYAWEQLYGNPQ------DTK 273

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362
             KK VIF+TDGEN        T  T+++C  M+     IYS+A++     +++L+ C+ 
Sbjct: 274 DRKKIVIFLTDGEN---MIINATRKTIELCNDMKKKKAVIYSIALAVD--NKEVLQGCSS 328

Query: 363 SSGQFFAVNDSRELLESFDKITDKIQE 389
           S G  +A +D++ L++++  I   + +
Sbjct: 329 S-GNVYAADDAQSLVQAYSLIGKDVMK 354


>gi|254472518|ref|ZP_05085918.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958801|gb|EEA94001.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 479

 Score =  119 bits (298), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 55/465 (11%), Positives = 130/465 (27%), Gaps = 90/465 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  +F   AID       R  +            A   +   + +  +  + +
Sbjct: 30  LVAFLMVLLIVFAGMAIDFGLGFNTRRAVNQ----------ALDAAVLAVANKLSTTELS 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S      I ++ ++          +  K  +      +        +     +P   L  
Sbjct: 80  SNTVDSLIDQYFEENLKNSVGGDVVHTKPVVTYDPKGDTVAATATATVKTSFLPVLKLLN 139

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                     ++  ST    ++   +A+ + +   +S S+            +      L
Sbjct: 140 SESGDFGELTVTSSSTARFPKTKVEVAVVVDVTGSMSGSIGS------LKTASRDMLDTL 193

Query: 181 LPPPPKKSFW---SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN---- 233
           LP    +            +          RK        G +   ++      +N    
Sbjct: 194 LPDDNTRLQSRVRISYVPYNVGVKLDKTLARKATFEKSQYGCVHARVRDLAYSGENHDYE 253

Query: 234 -----LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                  V      Y+      Q  PL+N+  +++S +N L     T     +   +  L
Sbjct: 254 DEDDDERVDYIGTNYSW-CPNAQMVPLTNDRTKIESSINALRASSATAGQIGIAWGWYTL 312

Query: 289 ---------------------------------YNEKESSHNTIGSTRLKKFVIFITDGE 315
                                            +N   ++  +      KK +   +D +
Sbjct: 313 SPEWRGFWPTESKPDFYDNNGVRKYAVLMTDGSFNAYYAADYSKADAEHKKLIKNKSDVQ 372

Query: 316 NSGASAYQNTLNT----------------------------LQICEYMRNAGMKIYSVAV 347
           NS        L+                               +C+ M+   + IY+V  
Sbjct: 373 NSQDPMDSGKLDADDHKKIASKVKWEYDYSSSLSGVPFKTASNLCKNMKKEDIVIYTVFF 432

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +  +G+ ++ +C  +S  F+   +   L+++F  I + I+   +
Sbjct: 433 GSDYKGKKIMEECASNSETFYHATNQSALIQAFSSIANDIKSIYL 477


>gi|311234271|gb|ADP87125.1| Protein of unknown function DUF2134, membrane [Desulfovibrio
           vulgaris RCH1]
          Length = 440

 Score =  119 bits (298), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 50/419 (11%), Positives = 123/419 (29%), Gaps = 74/419 (17%)

Query: 17  IDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           ID   +    +++Q+A+DAA L+G   +  D  +               + +  +  + S
Sbjct: 54  IDSGMLYLSHSRLQAAVDAAALAGSLQLPYDPQLDKG-----LVRGAVTQYMDANYPEAS 108

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST 136
                 G   +                           T        +    + +  ++T
Sbjct: 109 LNGVTPGTEERSVT-------------------VTATATVPTIFMNALGIGSSEVHAKAT 149

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
               +      + +  V+D S SM+   +Q+ N   +      +               +
Sbjct: 150 AGYNK------LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFR 203

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCT 253
            K    PA  +   D    + G L  S       K +     G+   +  N      +  
Sbjct: 204 GK-VHLPAGVDGLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQ 262

Query: 254 PLSNNLNEVKSRL---NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
            L+ +   + + +   N L     T     +      L  E   +  +  +  ++K +I 
Sbjct: 263 GLTEDRETILTAISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEGS-SAKDIRKVIIV 321

Query: 311 ITDGENSGASAYQN-------------------------------TLNTLQICEYMRNAG 339
           +TDG+        +                                   L+     + AG
Sbjct: 322 LTDGDTEDGKCGGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKAKEAG 381

Query: 340 MKIYSVAVS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++++++    +      L++        ++  ++    + ++ + F KI  ++  + +R
Sbjct: 382 IEVFAIRFGDSDSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 440


>gi|86747937|ref|YP_484433.1| hypothetical protein RPB_0811 [Rhodopseudomonas palustris HaA2]
 gi|86570965|gb|ABD05522.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 435

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 67/433 (15%), Positives = 132/433 (30%), Gaps = 73/433 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID A    IR ++QSA DAAVL   ++   +RT        +Q 
Sbjct: 28  IFAIALLPILGFIGAAIDYATANRIRTKLQSAQDAAVLLAVSNSEINRTTAQAKADAEQF 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                            + EN G  +  A    T                          
Sbjct: 88  FNATIGAYGLTATIKIEVTENDGKRSATADFTSTVT---------------------TNF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             LI      +  RST  + R    +     ++LD S SM               ++   
Sbjct: 127 LNLIGYPTLAIGNRSTSTVSR---PIYQDFYLLLDNSPSMGVAATTADIATMVGNTSDKC 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR-IG 239
                  S  +     +K          +IDV+ ++   L ++            +    
Sbjct: 184 AFACHDLSDSNNYYNLAK----KLGVKMRIDVVRQAVQQLTSTATLMTAVNNQFRMAVYT 239

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHHAYRELYNEKE 293
                  +       LS+ ++ V++    ++         N +     + A   +     
Sbjct: 240 LGGSCASLGLTTIASLSSAMSSVQTAAGAIDLMSIPKQNYNNDQCTDFNSALAAMNTTIP 299

Query: 294 SSHNTIGSTRLKKFVIFITDG-----------ENSGASAYQNTLNTLQICEYMRNAGMKI 342
           SS     +   +K++ F++DG           + + +        T+  C+ M++ G++I
Sbjct: 300 SSGTGTAAQ-PQKWLFFVSDGVADFNNPSGCTQPTVSGGRCQEPLTVTQCKAMKDRGIQI 358

Query: 343 ---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDSRELL 377
              Y+  ++ P                            ++ C      +F V+ ++ + 
Sbjct: 359 AVLYTTYLALPTNQWYNDHIAPFNAGPYGPSVNSQIAAKMKSCAS-PDFYFEVSPTQGIS 417

Query: 378 ESFDKITDKIQEQ 390
           E+ D +  K   +
Sbjct: 418 EAMDALFKKAVAK 430


>gi|315498202|ref|YP_004087006.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416214|gb|ADU12855.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 489

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 59/486 (12%), Positives = 123/486 (25%), Gaps = 117/486 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  +  S+  + +  A+D ++++  R++ Q ALDAA L+                  +Q 
Sbjct: 17  MFGLFFSILIVSMAGAVDYSNVISRRSKAQDALDAATLAVAVLRP---------ATVEQA 67

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               K ++ K L           D     Q N          Y   +K  Y+     +  
Sbjct: 68  QAAVKLRLDKELGDNP-------DKVVIGQFNY---DTKTRTYYVTAKGTYKPFLLGVVN 117

Query: 121 KGLIPSALTNLSLRSTG---------IIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
              IP  + + ++++               S   +       LDV ++     +     +
Sbjct: 118 IKEIPYEVISETIQAANGTLELALVLDNTDSMGQILNGSSTRLDVLKTAATNLVNTVMTS 177

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAP----------------------APAPANRK 209
            N    K  + P               +                                
Sbjct: 178 ANKDYVKVAVVPYADYVNVGLANRSQSWVSVGADYTVPAAAKTCTTISTKQVCTGGVYGT 237

Query: 210 IDVLIESA------GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV--------------- 248
            D + +             +                   Y                    
Sbjct: 238 CDSIKDGVPIKVGCWKTPQTCTTVNITPYQSCNNPQPTYYKWYGCVRHQVDSKTKMLVLP 297

Query: 249 ----------------GNQCTPLSNNLNEVKSRLNKLNPYEN-----TNTYPAMHHAYRE 287
                                PLSN+   V + +  L          T     +H     
Sbjct: 298 DPLTAYTGVLETAQKCPTAIQPLSNDKTVVTNSIKGLVNSIGSYKPDTFIPGGLHWGVNT 357

Query: 288 LYNEKE---SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ-------------- 330
           L               +   KK ++ +TDG N+  +     + +                
Sbjct: 358 LSPPAPFKEGMAYDSKNKEPKKVIVLMTDGANTLYTNSSGQIVSAATGSPPTISSSLVAP 417

Query: 331 -------ICEYMRNAGMKIYSVAVS-APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
                   C+Y +   ++++ + +    P     L+ C   +  +F   ++ +L+E+F+ 
Sbjct: 418 TYTAQDNACKYAKGKNIEVFVIGLGVTDPTALSALKSCATDAQHYFDAQNANDLIEAFEI 477

Query: 383 ITDKIQ 388
           I  K+ 
Sbjct: 478 IGGKLS 483


>gi|260778153|ref|ZP_05887046.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606166|gb|EEX32451.1| hypothetical protein VIC_003555 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 397

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/392 (13%), Positives = 125/392 (31%), Gaps = 27/392 (6%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              ++    +     I +   + + ++   A+DAA L+   +  SD ++           
Sbjct: 13  FLALLIPLVVLSAATIMIGFQVQLSSRAMQAVDAASLACAFADYSDPSVNQA-------- 64

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                   ++ +    + ++    A   ++N+          +  ++A Y   + ++   
Sbjct: 65  ------YLEYYQPNVKLVKSEIYSASGCELNMGYQLTGLFSSLKFAQASYSAQSGSVEQA 118

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            +  SA    +  +  +   SS   +I     +           Q +   +   +    +
Sbjct: 119 HVNQSASVTPTEMTLVLDISSSMAGSIDTLKSILTRAIER--IEQDNVQIDGRRAISISI 176

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
            P                         K           V ++ +   EK  +S R    
Sbjct: 177 VPFSDGVSARNADWLDDKGVFCIDGLTKESGGSVLVNETVQNLDRIHSEK-AVSHRAPDE 235

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT-IG 300
                       PL++N++EVK+ +N L     T +Y  +    R+L             
Sbjct: 236 FLADCSASATLVPLTDNMSEVKTAINALTTTGGTRSYQGVIWGARQLIPRWRQEWGYNPY 295

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEY-MRNAGMKIYSVAVSAPPEGQDLLRK 359
           S   K+ +I +TDG    +    + L    +C+       +++  +  +         + 
Sbjct: 296 SLAPKQKLILMTDGV--DSGYVLDDLIDAGLCDRLANEFAIELNFIGFNVQDSRLAQFQS 353

Query: 360 C---TDSS---GQFFAVNDSRELLESFDKITD 385
           C    ++    GQ F+  ++ +L E F KI +
Sbjct: 354 CINAANTDGIKGQVFSATNTEKLDEYFSKILE 385


>gi|91975399|ref|YP_568058.1| hypothetical protein RPD_0919 [Rhodopseudomonas palustris BisB5]
 gi|91681855|gb|ABE38157.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 435

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 63/433 (14%), Positives = 136/433 (31%), Gaps = 73/433 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  A+D  +   +R +++SA DAAVL   ++   ++T+ D      Q 
Sbjct: 28  IFAIALLPILGFIGAAVDYTNASRVRAKLESAQDAAVLLAVSNSAINKTVADAQADAVQF 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                            + EN G                       S       +     
Sbjct: 88  FNATLDGYGLSATIDLSVSENDGK---------------------RSAVSSFSSSVKTHF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +I      +  RST  +      + +   ++LD S SM               ++   
Sbjct: 127 LDMIGYPTLAIGNRSTSTVSL---PVYVDFYLLLDNSPSMGVAATTSDIATMVANTSDQC 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  S  +     +K          +IDV+ ++   L  +            + + T
Sbjct: 184 AFACHDLSTSNNYYNLAK----KLGVTMRIDVVRQAVQRLTTTATAMSAVTNQFRMGVYT 239

Query: 241 I-AYNIGIVGNQCTPLSNNLNEVKSRLNKLNP------YENTNTYPAMHHAYRELYNEKE 293
             +    I       LS++++ V++ +  ++         N +       +   + +   
Sbjct: 240 FGSSCTAIGLTTVANLSSSMSSVQTSVGTIDLMTIPYQGYNNDQCTDFDGSLTAINSAIP 299

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-----------TLQICEYMRNAGMKI 342
            S  +  ST+ +K++ F++DG          T             T+  C  +++ G++I
Sbjct: 300 -SPGSGISTQPQKWLFFVSDGVADANYPSTCTKPTVSGGRCQEPLTVAQCTAIKSRGIQI 358

Query: 343 ---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDSRELL 377
              Y+  ++ P                            ++ C    G +F V+ ++ + 
Sbjct: 359 AVLYTTYLALPTNSWYNTYIAPFNPGPYGPSTNSQIAANMQSCAS-PGFYFEVSPTQGIA 417

Query: 378 ESFDKITDKIQEQ 390
           E+ D +  K   +
Sbjct: 418 EAMDALFKKAVAK 430


>gi|59711129|ref|YP_203905.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59479230|gb|AAW85017.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 465

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/469 (10%), Positives = 131/469 (27%), Gaps = 94/469 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I V F   T A D A  +  + +++ A +AAVL+  A             + + +
Sbjct: 16  LFVMCIPVLFGVFTLASDGARALQSKARLEDAAEAAVLAVSA----------YGEEDEVS 65

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN---PLQYIAESKAQYEIPTEN 117
           +   K  +  ++   S + +   +  + +++      +N    ++Y    + +++     
Sbjct: 66  TQTGKDYVAHYMHDMSNLVDIEVEKLECSELPECTADDNDRPFVEYQVSGRTKHKSWFPG 125

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM--- 174
             +      +     +       +   +  + I  +LD S SM   +             
Sbjct: 126 NDVTVGFGES---FDVTGMSKARKFQSSQPMDITFILDFSGSMNYDWEGHAPSYMEEEVP 182

Query: 175 -------------TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                             +     +   ++ +TT  K+  A    NR+      +   ++
Sbjct: 183 KVPGRYSPPSRLSDLKDVVQMVTDELQVYNNSTTGPKHRVAMTGYNRRTVNESSNGKFVI 242

Query: 222 NS-----IQKAIQEKKNLSVRIG-------------TIAYNIGIVGNQCTPLSNNLNEVK 263
                        +  +                    +              +++     
Sbjct: 243 RDQRITKYNSDGYDAGDKFYPKKTINKQFMVKGAAARVPNGDEKAEFTDIMYTSDFASFN 302

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAY 322
            ++     +  T +   +  A + +     +          K+ +I ++DG + +     
Sbjct: 303 HKIKSFEAFGGTASLQGIIRASQIVSYHITNDGEEAN---PKQLIIILSDGEDFNHYLGQ 359

Query: 323 QNTLNTLQICEYMRNA----------------------------------GMKIYSVAV- 347
             TL    +C+ +RNA                                   ++I  +   
Sbjct: 360 TETLVDYGMCDNLRNAIEGGPVSSEDNKADKIVFSSGSSSGLPTNTGEDPSVRIAMIGFG 419

Query: 348 -SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                     L  C       F+ N+  E+    + I   + E+   +A
Sbjct: 420 DGYDIHANTGLLNCV-GEENAFSANNKDEI---LNLIMSLVSEEVGHLA 464


>gi|46580532|ref|YP_011340.1| von Willebrand factor type A domain-containing protein
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|46449951|gb|AAS96600.1| von Willebrand factor type A domain protein [Desulfovibrio vulgaris
           str. Hildenborough]
          Length = 420

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/419 (11%), Positives = 123/419 (29%), Gaps = 74/419 (17%)

Query: 17  IDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           ID   +    +++Q+A+DAA L+G   +  D  +               + +  +  + S
Sbjct: 34  IDSGMLYLSHSRLQAAVDAAALAGSLQLPYDPQLDKG-----LVRGAVTQYMDANYPEAS 88

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST 136
                 G   +                           T        +    + +  ++T
Sbjct: 89  LNGVTPGTEERSVT-------------------VTATATVPTIFMNALGIGSSEVHAKAT 129

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
               +      + +  V+D S SM+   +Q+ N   +      +               +
Sbjct: 130 AGYNK------LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFR 183

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCT 253
            K    PA  +   D    + G L  S       K +     G+   +  N      +  
Sbjct: 184 GK-VHLPAGVDGLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQ 242

Query: 254 PLSNNLNEVKSRL---NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
            L+ +   + + +   N L     T     +      L  E   +  +  +  ++K +I 
Sbjct: 243 GLTEDRETILTAISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEGS-SAKDIRKVIIV 301

Query: 311 ITDGENSGASAYQN-------------------------------TLNTLQICEYMRNAG 339
           +TDG+        +                                   L+     + AG
Sbjct: 302 LTDGDTEDGKCGGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKAKEAG 361

Query: 340 MKIYSVAVS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++++++    +      L++        ++  ++    + ++ + F KI  ++  + +R
Sbjct: 362 IEVFAIRFGDSDSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 420


>gi|328541712|ref|YP_004301821.1| hypothetical protein SL003B_0088 [polymorphum gilvum SL003B-26A1]
 gi|326411464|gb|ADZ68527.1| hypothetical protein SL003B_0088 [Polymorphum gilvum SL003B-26A1]
          Length = 454

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 56/448 (12%), Positives = 129/448 (28%), Gaps = 78/448 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  +++++  +     +D    + +R  +  AL        A +   R +        + 
Sbjct: 27  MVGVLVALMVVIGGAGLDYGRAIMLRASISHAL------DAAVLAVARQLSVSIMTDSEL 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               K     ++          GD+      +              + A   +PT  + +
Sbjct: 81  DKAIKDAFAANMASAGLSGATLGDLTYVLDPDAG---------TISATATALVPTYFIHV 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL P      ++      + +     + + MV+DV+ SM +            +    L
Sbjct: 132 GGLGPE-----NVAIAASADATYSRFDVELAMVVDVTGSMRNSM--ASLRTAAQSVVDIL 184

Query: 181 LPPPPKKS----FWSKNTTKSKYA--PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           +P   KKS      +                 +             + + +         
Sbjct: 185 IPDGTKKSASKVRIALVPYSQGVNLGEYAPKVSNGDAGTQNCVTERMGNEKYTDATYNYN 244

Query: 235 SVRIGTIAYNIGIVGNQCT--PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                          +     PL++  N + S ++KL     T     +   +  L  + 
Sbjct: 245 GTSSEFFGGGSNSCASTPQMEPLTSKRNTLTSAISKLKDNGRTAGQTGIAWGWYALSPKW 304

Query: 293 ES------SHNTIGSTRLKKFVIFITDGENS----------------------------- 317
            +         +   + + KF + +TDG+ +                             
Sbjct: 305 SNLWPNDSVPGSYTDSDILKFALIMTDGDFNEYYDKATAQSNCKWQFNWSTFKWEQVCDS 364

Query: 318 ----------GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE--GQDLLRKCT-DSS 364
                        +  ++     +C  ++  G+++YS+   +     G  +++ C   + 
Sbjct: 365 SYVWTAYSEAAGYSNVSSTRAKTLCAAIKQTGIQVYSIYFGSNANSAGAKVMKDCASSTK 424

Query: 365 GQFFAVNDSRELLESFDKITDKIQEQSV 392
             FF      EL+ +F KI +KIQ   +
Sbjct: 425 ETFFMATSDSELIAAFAKIANKIQNIYL 452


>gi|99081991|ref|YP_614145.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
 gi|99038271|gb|ABF64883.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
          Length = 582

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/370 (12%), Positives = 90/370 (24%), Gaps = 64/370 (17%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           +I+ + F+     +D+  +   R ++Q  LD AVL+       D+ +       D  S  
Sbjct: 41  MIVVLMFMIGGLGMDMVRLERDRTKLQYTLDRAVLAAADL---DQPLDPEAVVLDYMSKS 97

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
                   +             +       +   N        +   Y++    L L   
Sbjct: 98  GLGDYTTVVVPEVSPTAKRVKASVDTNFTASWMNNVFYDDYIRNPDTYQLEPITLPLL-- 155

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                                   + I +VLDVS SM       +         + +   
Sbjct: 156 -------------ASSTAVESIGNVEISLVLDVSGSMRSNDRLVNLKRAAKEFVQTMDDN 202

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLSVRI 238
                        S     P     +++V              +    A         R 
Sbjct: 203 TEDGKMSISIVPYSTQVSMPEAFLDELNVSSEHDYSHCINFSGSDFNNAGISTTQAYERT 262

Query: 239 GTIAYNI--------------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
                                               LS+N+ ++++ ++   P ENT+  
Sbjct: 263 MHFTVWNSGDYRSRTRLVRQPTCAAHSDNPERTALLLSDNVTQLQNYIDAFVPSENTSID 322

Query: 279 PAMHHAYRELYNE---------------------KESSHNTIGSTRLKKFVIFITDGENS 317
             M      L                          +       T   K ++ +TDG+N+
Sbjct: 323 LGMKWGSALLDPSVQPVIASLADDANPNQSIASRFANRPVPYTDTETLKVIVMMTDGQNT 382

Query: 318 GASAYQNTLN 327
                +N+  
Sbjct: 383 SQYYLRNSYR 392



 Score = 80.3 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 74/227 (32%), Gaps = 14/227 (6%)

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
           D   +     +        ++ +N+ +   +P    A  +         +  +  + +  
Sbjct: 366 DTETLKVIVMMTDGQNTSQYYLRNSYREGDSPVWYNAQER-------VYSTYDPNRGSKP 418

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
              +   R     Y  G         +                       A+  +Y +L+
Sbjct: 419 YYWDNLQRWADHPYGNGTYEETYCTGTLYYGNCYY--GSWQTRTVDEPGTAVQLSYPDLF 476

Query: 290 NEKESSH---NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            +    +      G         + +   +S  S       TL ICE  +  G+ ++++ 
Sbjct: 477 ADTSLRYLRDRLFGDWMSNANYYWFSGLFSSVGST-TKDARTLDICEAAKAKGVVVFTIG 535

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             AP  GQ++L+ C  S+  ++ V D  E+ ++F  I   I++  + 
Sbjct: 536 FEAPSRGQEVLQACASSASHYYDV-DGLEISDAFASIASAIRQLRLT 581


>gi|259416688|ref|ZP_05740608.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348127|gb|EEW59904.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 583

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 45/370 (12%), Positives = 88/370 (23%), Gaps = 64/370 (17%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           +I+ + F      +DL  +   R  +Q  LD AVL+       D+ +       D  S  
Sbjct: 41  MILVLMFALGGLGMDLVRMERDRTNLQYTLDRAVLAAADL---DQPLDPEAVVIDYMSKS 97

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
                   +             +   +       +   +    +   YE+    L L   
Sbjct: 98  GLSDYTTVVVPEVSPTAKRVKASVDTEFTAGWMNSIFYEDYMRNPDTYELEPITLPLL-- 155

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                                   + I +VLDVS SM       +         + +   
Sbjct: 156 -------------ASSTAVESIGNVEISLVLDVSGSMRSNNRLVNLKRAAKEFVQTMDDN 202

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKI-----DVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                        S     PA    ++                +              R 
Sbjct: 203 TEDGKMSISIVPYSTQVSMPAAFLDEMRVSDEHSYSNCINFDGSDFNTTGLNLSREYERT 262

Query: 239 GTIAYNIGI--------------------VGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
              +                                +S+N+ +++S ++     ENT+  
Sbjct: 263 MHFSVWNYYDYRDDDEHVRQPTCASDADNPERTALLMSDNVAQLQSYIDAFEHSENTSID 322

Query: 279 PAMHHAYRELYNEKE---------------------SSHNTIGSTRLKKFVIFITDGENS 317
             M      L    +                     +   +   T   K ++ +TDG+N+
Sbjct: 323 LGMKWGTALLDPSVQPVIATLANDANPNQSIEARYANRPVSYQDTETLKVIVMMTDGQNT 382

Query: 318 GASAYQNTLN 327
                +N   
Sbjct: 383 AQYYIKNDYR 392



 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/236 (12%), Positives = 72/236 (30%), Gaps = 25/236 (10%)

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKN--------TTKSKYAPAPAPANRKIDVLIESAG 218
            + D   +     +        ++ KN           +      +  +       +   
Sbjct: 363 SYQDTETLKVIVMMTDGQNTAQYYIKNDYREGLTPVWYNSEENVYSTYDPNRYGSDKYYW 422

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
           +     +                    G   +     S     V      L         
Sbjct: 423 HQTGQWEDHPYGNGTYQETYCDGREYYGRCYDG----SWKTRTVDEPGEALQLSYADLFA 478

Query: 279 -PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
             ++ + YR+L+ +  S+ +        +   ++ D              TL +C+  + 
Sbjct: 479 ETSLRYLYRDLFGDWMSNASWY---WYNRLYSYVGD--------STKDSRTLAVCDAAKE 527

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            G+ ++++   AP  GQ +L++C  S+  ++ V D  E+ ++F  I   I++  + 
Sbjct: 528 KGIVVFTIGFEAPWRGQQVLQQCASSASHYYDV-DGLEISDAFASIASAIRQLRLT 582


>gi|329848522|ref|ZP_08263550.1| flp pilus assembly protein TadG [Asticcacaulis biprosthecum C19]
 gi|328843585|gb|EGF93154.1| flp pilus assembly protein TadG [Asticcacaulis biprosthecum C19]
          Length = 486

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 54/460 (11%), Positives = 123/460 (26%), Gaps = 67/460 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I      +  AID A +   +   Q ALD+AVL+      S+             
Sbjct: 26  IFGLAIFAIMAALGTAIDFAVLQRAKRSTQDALDSAVLAAAIVNNSNEGDLKKLAADVFK 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKA--------------QINITKDKNNPLQYIAE 106
             +    +   +    Y  +     A                  +      +        
Sbjct: 86  ENLGAADLDAKVTAFKYDAKARTVKATAQGSYDPVIMQLFGFKNLPYAVTSDAIKAADGT 145

Query: 107 SKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ 166
            +    +         +  +   ++   +   +  +         + + V    + + + 
Sbjct: 146 LEVALVLDNTWSMSATVNGTPKIDILKTAAQGLVSTILTKDNKDYVKIAVVPYADYVNVG 205

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNT---------------------TKSKYAPAPAP 205
             N N    S          K+  + +T                     T S +  A   
Sbjct: 206 MANRNMPWVSVAADYSTTSTKTCKTVSTATQCTGGTKGTCTGNQDGVPYTYSCWIVAQTC 265

Query: 206 ANRKIDVLIES----------AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
               +                 G + N +  +     + +   G +        N   PL
Sbjct: 266 KTVNVTPYQSCSGGGTTNYKWYGCVKNQVASSKVVMPDPTTPYGGLVQTSQTCLNPILPL 325

Query: 256 SNNLNEVKSRLNKLNPYEN-----TNTYPAMHHAYRELYNEKE---SSHNTIGSTRLKKF 307
           SN+   V + +  L          T     M      L               +   +K 
Sbjct: 326 SNDATVVTNTIKGLVVNIGGYKPETYIPGGMIWGVNALTPPAPFTEGKPYDANNKEPRKT 385

Query: 308 VIFITDGENSGASAYQNTLNTLQI-------------CEYMRNAGMKIYSVAVS-APPEG 353
           ++ +TDG N+  +     +                  C+Y ++  ++IY++       + 
Sbjct: 386 IVLMTDGANTLYANTSGGIAVANATQVAVTYSDQIRVCDYAKSKKIEIYTIGFDVTDSKA 445

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
              L+ C   +  +F    S +L+++F+ I  K+ +  + 
Sbjct: 446 LSTLKACATDAQHYFDAKSSADLIKAFETIGGKLSKVRLT 485


>gi|283782262|ref|YP_003373017.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
 gi|283440715|gb|ADB19157.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
          Length = 395

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 50/404 (12%), Positives = 119/404 (29%), Gaps = 60/404 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQS----ALDAAVLSGCASIVSDRTIKDPTTK 56
           + A ++ V      +AID++++  +R+++++    A  A  L+   +   D         
Sbjct: 23  LIAFLLVVVVCMAAFAIDVSYMQLVRSELRAATDAAAKAGTLALAKT-DGDAASARTAAI 81

Query: 57  KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
           +         +          +  +A            +     ++ ++         + 
Sbjct: 82  QAAARNKVAGRALVLTTDQVQVGRSAAQANGTWSFTANQTPYTSVKILSSMSDSTAAGSV 141

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN---NN 173
            LFL   +       +  +T         +   IC+V+D S SM                
Sbjct: 142 PLFLGTFMGRGSFQPAQSATA------SQMEQEICLVIDRSHSMCFNMSGVEWSYPPGTK 195

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
            T +    PP    S W                      L  S    +++I +     + 
Sbjct: 196 TTPHTICYPPHATLSRW--------------------AALQSSVNLFMDTILETNNTPRV 235

Query: 234 LSVRI----------GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPA 280
             +             +      +       LS +   VKS++           TN    
Sbjct: 236 ALITWGSTIGTNTAEYSYTKKTEVAVANELGLSTDYAAVKSKIAARTTKVMLGGTNMSAG 295

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +      L      +            +I +TDG+ +         + +   E   + G+
Sbjct: 296 IDAGRTLLNGNTVRALAKKT-------MILMTDGQWNQGR------DPIDAAEDAADEGI 342

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +I+++   +      + +    + G+++  ++  EL E+F  + 
Sbjct: 343 QIHTITFLSGSAQNTMRQVAEITGGKYYVSSNQAELEEAFRDLA 386


>gi|170724979|ref|YP_001759005.1| hypothetical protein Swoo_0614 [Shewanella woodyi ATCC 51908]
 gi|169810326|gb|ACA84910.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
          Length = 503

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 51/476 (10%), Positives = 127/476 (26%), Gaps = 99/476 (20%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
             ++   F  +  A++    +  +N++  A +AA L+   +        D   +      
Sbjct: 21  VFLLIPLFGMVFLALEGTRYIQKKNRLGDATEAASLAVSMA-----NRDDKGYETQLAKD 75

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
                ++   +      E   DI      + + +     QY   +K ++     +  +  
Sbjct: 76  YISSYMRNIKEISQVKVERKEDIDHYPMADGSFEDREYTQYRVTAKTEHTSWLHSDLIPS 135

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN----------- 171
              +        +         +  + I  V D S SM+   +    D            
Sbjct: 136 FKETETLANRALARA-YPEYLGDRDVDIVFVSDFSGSMKGSRINSLKDAITEISNEILVP 194

Query: 172 -----------------NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
                              +            +  +   + K+        +    +   
Sbjct: 195 RDGETEIRNRIALVPYNMRVVEGDSGRSVCMTQLKYRNPSGKTGSNYTNYESINWREWAN 254

Query: 215 ESAGNLVNSIQKA--------------------IQEKKNLSVRIGTIAYNIGIVGNQCTP 254
           +S   + + +  +                         +        + N          
Sbjct: 255 KSYNQVSSCVSNSRKCNGLPGPRADARTIKSVVNDAPSSYRSSKWPDSSNWIDYSRSVDQ 314

Query: 255 LSN-NLNEVKSR------------------------------LNKLNPYENTNTYPAMHH 283
           L N N N V+                                +N+++P   T+ Y  +  
Sbjct: 315 LFNENSNNVQHHPSYQRLYSGSMCNGKFWTVPLTNQKSEIMKVNQMSPDGGTSVYQGLLR 374

Query: 284 AYRELYNEKESSHNTIGSTRLK---KFVIFITDG-ENSGASAYQNTLNTLQICEYMRNA- 338
             + L   +  + N           K ++ ++DG E+   S +   +N   +C  +R   
Sbjct: 375 GAQILDKGRPVNPNEEELEEYNKRLKMILILSDGMESPYESTFSKLVNNYGMCNKIRAQF 434

Query: 339 -----GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                 + +  + +     GQ+  + C  +      + D  +L +   +I D I++
Sbjct: 435 NDGELPLHMGVIGIKFSASGQNAFKNCVGADN----IIDVNDLDDLIQEILDLIKK 486


>gi|295691296|ref|YP_003594989.1| TadE family protein [Caulobacter segnis ATCC 21756]
 gi|295433199|gb|ADG12371.1| TadE family protein [Caulobacter segnis ATCC 21756]
          Length = 531

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 56/507 (11%), Positives = 124/507 (24%), Gaps = 116/507 (22%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL-SGCASIVSDRTIKDPTTKKDQT 60
            A++     + +   IDL  I   R+QMQ ALDAA L +  ++ V+D  ++         
Sbjct: 23  FALLAIPMSILVFALIDLGRISLQRHQMQDALDAATLMAARSTAVTDAELESVGDPAFLA 82

Query: 61  STIFKKQI-----------------------------------KKHLKQGSYIRENAGDI 85
                                                        +L   S +  ++ ++
Sbjct: 83  EIAGLNLGLSASNASFKAGAGNHIIGTATATVKPIIANLWTTDDFNLTATSDVVRSSKNL 142

Query: 86  AQKAQINITKDKNNPLQYIAESKAQ---------------YEIPTENLFLKGLIPSALTN 130
                ++IT   +       ++ A                 ++      +   + +    
Sbjct: 143 EVAVVLDITGSMSGSRITDLKTGASDLVDIVVKDQQAPFYSKVAIVPYSVGVNVGTYADA 202

Query: 131 LSLRSTGIIERSSENLAI-------------SICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           +                                  +  VS          +    +  S 
Sbjct: 203 VRGAVIARTITGVSKTNAAVVASAAHGFIVGDKVTISGVSGPTMLNGNTYNITAASADSF 262

Query: 178 KYLLPPPPKKSFWS---------KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
                      + S          N     +    A   ++   L         +     
Sbjct: 263 TINANTSNAPKYVSGGVATCDTSTNPGCLNFTFTSASNTKETRTLSTCVTERTGTYAYTD 322

Query: 229 QEK-------KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAM 281
                        + ++              TPLS++   +K ++N L+   +T      
Sbjct: 323 IAPSIAPVGRNYPTTKLENSMQPNPCPTATITPLSSDRVTLKGQINALSIGGSTAGQIGF 382

Query: 282 HHAYRELYNEK-------ESSHNTIGSTRLKKFVIFITDGENSGA--------------- 319
              +  +                   S  L K V+ +TDG  +                 
Sbjct: 383 AWGWYMVSPNFGYLWPNATQRPAPYNSKDLVKVVVLMTDGAFNTPYCKGVIAKDAGSGSG 442

Query: 320 ----------SAYQNTLNTLQICEYMRNA--GMKIYSVAV--SAPPEGQDLLRKCTDSSG 365
                     +       T ++C+ M++    + I++V           ++L+ C   + 
Sbjct: 443 AVDDHINCVATNGDAFTQTRKLCDAMKDPSLKLTIFTVGFDVGGDANAVNMLKYCATDAQ 502

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSV 392
             +      EL  +F  I  +I    +
Sbjct: 503 HVYFPATGSELKTAFKSIAQEISSLRI 529


>gi|120602151|ref|YP_966551.1| von Willebrand factor type A [Desulfovibrio vulgaris DP4]
 gi|120562380|gb|ABM28124.1| von Willebrand factor, type A [Desulfovibrio vulgaris DP4]
          Length = 420

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/419 (11%), Positives = 124/419 (29%), Gaps = 74/419 (17%)

Query: 17  IDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           ID   +    +++Q+A+DAA L+G   +  D  +               + +  +  + S
Sbjct: 34  IDSGMLYLSHSRLQAAVDAAALAGSLQLPYDPQLDKG-----LVRGAVTQYMDANYPEAS 88

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST 136
                 G   +                           T        +    + +  ++T
Sbjct: 89  LNGVTPGTEERSVT-------------------VTATATVPTIFMNALGIGSSEVHAKAT 129

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
               +      + +  V+D S SM+   +Q+ N   +      +               +
Sbjct: 130 AGYNK------LEVVFVIDNSGSMKGTPIQQTNSAASQLVELIMPEGMMTSVKVGLVPFR 183

Query: 197 SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---IAYNIGIVGNQCT 253
            K    PA  +   D    + G L  S       K +     G+   +  N      +  
Sbjct: 184 GK-VHLPAGVDGLPDGCRNADGTLNPSWLHEEYFKTSYRYPSGSSLNVPKNTCTSIPRVQ 242

Query: 254 PLSNNLNEVKSRL---NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
            L+ +   + + +   N L     T     +      L  E   +  +  +  ++K +I 
Sbjct: 243 GLTEDRETILTAISKQNGLGDASGTVISEGLKWGRHVLTPEAPFTEGS-SAKDIRKVIIV 301

Query: 311 ITDGENSGASAYQN-------------------------------TLNTLQICEYMRNAG 339
           +TDG+        +                                   L+    ++ AG
Sbjct: 302 LTDGDTEDGKCGGSYAINYTPNAYWTNAFYGMLDMTSHCENGGKLNAAMLEEARKVKEAG 361

Query: 340 MKIYSVAVS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++++++    +      L++        ++  ++    + ++ + F KI  ++  + +R
Sbjct: 362 IEVFAIRFGDSDSVDVSLMKSIASSKAGTNDHYYDAPSAYDIDDVFKKIGRQLGWRLLR 420


>gi|32471725|ref|NP_864718.1| hypothetical protein RB2055 [Rhodopirellula baltica SH 1]
 gi|32397096|emb|CAD72400.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 402

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 47/399 (11%), Positives = 126/399 (31%), Gaps = 45/399 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I++ V  +   Y I++A++  +    Q   DAAV +     +               
Sbjct: 43  LLVIMLPVLLILAAYVINVAYVEAVTADSQVVTDAAVCAAGRVYIQTGDKNAALAAARDA 102

Query: 61  ST---IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
           +    +  K +  ++    +       + +        D +     +  +        + 
Sbjct: 103 AERNPVAGKVVPINMSDLEFGISLRESLDEGYSFQPLSDDDEFGNAVRLTTLSLSNSPQP 162

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           +F            +L         S    + + +V+D S SM     +  +   N  + 
Sbjct: 163 VFSPLF---PTMGTNLEIRPQRVAVSTQSTMDVALVIDRSGSMAYANDEAPDPYVNPAAA 219

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                                Y     P +R +D++  S       +  +         +
Sbjct: 220 ----------------PPGWTYGDPVPPNSRWLDLV-ASVNAFNGFLADSP-----QYEK 257

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKES 294
           +    Y+     ++   L++   E+ ++L+ ++       T+    + H    L +   +
Sbjct: 258 LCLATYSDNA--SRDCDLTHTYAEISNQLDAISYQFNGGGTSVGYGLEHGLAVLTDATHA 315

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ 354
                      + ++ +TDG ++   + ++          ++N G+ ++++  S   +  
Sbjct: 316 R------KFAVRVMVLMTDGHHNTGKSPESMTYH------LQNHGVTLFTITFSDDADQS 363

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            +        G+ F   D+ +L  +F KI  K+     +
Sbjct: 364 RMSNLANACGGENFHATDASQLQNAFQKIAKKLPSLMTQ 402


>gi|89055932|ref|YP_511383.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
 gi|88865481|gb|ABD56358.1| hypothetical protein Jann_3441 [Jannaschia sp. CCS1]
          Length = 612

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 45/392 (11%), Positives = 89/392 (22%), Gaps = 67/392 (17%)

Query: 1   MTA---IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           +TA   ++  +       AID+      R+Q+Q  LD AVL+         ++  P   +
Sbjct: 52  ITAFATMLFILMVGASGIAIDVMRYETQRSQLQYTLDRAVLAAA-------SLTQPYDPE 104

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                 F             I    G           + +         + A+ E+    
Sbjct: 105 GVVRDYFA------------IAGIDGYRLD------VRVEEGLNFRRVHAYAELEVR--- 143

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
                +                        I + MVLD+S SM +     +         
Sbjct: 144 SIFMQMFGVRAMTSPAIGAAEERVRR----IEVSMVLDISGSMGENNRMTNMRPAAREFV 199

Query: 178 KYLLPPPPKKSF----WSKNTTKSKYAPAP-----APANRKIDVLIESAGNLVNSIQKAI 228
             +L      +            +                 +                  
Sbjct: 200 TEVLSANENVNNELLVSVSIVPYNGRVNGGDLIESVFTYDDLHSESNCTRFAEADFTSTA 259

Query: 229 QEKKNLSVRIGTIAYNI-------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
            +      RI                            P  +    + + ++ LN    T
Sbjct: 260 IDPAVPLQRIAHWDRGNEEEDESFQWAHCQTDQYGAILPWQHTEAALHAHIDSLNTGGWT 319

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                M+ A   L      +             +  +   +   S              +
Sbjct: 320 AIDLGMNWAVGLLDPAAAPALTG----------LIASGHVHPEFSDRPAPYRDGDRATTI 369

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQF 367
            +  +K+  +        Q  LR   DS+G++
Sbjct: 370 DDETIKVVVLMTDGDNTRQYDLRDIYDSAGRY 401



 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 75/300 (25%), Gaps = 20/300 (6%)

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
            + T       L  +    L   +                   D      D       D+
Sbjct: 312 SLNTGGWTAIDLGMNWAVGLLDPAAAPALTGLIASGHVHPEFSDRPAPYRDGDRATTIDD 371

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAP-----APAPANRKIDVLIESAGNLVNSIQK 226
             +     +      + +  ++   S           AP  R       S          
Sbjct: 372 ETIKVVVLMTDGDNTRQYDLRDIYDSAGRYVGFREGYAPIFRNTSTGQYSIWWEDQGAFW 431

Query: 227 AIQEKKNLSVRIGTIAYN--IGIVGNQCTPLSNNLNEVKSRLNK------LNPY---ENT 275
                            +      G      + +                L      ++T
Sbjct: 432 IPTGNTRDPGGSWQAQPDGGWSRYGMTALEFTEDRANAFDPAEAGNGEVLLWADLFSDHT 491

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI-FITDGENSGASAYQNTLNT--LQIC 332
             Y A    +      ++       +       I + +DG        Q+  +T  + IC
Sbjct: 492 AGYIAAEWFHAPADESEQWDFYNQLAENPSHNYIGWDSDGVRPDGVVGQSQADTNLMAIC 551

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +    AG+ +Y++   AP  GQ ++  C      +F V   RE+ E+F  I   I +  +
Sbjct: 552 DVANAAGIIVYAIGFEAPDRGQRVMEHCASVDANYFDVE-GREISEAFASIARSINQLRL 610


>gi|197335948|ref|YP_002155278.1| hypothetical protein VFMJ11_0524 [Vibrio fischeri MJ11]
 gi|197317438|gb|ACH66885.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 463

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 52/469 (11%), Positives = 125/469 (26%), Gaps = 94/469 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + I V F   T A D A  +  + +++ A +AAVL+  A             + + +
Sbjct: 14  LFVMCIPVLFGVFTLASDGARALQSKARLEDAAEAAVLAVSA----------YGEEDEVS 63

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN---PLQYIAESKAQYEIPTEN 117
           +   K  +  +L   S + +   +  + +++      +N    ++Y    + ++      
Sbjct: 64  TQTGKDYVAHYLHDMSSLVDIKVEKLECSELPECTADDNDRPFVEYQVSGRTKHISWFPG 123

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
             +      +     +  +    +   +  + I  +LD S SM   +             
Sbjct: 124 NDVTVGFGES---FDVTGSSKARKFQSSQPMDITFILDFSGSMNYDWEGHAPSYMEEEIP 180

Query: 178 KYLLPPPPKKSFWS---------------KNTTKSKYAPAPAPANRKIDVLIESAGNL-- 220
           K      P                      N+T             +  V   S G    
Sbjct: 181 KVPGRYSPPSRLSDLKYVVQMVTDELQVYNNSTAGPKHRVAMTGYNRRTVNESSNGKFVI 240

Query: 221 ----VNSIQKAIQEKKNLSVRIG-------------TIAYNIGIVGNQCTPLSNNLNEVK 263
               +        +  +                    +              +++     
Sbjct: 241 RDQRITKYNSDGYDAGDTFYPKKTINKQFMVKGAAARVPNGDEKAEFTDIMYTSDFASFN 300

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAY 322
            ++     +  T +   +  A + +     +          K+ +I ++DG + +     
Sbjct: 301 HKIKSFEAFGGTASLQGIIRASQIVSYHITNDGEEAN---PKQLIIILSDGEDFNHYLGQ 357

Query: 323 QNTLNTLQICEYMRNA----------------------------------GMKIYSVAV- 347
             TL    +C+ +RNA                                   ++I  +   
Sbjct: 358 TETLVDYGMCDNLRNAIEGGPVSSEDNKEDKIVFSSGSSSGLPTNTGEDPSVRIAMIGFG 417

Query: 348 -SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                     L  C       F+ N+  E+    + I   + E+   +A
Sbjct: 418 DGYDIHANTGLLNCV-GEENAFSANNKDEI---LNLIMSLVSEEVGHLA 462


>gi|319780897|ref|YP_004140373.1| hypothetical protein Mesci_1159 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166785|gb|ADV10323.1| hypothetical protein Mesci_1159 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 492

 Score =  116 bits (289), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 52/463 (11%), Positives = 124/463 (26%), Gaps = 74/463 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +  SV  L + ++++++ +   R+ +Q  +DAAV S    + +    +    K  Q 
Sbjct: 25  LFGLSASVLALAVGFSVNVSQLYNARSSLQGVVDAAVTSTARDLTTGAIKEADANKSVQA 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNP-------------------- 100
                 Q          +     +   K                                
Sbjct: 85  FLDANSQAGILQADQIVLDRLIVNRTAKTVQADAHVDVGLYFPIFGTGDMKRVAASTTAL 144

Query: 101 -LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS 159
                 E     +I         +        + ++        ++       V  V  +
Sbjct: 145 YSDKTVEVAMMLDITGSMAKRGKVDKIGDLKTAAKNAVQTMLQKQDPQNPRIRVAIVPYA 204

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPK------KSFWSKNTTKSKYAPAPAPANRKIDVL 213
                 +   +          LPP         K+  +   + S Y      A  + D  
Sbjct: 205 SGVNAGKLAENVYAEKQASTELPPVAGSPLLVAKTGKNLLPSFSDYISIVGAAMPRPDNC 264

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYN--------------IGIVGNQCTPLSNNL 259
                +   +   +      +        +                     +  PL+ + 
Sbjct: 265 ATERKDKNGNADMSADGPDTVRTDGNGKKFYALVNRDDHLGDGDMNRCPDAKVIPLTADS 324

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT---------IGSTRLKKFVIF 310
           + +   +        T    A+   Y  L  +  ++                ++ K  I 
Sbjct: 325 DALLESIEDFRANGFTAGAIAIQWTYYMLSPQWRTAIRNAGLGKGASDADPKKIAKVAIL 384

Query: 311 ITDGENSG---ASAYQNTL-------NTLQICEYMRNAGMKIYSVAVSAPPEG------- 353
           +TDG+ +     +             N   +C+ M+N G++I+++      +        
Sbjct: 385 MTDGQFNTAFAGAGDSYNRQGTLARGNAETLCDNMKNDGIEIFTIGFDLDDKDMSTTERD 444

Query: 354 --QDLLRKCTDSSG-----QFFAVNDSRELLESFDKITDKIQE 389
             + +L+ C+          FF V+   EL ++F +I    ++
Sbjct: 445 QAKAVLKDCSSKDTSGAKRHFFDVSTGAELDDAFQEIIRNTEK 487


>gi|222147837|ref|YP_002548794.1| hypothetical protein Avi_1104 [Agrobacterium vitis S4]
 gi|221734825|gb|ACM35788.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 483

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/466 (12%), Positives = 144/466 (30%), Gaps = 75/466 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSA-----------------LDAAVLSGCAS 43
           M+AI++    L +  A+D +     RN +Q                   +D+  L+    
Sbjct: 21  MSAILLMPLLLAVGAAVDYSSARDHRNDIQVTADSAILAAASSYSSSSGVDS--LAAGID 78

Query: 44  IVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS---------YIRENAGDIAQKAQINIT 94
              D  + D  +    T+ + K+     L              +  +   +A    ++++
Sbjct: 79  SYLDSKLTDQGSNDVDTAAVPKRLSGPTLSADGKEICIVVGEGVPTSFMQLAGVKTVDVS 138

Query: 95  KDKNN--PLQYIAESKAQYEIPTENLFLKGLIPSAL----TNLSLRSTGIIERSSENLAI 148
                  P     E     ++ +  +     +P          S  +   + + S+    
Sbjct: 139 AKSCAALPGNIDLEVSLVLDVSSSMIEEGRFVPMQTAVKSFLTSFANDATVAKRSKIAIA 198

Query: 149 SICMVLDVSRSMEDLYL----QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA 204
                 ++  + +D            +       Y        S W  N T   Y  +  
Sbjct: 199 PFSSRFNIGLTHKDWLKAYGGNDAVPSRWTDPKSYYKDSKYSFSQWIDNVTTLAYTSSNY 258

Query: 205 PA----NRKIDVL-IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                   + DV   ++       +  A    +    +      +         PL+++ 
Sbjct: 259 YWIGCVEPRADVEMKDNGAIGTYGLSDAPPSTEAFVAQDYNTGSSTSFCPPPIVPLTSSF 318

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG-----STRLKKFVIFITDG 314
           + ++S +  +    +T     M   +  L  +  S+          S ++KK ++F+TDG
Sbjct: 319 STLQSAIADMTSEGSTRLDAGMLAGWYTLSPKWRSAWGGGTAPADYSEKVKKVIVFMTDG 378

Query: 315 ENSGASAYQNTLNT-------------------------LQICEYMRNAGMKIYSVAVSA 349
           E +      +   +                         L  C+ +++  ++IY+++ S+
Sbjct: 379 EMNVKFGSTDPAKSSTEKLDWICDKNRTKSCNDTATNALLTTCDSIKSNNIEIYAISYSS 438

Query: 350 PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                  L+ C  S  +++    +  + + +  I+  I   +VR+ 
Sbjct: 439 EA-DVQNLQTC-SSGTKYYFSASTTNIKDVYTAISKNIIGSTVRLT 482


>gi|316931543|ref|YP_004106525.1| hypothetical protein Rpdx1_0148 [Rhodopseudomonas palustris DX-1]
 gi|315599257|gb|ADU41792.1| Protein of unknown function DUF2134, membrane [Rhodopseudomonas
           palustris DX-1]
          Length = 443

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/429 (12%), Positives = 127/429 (29%), Gaps = 54/429 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++      I  A+D +    +R ++Q+A DAA +   +            +     
Sbjct: 21  IFALVLIPLISAIGCAVDYSRANALRTKLQAAADAASVGAVSRTSPAYIAAGSMSTDGAI 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           ++     ++        +    G         ++K         ++     +I   +   
Sbjct: 81  TSGADDALR---IFNGNLANLTGYTLDSVAATVSKSGE---AVTSKVTFSAQI---STMF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
              +  +   +   ST     +S    I   ++LD S SM               +    
Sbjct: 132 MKAVAVSSMTVGGVSTA---TASMPKYIDFYLLLDNSPSMGVGATPTDVAAMVAATANKS 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                  +    N   + Y  A A     +IDVL  +   L+++            + I 
Sbjct: 189 SDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTAAATATYTNQFRMAIY 248

Query: 240 TIAYNIGIV-GNQCTPLSNNLNEVKSRLNKLNPYE--NTNTYPAMHHAYRELYNEKES-- 294
               +           LS +L+  K+    ++       N        Y  +    +   
Sbjct: 249 DFGASAQTAGLRNLFALSASLSSAKTAAGAIDLMTVKGQNDNNDQDTQYTAILPAIDKLI 308

Query: 295 -SHNTIGSTRLKKFVIFITDGENSGASAY---------QNTLNTLQICEYMRNAGMKI-- 342
            +  T  +    K++ F++DG     +             +     +C+ +++ G+++  
Sbjct: 309 AAPGTGAAGSPLKYLFFVSDGVADEYNPACLKPKTGNRCQSPINPALCKTLKDRGVRVAV 368

Query: 343 -YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDSRELLES 379
            Y+  +  P                            +  C    G +F V+ ++ + E+
Sbjct: 369 LYTTYLDLPSNDWYKKWIAPFNEGPYGPSPNSEIAKNMEACAS-PGFYFEVSPTQGIAEA 427

Query: 380 FDKITDKIQ 388
            + +  +  
Sbjct: 428 MNALFKRAV 436


>gi|192288907|ref|YP_001989512.1| hypothetical protein Rpal_0477 [Rhodopseudomonas palustris TIE-1]
 gi|192282656|gb|ACE99036.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 443

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/431 (12%), Positives = 132/431 (30%), Gaps = 58/431 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++      +  A+D +    +R+++Q+A DAA +   +            +     
Sbjct: 21  IFALVLVPLISAVGCAVDYSRANALRSKLQAAADAASVGAVSRTSPAYVAAGAMSGDGVI 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S+     ++        +    G     +   +TK  +      ++     +I   +   
Sbjct: 81  SSGADDALR---IFNGNLNGLTGYTLASSSATVTKASD---VVTSQVTFSAQI---STMF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  +   +   ST     +S    I   ++LD S SM               +    
Sbjct: 132 MKVVGMSAMTVGGTSTA---TASMPKYIDFYLLLDNSPSMGVGATPTDVSAMIAATANKS 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                  +    N   + Y  A A     +IDVL  +   L+++             R+ 
Sbjct: 189 SDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTASATATYSNQF--RMA 246

Query: 240 TIAYNIGIVGNQCTPL-----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
              +           L     S +  +  +    L   +  N       +Y  ++    +
Sbjct: 247 IYDFGASAQTAGLRNLFSLSASLSSAKTAASAIDLMTVKGQNDNNDQDTSYTAIFPAINN 306

Query: 295 SH---NTIGSTRLKKFVIFITDGENSGASAY---------QNTLNTLQICEYMRNAGMKI 342
                 +  S   +K++ F++DG     +             +     +C+ +++ G+KI
Sbjct: 307 EISSPGSGVSGSPQKYLFFVSDGVADEYNPSCLKPKTGNRCQSPINPALCKTLKDRGIKI 366

Query: 343 ---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDSRELL 377
              Y+  ++ P                            +  C    G +F V+ ++ + 
Sbjct: 367 AVLYTTYLNLPSNDWYKKWIAPFNAGPYGPSPNSEIAQNMEACAS-PGFYFEVSPTQGIA 425

Query: 378 ESFDKITDKIQ 388
           E+ + +  K  
Sbjct: 426 EAMNALFKKAV 436


>gi|86356688|ref|YP_468580.1| hypothetical protein RHE_CH01044 [Rhizobium etli CFN 42]
 gi|86280790|gb|ABC89853.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 445

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/437 (13%), Positives = 125/437 (28%), Gaps = 61/437 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           MTA+++         A+D A  + +R ++ +          A   +  +I   +    Q 
Sbjct: 16  MTALLVVPLLGAAGTAVDFASALSLRTELYA---------AADAAAVGSITPTSEAAAQA 66

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T+         K  +     +    ++    +T D +   +    S       T     
Sbjct: 67  NTMSGDGSLTLGKSEAQKIFFSQMSKKQGDAPVTVDISVQKKGDTLSSTVSFNATMPTTF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++      ++  +T           +   M+LD + SM               +    
Sbjct: 127 MQVMGFDEIAVTGAATAQ---YQTPSYMDFFMLLDNTPSMGVAATTDDITAMKKATANGH 183

Query: 181 LPPPPKKSFWSKNT---------TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
                K   ++ +                        +IDV+  +   L+   +      
Sbjct: 184 DGGKDKNCAFACHIVSEKGVEDKNSYYNVARNNGVTIRIDVVASAVKALMAKAKDTQSMP 243

Query: 232 KNLSVRIGTIAYNIGIVGN----QCTPLSNNLNEVKSRLN--KLNPYENTNTYPAMHHAY 285
               V   T              + + L+ +L  V +  N  KL      N Y     ++
Sbjct: 244 SQFRVAAYTSGKTAQDAKAAKLFKVSDLNYDLGAVAAAANMIKLMSIPYQNYYSDQQTSF 303

Query: 286 RELYNEKESS-----HNTIGSTRLKKFVIFITDGENSGASAYQNTL------------NT 328
            E     E            +   +K V F+ DG          T               
Sbjct: 304 DEALKGIEGEIKGNIGTGTSNADRQKIVFFVADGVGDSYKPTGCTSPKGANGGRCIEPID 363

Query: 329 LQICEYMRNAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVND 372
              C+ +++ G+K+   Y+  +  P  G                + +C  + G +FAV+ 
Sbjct: 364 TTYCKKLKDRGIKVAVLYTTYLPLPDNGFYKDWVKPFETRIAAKMEECA-TPGFYFAVSP 422

Query: 373 SRELLESFDKITDKIQE 389
           +  + E+ + +  KI  
Sbjct: 423 TEGIEEAMEALFRKIVS 439


>gi|303248312|ref|ZP_07334574.1| von Willebrand factor type A [Desulfovibrio fructosovorans JJ]
 gi|302490337|gb|EFL50249.1| von Willebrand factor type A [Desulfovibrio fructosovorans JJ]
          Length = 452

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/470 (11%), Positives = 131/470 (27%), Gaps = 111/470 (23%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A  +      +  A+DL  +    N++Q+A+DAA L+G   +  D  + +    +  T+
Sbjct: 3   VAATLVGLMAAVGVAVDLGRVYVAHNKLQNAVDAAALAGSLQLPDDPDVDNGKVSQAVTT 62

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            +                          +   T   +          A+ ++    + L 
Sbjct: 63  NLAAND---------------------PEAKATDISSGGATRSVCVTAEADVD---MTLS 98

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            ++    T ++  +            I + MVLD + SM    +    +      +  + 
Sbjct: 99  KVVGLDATTVTAEACAGYN------DIELVMVLDATGSMRGTPIANVKEAAANLVDLIMP 152

Query: 182 PPPPKKSFWSKNTTKSKYAP--APAPANRKID------VLIESAGNLVNSIQKAIQEKKN 233
                                    P   + D          + G L +   K       
Sbjct: 153 DSGANTRSKIGLVPFQGKVRIDGNDPVTAERDPDGVGAGCRNADGTLNDGKLKTEYSDTR 212

Query: 234 L-------SVRIGTIAYNIGIVG--NQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAM 281
                       G   Y        +    LS++   +   +  +N       T     +
Sbjct: 213 SRNSIFYGYTISGVSTYYDRTCSGMSPIRALSSDKEAILDNIGAINAGAVTSGTLISEGI 272

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE-------------------------- 315
              ++ L  +   +        ++K +I +TDG+                          
Sbjct: 273 KWGHKVLSPKAPYTEGNTDKK-VRKIMIVLTDGDTEDGRCGGRYASASRTVNAYWTNAYF 331

Query: 316 -----NSGASAYQNTLNTLQI---------------------CEYMR---NAGMKIYSVA 346
                 + AS+  +TL+T                         +  +   +  ++I+++ 
Sbjct: 332 GQGLRPNSASSPYDTLSTASATLAQIPDCTDGGKLNQYVLDEADDAKNDADYPVEIFAIR 391

Query: 347 VS-APPEGQDLLRKCTD----SSGQFFAVNDSRELLESFDKITDKIQEQS 391
              +      L+++       +   ++   DS ++ + F KI  ++ ++ 
Sbjct: 392 FGDSDATDISLMKRIASSKSGTDDHYYDAPDSSDIKDMFKKIGQQLGQRL 441


>gi|39933553|ref|NP_945829.1| hypothetical protein RPA0476 [Rhodopseudomonas palustris CGA009]
 gi|39647399|emb|CAE25920.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 443

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 55/431 (12%), Positives = 132/431 (30%), Gaps = 58/431 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++      +  A+D +    +R+++Q+A DAA +   +            +     
Sbjct: 21  IFALVLVPLISAVGCAVDYSRANALRSKLQAAADAASVGAVSRTSPAYVAAGAMSGDGVI 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S+     ++        +    G     +   +TK  +      ++     +I   +   
Sbjct: 81  SSGADDALR---IFNGNLNGLTGYTLASSSATVTKASD---VVTSQVTFSAQI---STMF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  +   +   ST     +S    I   ++LD S SM               +    
Sbjct: 132 MKVVGMSAMAVGGTSTA---TASMPKYIDFYLLLDNSPSMGVGATPTDVSAMIAATANKS 188

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                  +    N   + Y  A A     +IDVL  +   L+++             R+ 
Sbjct: 189 SDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTATATATYSNQF--RMA 246

Query: 240 TIAYNIGIVGNQCTPL-----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
              +           L     S +  +  +    L   +  N       +Y  ++    +
Sbjct: 247 IYDFGASAQTAGLRNLFSLSASLSSAKTAASAIDLMTVKGQNDNNDQDTSYTAIFPAINN 306

Query: 295 SH---NTIGSTRLKKFVIFITDGENSGASAY---------QNTLNTLQICEYMRNAGMKI 342
                 +  S   +K++ F++DG     +             +     +C+ +++ G+KI
Sbjct: 307 EISSPGSGVSGSPQKYLFFVSDGVADEYNPSCLKPKTGNRCQSPINPALCKTLKDRGIKI 366

Query: 343 ---YSVAVSAPPEG----------------------QDLLRKCTDSSGQFFAVNDSRELL 377
              Y+  ++ P                            +  C    G +F V+ ++ + 
Sbjct: 367 AVLYTTYLNLPSNDWYKKWIAPFNAGPYGPSPNSEIAQNMEACAS-PGFYFEVSPTQGIA 425

Query: 378 ESFDKITDKIQ 388
           E+ + +  K  
Sbjct: 426 EAMNALFKKAV 436


>gi|254440702|ref|ZP_05054195.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
 gi|198250780|gb|EDY75095.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
          Length = 590

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/361 (14%), Positives = 89/361 (24%), Gaps = 75/361 (20%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           +++ +   F   A+DL      R ++Q +LD A L+          +       D     
Sbjct: 36  MMMVMILWFGGMAVDLMRYETTRAKLQGSLDRATLAAA-------DLDQVMAPADVVRDY 88

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K    H  QG  I                         I  + A   +P     L  +
Sbjct: 89  MDKAGMLHFLQGDPI-----------------VDQGINYRIVTANASAPMPLFFYDLPKV 131

Query: 124 I------PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
                    +   +S  ST     S   +++    VLDVS SM       +         
Sbjct: 132 FSSPFTPGMSSLTVSGSSTAEERVSDVEISL----VLDVSSSMNSNNRMTNLRPAAREFV 187

Query: 178 KYLLPPPPKK----SFWSKNTTKSKYAP----APAPANRKIDVLIESAGNLVNSIQKAI- 228
             +L             S     +   P    AP     +                    
Sbjct: 188 TTVLANNTNAPQGLITISMIPYSAVVNPGTDIAPHLNINRTHEYSTCPMFDDTEFTTTAL 247

Query: 229 -------------QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
                            N         +      N   P + N  ++ + +N L+ Y NT
Sbjct: 248 NLGASYDHVSHFSYGGSNDMPINPNYTWCFAGDLNAIKPHTTNEADLHTAINNLHAYGNT 307

Query: 276 NTYPAMHHAYRELYNEKE-------------------SSHNTIGSTRLKKFVIFITDGEN 316
                +      L +  +                             + K ++ +TDG+N
Sbjct: 308 AIDMGVKWGVALLDSSTQSLISSLAGASGTGVPAIANGRPELHTQADVLKVLVLMTDGQN 367

Query: 317 S 317
           +
Sbjct: 368 T 368



 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 80/214 (37%), Gaps = 20/214 (9%)

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI-----VGNQCT 253
           Y    +P    +D + +   ++  +      + +  + R     Y  G        +   
Sbjct: 377 YKSGMSPVWFDLDDVNQPLWDVDFNKTSVQYQGEATNSRWDDWFYWNGYSGTLRYRDYPN 436

Query: 254 PLSNNLNEVKSR-LNKLNPYENT----NTYPAMHHAYRELYNEKE----SSHNTIGSTRL 304
             ++ L  V +  ++   P E T    N     H ++++L+ ++     ++H  + +   
Sbjct: 437 GFNSRLAYVNASPVDASGPGEGTRYVDNGDELYHASWQQLFADRSYFLINNHYFLDAYYA 496

Query: 305 KKFV---IFITDGENSGASAYQNTLNTL--QICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
             +     + TD          +  NT    IC   R  G+ IY+VA  AP  GQ  L+ 
Sbjct: 497 GAWSWNEYWGTDNSIDHLIVNGSEANTRLSNICAAARAQGIVIYTVAFEAPSGGQTALQD 556

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           C  SS  +F V D  ++  +F  I   I+   + 
Sbjct: 557 CASSSSHYFDV-DGTDISGAFSAIASDIRNLKLT 589


>gi|254504856|ref|ZP_05117007.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
 gi|222440927|gb|EEE47606.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
          Length = 455

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/471 (12%), Positives = 124/471 (26%), Gaps = 108/471 (22%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+      L    ++D+  +   + ++QS LD+A L+  +   +              
Sbjct: 12  LTALAFVPLMLITIGSLDVVRMTTAQAKLQSTLDSATLAAASLSNT-----------ADI 60

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                + I+ +L   +        +          D  N       +    E     + +
Sbjct: 61  EDTVDEYIQANLPDTAPWTTLKLTMGD------VTDSLNAKSVEITATVDIE-----MTI 109

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L     T++   S            I + +VLD+S SM    +    +      +  L
Sbjct: 110 LKLAGIDKTSVLASSVAQQAAQ----NIEVSVVLDISSSMGGSKITSLREAAKGFIDTML 165

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL------ 234
                K+                   +     +  S   +++S   A             
Sbjct: 166 KEDEDKEYTSLSIIPFGGTVNIGDFYDT--YAVNSSTPGVIDSPSSANYYVNKNVPYGKF 223

Query: 235 ---SVRIGTIAYNIGIVGNQCTPL-----------------------------SNNLNEV 262
              + R G I Y          P                              SNN  ++
Sbjct: 224 MFSTEREGCIEYTDDDFDMAAIPANSRPQVPDFTKWVATNPWCPSEDSAMVLNSNNTTDL 283

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKES--------SHNTIGSTRLKKFVIFITDG 314
           K+ ++ ++  + T          + L                         K  + +TDG
Sbjct: 284 KALIDDMDLSDGTGMDIGALWGAKVLSGSMRGQLGGDFSDRPADFNDEDTLKVAVIMTDG 343

Query: 315 ----------ENSGASAYQNTLNT---------------------LQICEYMRNAGMKIY 343
                       +       T  T                      ++CEY+ +  +++Y
Sbjct: 344 AITAQFRPRDYTTTGKIKNKTQQTIVSKGNINTASTKADDAVAYFKRVCEYLNDNNVQVY 403

Query: 344 SVAVSAPPEG--QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           ++            LL+ C  S   ++ V     + ++F+ I   +    V
Sbjct: 404 TIGFQINSGSLPDQLLKYCASSLSNYYFVEGLN-IEDAFNAIASAVNNLRV 453


>gi|332558842|ref|ZP_08413164.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
 gi|332276554|gb|EGJ21869.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
          Length = 566

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 90/363 (24%), Gaps = 81/363 (22%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            ++ +  +    A+D+    + R ++Q  LD AVL+         ++    +  +     
Sbjct: 30  FMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAA-------SLTQSRSPAEVVRDY 82

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K   +       +  N  ++                     + A Y +PT       L
Sbjct: 83  VAKAGLEDYLDEPVVNANTLNV-----------------RSVTATAAYSMPTV---FMKL 122

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-----KHNDNNNMTSNK 178
           +          ST     S+  +++    VLD+S SM            +          
Sbjct: 123 LDIDRLEAPAVSTAEERVSNVEISL----VLDMSNSMVTDGTNPRDRLDNLKVAARDFID 178

Query: 179 YLLPPPPKK-----SFWSKNTTKSKYAPAP------APANRKIDVLIESAGNLVNSIQKA 227
            ++                    +    A        P                +     
Sbjct: 179 IVMAGANSGLDGAPVISVSIVPYTGQVNAGADLLATYPNVSHRQPYSSCVEFAASDFTTT 238

Query: 228 IQEKK------------NLSVRIGTIAYNIGIVGN-----QCTPLSNNLNEVKSRLNKLN 270
                            + S       Y              TP S++   +K+ +++L+
Sbjct: 239 ALANGAPLTGSGNSELFSSSSSTQAPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDRLS 298

Query: 271 PYENTNTYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITD 313
              +T     M      L    +                        S  + K V+ +TD
Sbjct: 299 GEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTD 358

Query: 314 GEN 316
           G++
Sbjct: 359 GQH 361



 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
               T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++      ++   F  I
Sbjct: 497 KNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYY-ATVGPQIRTVFHSI 555

Query: 384 TDKIQEQSVR 393
              I +  + 
Sbjct: 556 ASHITQLRLT 565


>gi|126462813|ref|YP_001043927.1| hypothetical protein Rsph17029_2052 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104477|gb|ABN77155.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 566

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/363 (11%), Positives = 88/363 (24%), Gaps = 81/363 (22%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            ++ +  +    A+D+    + R ++Q  LD AVL+         ++    +  +     
Sbjct: 30  FMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAA-------SLTQSRSPAEVVRDY 82

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K   +       +  N  ++                     + A Y +PT       L
Sbjct: 83  VAKAGLEDYLDEPVVNANTLNV-----------------RSVTATAAYSMPTV---FMKL 122

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-----KHNDNNNMTSNK 178
           +          ST     S+  +++    VLD+S SM            +          
Sbjct: 123 LDIDRLEAPAVSTAEERVSNVEISL----VLDMSNSMVTDGTNPRDRLDNLKVAARDFID 178

Query: 179 YLLPPPPKK-----SFWSKNTTKSKYAPAP------APANRKIDVLIESAGNLVNSIQKA 227
            ++                    +    A        P                +     
Sbjct: 179 IVMAGANSGLDGAPVISVSIVPYTGQVNAGADLLATYPNVSHRQPYSSCVEFAASDFTTT 238

Query: 228 IQEKK-----------------NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                                   +                 TP S++   +K+ +++L+
Sbjct: 239 ALANGATLTGSGNSELFSSSSSTQTPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDRLS 298

Query: 271 PYENTNTYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITD 313
              +T     M      L    +                        S  + K V+ +TD
Sbjct: 299 GEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTD 358

Query: 314 GEN 316
           G++
Sbjct: 359 GQH 361



 Score = 68.4 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
               T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++      ++   F  I
Sbjct: 497 KNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYY-ATVGPQIRTVFHSI 555

Query: 384 TDKIQEQSVR 393
              I +  + 
Sbjct: 556 ASHITQLRLT 565


>gi|77463970|ref|YP_353474.1| hypothetical protein RSP_0399 [Rhodobacter sphaeroides 2.4.1]
 gi|77388388|gb|ABA79573.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 566

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 89/363 (24%), Gaps = 81/363 (22%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            ++ +  +    A+D+    + R ++Q  LD AVL+         ++    +  +     
Sbjct: 30  FMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAA-------SLTQSRSPAEVVRDY 82

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K           +  N  ++                     + A Y +PT       L
Sbjct: 83  VTKAGLADYLDEPVVNANTLNV-----------------RSVTATAAYSMPTV---FMKL 122

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-----KHNDNNNMTSNK 178
           +          ST     S+  +++    VLD+S SM            +          
Sbjct: 123 LDIDRLEAPAVSTAEERVSNVEISL----VLDMSNSMVTDGTNPRDRLDNLKVAARDFID 178

Query: 179 YLLPPPPKK-----SFWSKNTTKSKYAPAPAPANRKIDVLIE------SAGNLVNSIQKA 227
            ++                    +    A A        +              +     
Sbjct: 179 IVMAGANSGLDGAPVISVSIVPYTGQVNAGADLLSTYPNVSHRQPYSSCVEFAASDFTTT 238

Query: 228 IQEKK------------NLSVRIGTIAYNIGIVGN-----QCTPLSNNLNEVKSRLNKLN 270
                            + S       Y              TP S++   +K  +++L+
Sbjct: 239 ALANGAPLTGSGNSELFSSSSSTQAPTYYWCPEETAAGNPTVTPFSHDPEALKLAIDRLS 298

Query: 271 PYENTNTYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITD 313
              +T     M      L    +                        S  + K V+ +TD
Sbjct: 299 GEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTD 358

Query: 314 GEN 316
           G++
Sbjct: 359 GQH 361



 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
               T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++      ++   F  I
Sbjct: 497 KNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYY-ATVGPQIRTVFHSI 555

Query: 384 TDKIQEQSVR 393
              I +  + 
Sbjct: 556 ASHITQLRLT 565


>gi|114571146|ref|YP_757826.1| Flp pilus assembly protein TadG [Maricaulis maris MCS10]
 gi|114341608|gb|ABI66888.1| Flp pilus assembly protein TadG [Maricaulis maris MCS10]
          Length = 500

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/476 (10%), Positives = 131/476 (27%), Gaps = 84/476 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + ++++    +    A+D+   +  R ++ +ALDAA L+         T       +   
Sbjct: 23  LFSLMLIPITVLSGGAVDINQALNARARLSAALDAAALAVGVHTSVSETEAAGIASEFIA 82

Query: 61  STIFKKQIK--KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA--------ESKAQ 110
           +    +++    ++       ++   +  ++++         ++YI          +++ 
Sbjct: 83  ANYPDRELGLVGNIVVQLDPDQDRVTVGAESRVETIVLGLIGIEYITVHWESEVQRARSS 142

Query: 111 YEIPTENLFLKGLIPSALTNLSLRS--------TGIIERSSENLAISICMVLDVSRSMED 162
            E+         +  S +++L             G      +   +     ++V    E 
Sbjct: 143 LELVMVLDNTGSMGGSKISSLRSAGLLLTDILFDGADPNRLKIGLVPFSATVNVGTWHER 202

Query: 163 LYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS------------------------- 197
            +    N  + + +  +         + S                               
Sbjct: 203 AWWLDANAQSPLHAENFDPAANRWDLYDSLQNRAWEGCVEARAIPHDIEDTAPDTGYPET 262

Query: 198 ----KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA-----YNIGIV 248
                +AP  +              + +    +  + +         I         G  
Sbjct: 263 LFLPYFAPDESNYANNAGYANSYLNDGMGGSNERARMRNTPKYTNAWINSSSRGPEWGCT 322

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKF 307
               TPL+N  N +   +  +     TN    +    R L      +   +       K 
Sbjct: 323 ARPITPLTNQRNVIDDAIEDMIASGTTNIPIGISWGVRVLSPGMPFTEGVSYDEEGTIKA 382

Query: 308 VIFITDG--------ENSGASAYQN----------------------TLNTLQICEYMRN 337
           ++ +TDG          + +                              T   CEY ++
Sbjct: 383 MVVLTDGENYLDGRNNPNYSHYSGYGYMRDGRLGIQTSSDSTIRNALNDRTEAACEYAKS 442

Query: 338 AGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            G+++Y++         +D++R C      +F       L  +F+ I   +    +
Sbjct: 443 LGIRVYTITFQVNSSSTRDMMRDCATHPTLYFDSPSDDALRSAFEMIAGDLTNLRL 498


>gi|221639828|ref|YP_002526090.1| hypothetical protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
 gi|221160609|gb|ACM01589.1| Hypothetical Protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
          Length = 566

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/363 (11%), Positives = 88/363 (24%), Gaps = 81/363 (22%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            ++ +  +    A+D+    + R ++Q  LD AVL+         ++    +  +     
Sbjct: 30  FMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAA-------SLTQSRSPAEVVEDY 82

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K   +       +  N  ++                     + A Y +PT       L
Sbjct: 83  VTKAGLEDYLDEPVVNANTLNV-----------------RSVTATAAYSMPTV---FMKL 122

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-----KHNDNNNMTSNK 178
           +          ST     S+  +++    VLD+S SM            +          
Sbjct: 123 LDIDRLEAPAVSTAEERVSNVEISL----VLDMSNSMVTDGTNPRDRLDNLKVAARDFID 178

Query: 179 YLLPPPPKK-----SFWSKNTTKSKYAPAP------APANRKIDVLIESAGNLVNSIQKA 227
            ++                    +    A        P                +     
Sbjct: 179 IVMAGANSGLDGAPVISISIVPYTGQVNAGADLLATYPNVSHRQPYSSCVEFAASDFTTT 238

Query: 228 IQEKK-----------------NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                                   +                 TP S++   +K+ +++L+
Sbjct: 239 ALANGATLTGSGNSELFSSSSSTQTPTYYWCPEETAAGNPTVTPFSHDPEALKAAIDRLS 298

Query: 271 PYENTNTYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITD 313
              +T     M      L    +                        S  + K V+ +TD
Sbjct: 299 GEGSTAIDTGMKWGVTLLDPSTQPSVAALIEDGKVNGAFAGRPLAYQSGNVMKVVVLMTD 358

Query: 314 GEN 316
           G++
Sbjct: 359 GQH 361



 Score = 68.8 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
               T QIC+  R  G+ +YSVA  A   GQ LL+ C  ++G ++      ++   F  I
Sbjct: 497 KNERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCASTTGHYY-ATVGPQIRTVFHSI 555

Query: 384 TDKIQEQSVR 393
              I +  + 
Sbjct: 556 ASHITQLRLT 565


>gi|332716075|ref|YP_004443541.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
 gi|325062760|gb|ADY66450.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
          Length = 429

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/429 (11%), Positives = 127/429 (29%), Gaps = 51/429 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+++         A+D+   M ++  +Q A D       A              K  +
Sbjct: 15  LTALLMVPLCGAAGVALDITRGMSVKADLQQAAD-----SAALAAVADMSASVQAAKKMS 69

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                    +  +      +          ++++  K+          +     + +  L
Sbjct: 70  GDGVIPVGNEEARAFFDGNQRGDADYTITSVDVSVIKHG----NVVESSVSFKASVSTTL 125

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
            GL+     +++  +T    +          ++LD + SM               +    
Sbjct: 126 SGLLGKDFVSVAGTATA---KYETETFSDFYLLLDNTPSMGVGATPTDVATLVANTGDKC 182

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                       +     +         +IDV+ ++  +L+++ +     K +   R+  
Sbjct: 183 AFACHIVKDGVADPNSYYFKAKKLGVTTRIDVVAKATASLMDTAKSTR--KSSNQYRMAV 240

Query: 241 IAYNIGIVGNQCT---PLSNNLNEVKSRLNKLNP------YENTNTYPAMHHAYRELYNE 291
             +       +      L+++L+  K +  ++N         N +       A  ++ ++
Sbjct: 241 YTFGERAEDTKLLEVVSLTSDLDAAKKKAGEINLMSIPYQGYNNDQQTDFDRALIQIGDK 300

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI----------CEYMRNAGMK 341
             SS     S    K + F++DG          T                C  ++  G +
Sbjct: 301 VGSSGTGASSANPDKVIFFVSDGVGDSYKPSSCTKKLTGGRCQEPIDIKDCTKLKEKGFR 360

Query: 342 I---YSVAVSAPPEGQ-------------DLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           I   Y+  +  P                   ++ C    G +F V+ S+ + ++   +  
Sbjct: 361 IAVLYTTYLPLPTNDWYNSWIKPFQAEIGSRMQSCAS-PGLYFEVSPSQGISDAMTVLFK 419

Query: 386 K-IQEQSVR 393
           K I    + 
Sbjct: 420 KAITSPRLT 428


>gi|170741048|ref|YP_001769703.1| hypothetical protein M446_2844 [Methylobacterium sp. 4-46]
 gi|168195322|gb|ACA17269.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 432

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/422 (11%), Positives = 125/422 (29%), Gaps = 59/422 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             +++    + +  ++D A +                   A+  +  ++ +         
Sbjct: 32  FGLLLLPMMVAMGVSVDYARVSAA----------RSDLAAAADAAVLSVTNKAAMSLDML 81

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           +   +     LK    + + +G  A    I++   +   L Y A  +             
Sbjct: 82  SAQARVRDAFLKNIQTMPDISGVSADAVVIDLLGVRAATLSYTASYR---------TAFS 132

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
           G++     ++S  +          + +   ++LD S SM               +     
Sbjct: 133 GILGMRTLSVSGNAASKSAV---PIYMDFYLLLDNSPSMGVGATSADISTMVSRTPDKCA 189

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR-IGT 240
                    S   +   +         +IDV+ ++   L+++                  
Sbjct: 190 FACHDL---SAGNSDYYHLAKSLGVTMRIDVVRQATQRLMDTAANTALVPGQFRTALYTM 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLN------PYENTNTYPAMHHAYRELYNEKES 294
            A    +     +PLS++L   K+    ++      P  N +        ++ L  + + 
Sbjct: 247 GADCASVGLTTVSPLSSDLAAAKTNAQAIDLMTIQKPGYNNDQCTDFDGVFQSLNGKIDV 306

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL----------QICEYMRNAGMKI-- 342
           + +   +   +K V  ++DG          T  T             C  ++N G+KI  
Sbjct: 307 AGDGSTALTPQKVVFLVSDGVADAYYPSTCTRKTTGGRCQEPLTLANCTTLKNRGIKIAV 366

Query: 343 -YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
            Y+  +  P                   ++ C    G +F V+ ++ + ++   +  +  
Sbjct: 367 LYTTYLPLPTNDWYNTWIAPFQATLPSAMQGCAS-PGLYFEVSPTQGIADAMTTLFQRTV 425

Query: 389 EQ 390
            Q
Sbjct: 426 SQ 427


>gi|296124353|ref|YP_003632131.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
 gi|296016693|gb|ADG69932.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
          Length = 390

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/391 (12%), Positives = 112/391 (28%), Gaps = 51/391 (13%)

Query: 12  FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIK--DPTTKKDQTSTIFKKQIK 69
              + +D+A++  +R ++++A DA+  +G  ++   +  +           +     +  
Sbjct: 30  MTMFTVDVAYMQLVRTELRAATDASAKAGMEALRRTQDTEAAIDAAIATAAANKVGGRSL 89

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALT 129
                         ++      N  +     ++  +            LF   +  +   
Sbjct: 90  TLTADQIEFGLAFRNVDNSVSFNAGQLPYTAVRVNSAMTESSAAGAVPLFFGSIFGTGQF 149

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
             +  +         +  + IC  +D S SM              T         P    
Sbjct: 150 EPTRSAVS------ASTEVEICFAIDRSHSMCFDLTGVDWSYPPGTPRNPDPVAFP---- 199

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT--------- 240
                        P P   +   L  +    V+       + +   V   +         
Sbjct: 200 -------------PHPTLSRWASLSRAMQTFVSITASQEPKPRVAMVTWASKITQSNYEG 246

Query: 241 -IAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSH 296
            +            PL+ NL ++   +   +       TN    +  A + L   K +  
Sbjct: 247 KLTKTNSPEVFVDVPLTTNLADLNQAIKGRSEKVMLGATNMAAGIDEARKILNATKSTRP 306

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                    + +I +TDG  +         N L   +   N G+ I+SV++  P  G   
Sbjct: 307 ------YAHRIIILMTDGLWNQGR------NPLLAAQDAANEGIVIHSVSL-LPRSGDIT 353

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
            +  + + G  +   +S  L  +F  I   +
Sbjct: 354 PQVSSTTGGVNYPATNSAALEAAFADIARTL 384


>gi|330862285|emb|CBX72446.1| hypothetical protein YEW_HH31780 [Yersinia enterocolitica W22703]
          Length = 457

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/448 (10%), Positives = 121/448 (27%), Gaps = 72/448 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             II       I    +++H +  + ++  A++ A L+                     +
Sbjct: 29  FMIIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALAIENNEIPDEPQQIK----NN 84

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            +    +  +L    ++            + I    +N       +      P + L   
Sbjct: 85  ALVLSYVNAYLPSKKFL------------VPIININDNTHYLEYNAAVTMAYPAKFLSQS 132

Query: 122 GLIP-SALTNLSLRSTGIIERS-SENLAISICMVLDVSRSMEDLYLQK------------ 167
                 +  N++     I  ++   +    +  V D S SM   + +             
Sbjct: 133 PFTNTISDMNITDNGVAIKNKAIEASEPTDVIFVADYSGSMLYNFNENKPRDHERIDALR 192

Query: 168 -------HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA--- 217
                      +N   N     P    +       + +      P + KI     +    
Sbjct: 193 SAFRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPKGNYLSD 252

Query: 218 ------------------GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                              +   +I       + + + +  + +   +        S   
Sbjct: 253 EIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGD-VCLQGSNAYSLEQ 311

Query: 260 NEVKSRLNK---LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            +  + ++    + P+  T     +  A     N+ ++ H  +             D  +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNIFKNKAKNGHKKLMIILSDGVDT--DDFPS 369

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD------LLRKCTDSSGQFFAV 370
           S        L    +CE ++   +++  +A++  P+           +KC      ++  
Sbjct: 370 SKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GEDNYYEA 428

Query: 371 NDSRELL-ESFDKITDKIQEQSVRIAPN 397
           +++ EL  +    ++     +  R  P 
Sbjct: 429 HNAHELEHKLQQAVSGSTTREVGRNIPK 456


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 74/408 (18%), Positives = 160/408 (39%), Gaps = 35/408 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASI-------VSDRTIKDP 53
           + ++I+    LFI   I +    + +N M++A  +A+LSG + I         + +    
Sbjct: 25  LFSVILISILLFIGILIYVLDYYHKKNAMENANTSAILSGASKIISRISYFGDNMSSHTH 84

Query: 54  TTKKDQTSTIFKKQIKKHLK--QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQY 111
               D  +   K  IK+ L      +       I+Q ++++IT++ +  + +   +++  
Sbjct: 85  RAIVDDVTRFIKSYIKESLLMDSSVFDISEKNIISQNSKVSITREPHPNVFHEFNNQSIL 144

Query: 112 EIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDN 171
           +       +              +    + +S+ ++    +V   +      ++Q   D 
Sbjct: 145 QNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFVPALVKIDTGEHPFFFVQLVVDL 204

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
           +   S      P     F              +  N K+D L ++    ++S+ +  +  
Sbjct: 205 SASMSCLMNSDPEHATEFS---------VCGKSKKNSKMDALKKAVLLFLDSVDRGSKT- 254

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL---NKLNPYENTNTYPAMHHAYREL 288
                              +    S    +V+  +     +N    T++ PAM  AY+ L
Sbjct: 255 --QKDTHYIGLTGYTTRVEKNIEPSWGTGKVRKYIVEEIDVNMLGQTDSTPAMKKAYQIL 312

Query: 289 YNEKESS--------HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
            ++K+ +           I     +KF+IF+TDGEN+   +    + T++ICE  +   +
Sbjct: 313 TSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDPKSD---VKTIKICEKAKKNSI 369

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           KI +++++A   G+ LL+KC  +   ++ V D+  LL  F  I+  I 
Sbjct: 370 KILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDISTLIT 417


>gi|84386788|ref|ZP_00989813.1| hypothetical protein V12B01_19181 [Vibrio splendidus 12B01]
 gi|84378316|gb|EAP95174.1| hypothetical protein V12B01_19181 [Vibrio splendidus 12B01]
          Length = 404

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/411 (12%), Positives = 107/411 (26%), Gaps = 49/411 (11%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
           A++    F+ +                        L   A ++                 
Sbjct: 24  ALLFPALFIAVG----------------------TLMVSAQVMVSNRAAQAADSAALACA 61

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN-PLQYIAESKAQYEIPTENLFLK 121
                    ++      +         +  I   +    L Y          P    F  
Sbjct: 62  FADTATLPMMRAYQEYYKPTLKGVSGLEPEIIGSECRISLGYSLS-------PLLPNFQY 114

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH--NDNNNMTSNKY 179
               + +T        ++E    ++   + +VLDVS SM            N   T    
Sbjct: 115 ESYATKVTATGGGYKSVVESKQSSIPTELVLVLDVSGSMGSNIQSLKSILSNALNTIQSQ 174

Query: 180 LLPPPPKKSFWSKNTTK-SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                   S         S  A    P   K    I     L              ++  
Sbjct: 175 SNNANDLDSVSISIVPFDSGVAAQRPPWLSKEAAGIYCIDGLNYRNGNFSAALTVDNLAT 234

Query: 239 GTI-----------AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
                           +     +   PL++  + V++ +N L     T ++  +    R+
Sbjct: 235 LHSQQPVKFAKPNGWLSDCNQSSPMLPLTSVFSRVRNSINSLTANGGTRSFHGLLWGVRQ 294

Query: 288 LYNEKESSHNTIGSTRLK--KFVIFITDGENSGASAYQNTLNTLQICEYM-RNAGMKIYS 344
           L    + +     ST  +  + ++  TDG + G +  Q  L     C       G+++  
Sbjct: 295 LIPSWQQAWGINVSTVPETRRKLVLFTDGADEGDTFDQ--LVNAGFCTTAINQYGIEMNF 352

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
           +             +C  +  + F+  ++ +L E F  I       ++++ 
Sbjct: 353 IGYGVSSSRIAQFERCAGNPSRVFSATNTTQLNEYFSDILAVEYSATIKLT 403


>gi|318604213|emb|CBY25711.1| protein TadG, associated with Flp pilus assembly [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 457

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/448 (10%), Positives = 121/448 (27%), Gaps = 72/448 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             II       I    +++H +  + ++  A++ A L+                     +
Sbjct: 29  FMIIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALTIENNEIPDEPQQIK----NN 84

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            +    +  +L    ++            + I    +N       +      P + L   
Sbjct: 85  ALVLSYVNAYLPSKKFL------------VPIININDNTHYLEYNAAVTMAYPAKFLSQS 132

Query: 122 GLIP-SALTNLSLRSTGIIERS-SENLAISICMVLDVSRSMEDLYLQK------------ 167
                 +  N++     I  ++   +    +  V D S SM   + +             
Sbjct: 133 PFTNTISDMNITDNGVAIKNKAIEASEPTDVIFVADYSGSMLYNFNENKPRDHERIDALR 192

Query: 168 -------HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA--- 217
                      +N   N     P    +       + +      P + KI     +    
Sbjct: 193 SAFRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPKGNYLSD 252

Query: 218 ------------------GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                              +   +I       + + + +  + +   +        S   
Sbjct: 253 EIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGD-VCLQGSNAYSLEQ 311

Query: 260 NEVKSRLNK---LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            +  + ++    + P+  T     +  A     N+ ++ H  +             D  +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNLFKNKAKNGHKKLMIILSDGVDT--DDFPS 369

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD------LLRKCTDSSGQFFAV 370
           S        L    +CE ++   +++  +A++  P+           +KC      ++  
Sbjct: 370 SKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GEDNYYEA 428

Query: 371 NDSRELL-ESFDKITDKIQEQSVRIAPN 397
           +++ EL  +    ++     +  R  P 
Sbjct: 429 HNAHELEHKLQQAVSGSTTREVGRNIPK 456


>gi|332162963|ref|YP_004299540.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667193|gb|ADZ43837.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 457

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/448 (10%), Positives = 121/448 (27%), Gaps = 72/448 (16%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             II       I    +++H +  + ++  A++ A L+                     +
Sbjct: 29  FMIIFPFFIALIFITFEISHYLQRKAKLSDAIEQATLALTIENNEIPDEPQQIK----NN 84

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            +    +  +L    ++            + I    +N       +      P + L   
Sbjct: 85  ALVLSYVNAYLPSKKFL------------VPIININDNTHYLEYNAAVTMAYPAKFLSQS 132

Query: 122 GLIP-SALTNLSLRSTGIIERS-SENLAISICMVLDVSRSMEDLYLQK------------ 167
                 +  N++     I  ++   +    +  V D S SM   + +             
Sbjct: 133 PFTNTISDMNITDNGVAIKNKAIEASEPTDVIFVADYSGSMLYNFNENKPRDHERIDALR 192

Query: 168 -------HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA--- 217
                      +N   N     P    +       + +      P + KI     +    
Sbjct: 193 SAFRKLHDIIMDNSNINAIGYIPFSWGTKRIVFENQQQKTYCHFPFSPKIHKPKGNYLSD 252

Query: 218 ------------------GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                              +   +I       + + + +  + +   +        S   
Sbjct: 253 EIKRSSNTLLLLDYIGDIIDYDKTIDSITGNAQTIDIPMSDVRFGD-VCLQGSNAYSLEQ 311

Query: 260 NEVKSRLNK---LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            +  + ++    + P+  T     +  A     N+ ++ H  +             D  +
Sbjct: 312 EQYINNIDNIIEMEPHGWTLISSGILSANNIFKNKAKNGHKKLMIILSDGVDT--DDFPS 369

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD------LLRKCTDSSGQFFAV 370
           S        L    +CE ++   +++  +A++  P+           +KC      ++  
Sbjct: 370 SKGIIISKMLVEKGMCEEIKENDIQMAFIAIAYSPDNNKNEPYHINWKKCV-GEDNYYEA 428

Query: 371 NDSRELL-ESFDKITDKIQEQSVRIAPN 397
           +++ EL  +    ++     +  R  P 
Sbjct: 429 HNAHELEHKLQQAVSGSTTREVGRNIPK 456


>gi|148253748|ref|YP_001238333.1| hypothetical protein BBta_2249 [Bradyrhizobium sp. BTAi1]
 gi|146405921|gb|ABQ34427.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 432

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/430 (11%), Positives = 121/430 (28%), Gaps = 67/430 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +     F+  AID +  +  + ++ ++LDAA+L+         T  D  T     
Sbjct: 25  IFALALLPILTFVGSAIDYSMAVRAKAKLSASLDAAMLAATGYTAMRGTAADAKTSAT-- 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                           Y  + +        +NIT   +          A       N   
Sbjct: 83  --------------NMYNGQMSSHKLTSNSLNITVTDSVT-ARTVTGTASV---VVNTAF 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +       ++  S+           +   +++D S S                ++   
Sbjct: 125 MYMFGFPTMTVTASSSASASF---PTYMDFYVLVDNSPSQGLGATTADMTTLQNATSDKC 181

Query: 181 LPPPPKKSFWSKNTTKSKYAPA----PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                     S   T    +            +IDV+  +  +L ++   +         
Sbjct: 182 AFACHDTYTSSTKKTLQTNSYYQIAKNKGVTMRIDVVRSATQSLTDTATSSQVVSNQ--Y 239

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---------YENTNTYPAMHHAYRE 287
           R+   +          T +++  + + S  + +             N +       A   
Sbjct: 240 RMAVYSLGSDCGSLGLTTVASLSSSMSSVKSSVGALDLMTIPYSGYNNDMCTDFDGAMSG 299

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-----------TLQICEYMR 336
           + N    +     ST  +K++ F++DG    +     +                 C+ ++
Sbjct: 300 M-NGVIPAQGDGSSTSPQKWLFFVSDGVADYSYPTTCSKTVLSGGRCQEPLNTTTCDTLK 358

Query: 337 NAGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELLESF 380
             G+KI   Y+  ++                    +++ C    G ++ V+ S  +  + 
Sbjct: 359 ARGIKIAVLYTTYLAITNNSWYTTYIAPWRDSISGIMKSCAS-PGYYYEVDSSGSIGAAL 417

Query: 381 DKITDKIQEQ 390
             +  +    
Sbjct: 418 TALFQQAIAS 427


>gi|327541799|gb|EGF28311.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 363

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/386 (12%), Positives = 115/386 (29%), Gaps = 73/386 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI++ +  + + ++ID+A +   R +++S+ DAA  +   ++           +  Q 
Sbjct: 40  LIAIMMFLFLIVVAFSIDIAQMHLARTELRSSTDAAANAAATTLADTLDRNLAIQRGQQI 99

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQ--INITKDKNNPLQYIAESKAQYEIPTENL 118
           +       +  L      +    D     +   N  +   N ++   +  A        L
Sbjct: 100 AQANLVNGQPLLLADGDFQFGRSDRQVNGKYAFNAGEAPFNGVRVNGQRTAGSLSGPVPL 159

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
           F   +  +++      +T             I +V+D S SM                  
Sbjct: 160 FFGNVTGTSIFEPEAFATATYVE------RDITLVVDRSGSMAG---------------- 197

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                                         + + L  +     + +     +      +I
Sbjct: 198 -----------------------------SRFNDLQAAIRIFTDLLATTPVD-----EQI 223

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           G  +YN     +    L+ N  EV + +++L     T+    M          +      
Sbjct: 224 GLASYNDRASED--VQLTENFAEVNNAMDRLRTGGFTSISRGMQAGQEIALRGRPPEFVE 281

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                    +I +TDG ++             +   +   G+ I+++   A  +   +  
Sbjct: 282 RT-------MIVMTDGRHNRG------PEPRVVATDLAADGVTIHTITFGAGADFGRMQD 328

Query: 359 KCTDSSGQFFAVNDSRELLESFDKIT 384
                 G+ F   +  +L + + +I 
Sbjct: 329 VARIGGGRHFHATNGDQLRDIYREIA 354


>gi|167644155|ref|YP_001681818.1| Flp pilus assembly protein TadG [Caulobacter sp. K31]
 gi|167346585|gb|ABZ69320.1| Flp pilus assembly protein TadG [Caulobacter sp. K31]
          Length = 562

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 63/533 (11%), Positives = 132/533 (24%), Gaps = 141/533 (26%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSD-------RTIKDPT 54
            A+++    +     ID++     + Q+Q ALDAA L    S  +              T
Sbjct: 29  FALLLIPIAVLTFGLIDISRASVQKRQLQDALDAATLMAARSTATTNADLDTIGDAALAT 88

Query: 55  TKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
                  T         L   + +     ++  K  I+      N       +  +    
Sbjct: 89  EMAGLGVTFGPGNSSFVLGDNNTVVGTIQNVVIKPIISNLWSSTNTPVSATATVMRSINH 148

Query: 115 TENLFLKGLIPSA---------------------------------------------LT 129
            E   +     S                                                
Sbjct: 149 LEVALVLDNTGSMASSLGSGGSKITALITASKSLVDVLSAAAARATEADAVKISVVPFSM 208

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHN---------DNNNMTSNKYL 180
            +++ ST   + S           +D   + ++ +    N         ++     +   
Sbjct: 209 TVNIGSTYQTQTSWLTGTQPAAYGVDNFATSQNRFTLLSNLGLTWGGCVESRPAPFDVTD 268

Query: 181 LPPPPKKSFWSKNTTK-------SKYAPAPAPANRKIDVLIESAGN------LVNSIQKA 227
             P P                  +    + + + +  D    S         L +++   
Sbjct: 269 DAPNPAIGASMFVPFFAPDEPDDNTVNISASSSTKYRDARRYSTSYPITNTYLTDTVTPT 328

Query: 228 IQEKKNLSVRIGTIAYNIGIVGNQCTPLS--------------------------NNLNE 261
                  S R   +A            L+                           + + 
Sbjct: 329 GTATNAWSTRSTVVAKYATSNKATLLSLAKTGTAYGPNAGCGMTSLMRLTNVKAKADRDT 388

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS----HNTIGSTRLKKFVIFITDGENS 317
           VK +L+++    NTN    +   +  L      +      T    R  K ++ +TDG+N+
Sbjct: 389 VKGKLDQMIASGNTNVAMGLIWGWHTLSKNAPFADGVDPATTVGKRTTKVIVLLTDGDNT 448

Query: 318 GASAYQNTLNTLQ-------------------------------------ICEYMRNAGM 340
             +      +                                         C   + AG+
Sbjct: 449 NDTYNNPNASIYTGYGYITQGRLLNASNSPLGATSTATNRRDAIDSREARACTNAKAAGV 508

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +IY++ V      + +L+ C      ++ V D+ +L   F+ I   IQ   + 
Sbjct: 509 QIYAIGVGVSSHSRGILQDCASKPEMYYDVTDAAQLASVFNTIAGSIQNLRIT 561


>gi|312878233|ref|ZP_07738157.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311794982|gb|EFR11387.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 1221

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/343 (11%), Positives = 102/343 (29%), Gaps = 40/343 (11%)

Query: 57  KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
            +QT T  +   +  +     I     +        I       +     +  +      
Sbjct: 394 DEQTGTKVEVVAEGDISPFVEINSLKDEEVFSEIYGIVSTP---VDIEVYAPFKEATVFI 450

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDL-------YLQKHN 169
            +    +      N+ +        +   L       ++     +         +     
Sbjct: 451 PIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPINKVVWAKTDHFTTFVLFYIPTW 510

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                           ++  +         +      N        +A + V+++ +   
Sbjct: 511 KAIWEVPINKGEREVNQQIKYIDLV-FVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGD- 568

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
                  R   + ++         PL+ +   VK+ +++++ +  TN    +  A  +L 
Sbjct: 569 -------RAAVVDFDDYGYL--LQPLTTDFQTVKNAIDRIDSWGGTNIAEGIRIANHQL- 618

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
                   +  S    K +I +TDGE    +               +N G+ IY++ +  
Sbjct: 619 -------ISQSSDDRIKVIILLTDGEGYYDNNLT---------TEAKNNGITIYTIGLGT 662

Query: 350 PPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQS 391
               ++LLR     + G +F V+ + +L + F +IT+ + E  
Sbjct: 663 -SVDENLLRNIATQTGGMYFPVSSASQLPQVFKRITEIVTEPI 704


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/346 (12%), Positives = 99/346 (28%), Gaps = 46/346 (13%)

Query: 57  KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
            DQT T  +   +  +     I     +        I       +     +  +      
Sbjct: 360 DDQTGTKVEIVAEGDISSFVEINNLKDEEVFSEIYGIVSTP---VDIEVYAPFKEATVFI 416

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDL-------YLQKHN 169
            +    +      N+ +        +   L       ++     +         +     
Sbjct: 417 PIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPVNKVVWAKTNHFTTFVLFYIPTW 476

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTT---KSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                           ++  +         S       P   +          L+   + 
Sbjct: 477 KAIWEVPINKGEREINQQVNYIDLVFVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGDRA 536

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
           A+ +  N                    PL+ +   VK+ +++++ +  TN    +  A +
Sbjct: 537 AVVDFDNFGY--------------LLQPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQ 582

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
           +L         +  S    K +I +TDGE    +               +N G+ IY++ 
Sbjct: 583 QL--------ISRSSEDRIKVIILLTDGEGYYDNNLT---------TEAKNNGITIYTIG 625

Query: 347 VSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQS 391
           +      ++LLR     + G +F V+ + +L + F +IT+ + E  
Sbjct: 626 LGT-SVDENLLRDIATQTGGMYFPVSSASQLPQVFKRITEIVTEPI 670


>gi|327541056|gb|EGF27607.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 497

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/417 (12%), Positives = 132/417 (31%), Gaps = 44/417 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  L   + I+LA +  ++ ++  A DAA  +G  +   ++T++        T
Sbjct: 89  LMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEAAKAAARLT 148

Query: 61  STIFKKQIKKHLKQGSYIRENAG------DIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
           + + +   + +                        +   TK   + +     + +   I 
Sbjct: 149 AAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLVAVSSVRIN 208

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSE----NLAISICMVLDVSRSMED--LYLQKH 168
            +      L P      +  S G     +      +   I +VLD S SM+         
Sbjct: 209 GKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDWKTYDWPDD 268

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP--APAPANRKIDVLIESAGNLVNSIQK 226
            D     S             W     + +Y    +      + D+   +   +      
Sbjct: 269 ADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWEEVFGLGPA 328

Query: 227 AIQ----------------EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                              ++   + ++   +YN     +    L ++ + V++ + +L 
Sbjct: 329 PNTPWEDLVLAVDAFLRVLDQTPQNEQVSIASYNSHGTLDCW--LLDDFDSVRAAVAQLG 386

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P  +T     M+       +E              K ++ +TDG ++  +          
Sbjct: 387 PNGSTGIGNGMNSGKTAFTHENAR-------PYASKTMVVMTDGNHNYGTQPNTVAQ--- 436

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
             + M ++ + I +V      + + +        G+ +  +   EL+ +F++I + +
Sbjct: 437 --QLMSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIANNL 491


>gi|283852082|ref|ZP_06369356.1| von Willebrand factor type A [Desulfovibrio sp. FW1012B]
 gi|283572472|gb|EFC20458.1| von Willebrand factor type A [Desulfovibrio sp. FW1012B]
          Length = 442

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/464 (12%), Positives = 126/464 (27%), Gaps = 111/464 (23%)

Query: 10  FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK 69
                 A+DL+ +    NQ+Q+A+DAA L+G   +  D  + +            K  + 
Sbjct: 1   MAAAGVAVDLSRVYVAHNQLQNAVDAAALAGSLQLPDDPDVTNGK---------VKAAVT 51

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALT 129
            +L        +                        ++KA  ++         +I    T
Sbjct: 52  ANLALNDPDATDIQ----------VTSGGATRSVCVDAKANVDMTL-----TKVIGIGDT 96

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSF 189
            ++  +            I + +VLD + SM+   +    D      N  +         
Sbjct: 97  TVTAEACAGYN------DIELVLVLDSTGSMKGSPIDSAKDAARDLVNLIMPASTSSTRS 150

Query: 190 WSKNTTKSKYA----PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN- 244
                            P  A R  D +     N   ++     + +       T  +  
Sbjct: 151 KIGLVPFQGKVRIDGSDPVTAERNPDGVGPGCRNADGTLNTGKLKVEYSRTATSTNIFYG 210

Query: 245 ------------IGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELY 289
                            +    LS++ N + + +  +N       T     +    + L 
Sbjct: 211 YTLSGVSTFTDKTCSGMSPIRALSSDKNTILNNIEAINAGAVTSGTLISEGIKWGRKVLS 270

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--------------------- 328
            E      +     ++K +I +TDG+        N  +                      
Sbjct: 271 PEAPYVEGSTDKK-VRKIMIVLTDGDTEDGRCGGNFASASKTVNTYWTNAYFGQGLKPDT 329

Query: 329 -------------------------------LQICEYMR---NAGMKIYSVAVS-APPEG 353
                                          L   +  +   N  ++I+SV    +    
Sbjct: 330 ATSPYATLSTATATLAQIPDCKDGGKLNQFVLDEADAAKNDLNYPVEIFSVRFGASDATD 389

Query: 354 QDLLRKCTD----SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           + L++K       ++  ++    S  + + F KI  ++ ++ + 
Sbjct: 390 KSLMQKIASSKPGTTDHYYDAPSSTGIQDMFKKIGQQLGQRLMT 433


>gi|90422080|ref|YP_530450.1| hypothetical protein RPC_0556 [Rhodopseudomonas palustris BisB18]
 gi|90104094|gb|ABD86131.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 453

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 65/443 (14%), Positives = 129/443 (29%), Gaps = 74/443 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  +    + I  AID A    IR++MQSA DAA + G  S  S   +   +   D  
Sbjct: 23  LFAFSLIPLLVAIGCAIDYARATQIRSKMQSAADAASV-GSVSKASPAFLAAGSMTTDGP 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +              +   +G    K    +TK     L       A        +  
Sbjct: 82  IAVGSTDATNIF--NGNMASQSGYTLSKLDAAVTKS-GATLTSTVTFSASVATTFLTIIG 138

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
           K  +    T++S  S          + I   ++LD S SM               ++   
Sbjct: 139 KTALAIGGTSVSTSSM--------PVYIDFYLLLDNSPSMGVGATPTDVATMVDNTSDKC 190

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                  +        +K          +IDVL ++   L+++             R+  
Sbjct: 191 AFACHDVNDEHNYYELAK----TLGVKTRIDVLRDATQQLMDTAAATATYPNQF--RMAI 244

Query: 241 IAYNIGIVGNQCTPL-----SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-- 293
             +           L     S +  +  +    L   +  N       +Y +L    +  
Sbjct: 245 YDFGASAQSAALRRLFALSSSLSSAKTAAGAIDLMTVKGQNDNDDRDTSYSKLLPAIDKQ 304

Query: 294 -SSHNTIGSTRLKKFVIFITDGENSGASAYQNTL----------------NTLQICEYMR 336
            ++     S   +K+++F++DG     +A                         +C+ M 
Sbjct: 305 ITAAGAGTSDAPQKYLLFVSDGVADETNAGCAKTMKNAFWGNKSPRCQSPIDPALCKAMT 364

Query: 337 NAGMKIYSVA-----------------------------VSAPPEGQ--DLLRKCTDSSG 365
           + G+K+  +                                  P  +  + ++ C    G
Sbjct: 365 DRGVKVAVLYTTYLALPLKQANGDPSWYASWIAPFNVGPYGPSPNSEIANNMKACAS-PG 423

Query: 366 QFFAVNDSRELLESFDKITDKIQ 388
            +F V+ +  + ++ + I  K  
Sbjct: 424 FYFEVSPTDGIADAMNAIFRKAV 446


>gi|146338996|ref|YP_001204044.1| hypothetical protein BRADO1945 [Bradyrhizobium sp. ORS278]
 gi|146191802|emb|CAL75807.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 432

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/430 (11%), Positives = 121/430 (28%), Gaps = 67/430 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID +  +  + ++ +++DAA+L+         +  D  T     
Sbjct: 25  IFAIALLPILAFIGSAIDYSMAVRAKAKLSASIDAALLAATGYTAMRGSSSDAKTAAT-- 82

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +F  Q+  H    + +  +  D      +  +                          
Sbjct: 83  -NMFNGQMSAHKLTSNSLSIDITDSVSARTVTGSAT-----------------VVVKTSF 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +       +S  S+           +   +++D S S                +    
Sbjct: 125 MYMFGYPTMTVSASSSASASF---PTYMDFYVLVDNSPSQGLGATTADMTTLQNATTDTC 181

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPA----PANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                     S   T    +            +IDV+  +  +L ++   +         
Sbjct: 182 AFACHDTYTSSSKKTLQTNSYYDKAKKLGVTMRIDVVRSATQSLTDTATSSQIVSNQ--Y 239

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP---------YENTNTYPAMHHAYRE 287
           R+   +          T +++  + + S  + +             N +           
Sbjct: 240 RMAVYSMGADCGSLGLTTVASLSSSMSSVKSSVGALDLMTIPYSGYNNDMCTDFDGTMSA 299

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN-----------TLQICEYMR 336
           + +    +     ST  +K++ F++DG    A     +             T   C  ++
Sbjct: 300 M-SGVIPTQGDGSSTNPQKWLFFVSDGVADYAYPTTCSKTTQSGGRCVEPLTTTTCTALK 358

Query: 337 NAGMKI---YSVAVSAPPEGQ-------------DLLRKCTDSSGQFFAVNDSRELLESF 380
             G+KI   Y+  ++    G               +++ C    G ++ V+ S  +  + 
Sbjct: 359 ARGIKIAVLYTTYLAITSNGYYNTWVKPWRDSIGTIMKSCAS-PGYYYEVDSSGSIGSAL 417

Query: 381 DKITDKIQEQ 390
             +  +    
Sbjct: 418 TALFQQAIAS 427


>gi|83951473|ref|ZP_00960205.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
 gi|83836479|gb|EAP75776.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
          Length = 550

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/372 (12%), Positives = 91/372 (24%), Gaps = 76/372 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M  +   +       A+D+      R Q+QS LD+AVL+   +                 
Sbjct: 1   MALVFFLIMIAAGGIAVDMMRYEMKRAQIQSTLDSAVLASAGAPYGS-----------DH 49

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             I +   +          E  G+I                     + A     T + +L
Sbjct: 50  RAIIEDYFRVANMTDYLAAEKEGEIVVTVN-----------SASVTANADM---TMDTYL 95

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L        +  ST       +   + + +VLDVS SM       +           L
Sbjct: 96  MKLSGIKELRTTGGSTA----VRKVPKLEVVLVLDVSGSMGSNSKLVNLKKAAKEFVTSL 151

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPAN-----RKIDVLIESA------------------ 217
           L      +        S                +                          
Sbjct: 152 LNGSEPGNTVISIVPFSWSVSPSVATFEALAVDRKHEFSTCIRFKANDHSHASLATGNSG 211

Query: 218 -------GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                    ++ +      ++ + S               +  P S +  E+ ++++ L 
Sbjct: 212 FSSGQPLDQMIYTALYGNFDEFSGSESSSDYRSCYANDYMEILPFSVSETELHAKIDSLQ 271

Query: 271 PYENTNTYPAMHHAYRELYNEKES-----------------SHNTIGSTRLKKFVIFITD 313
              NT+    M      L                         +  G+    K  + + D
Sbjct: 272 ASGNTSGNQGMIWGAALLDPSFRQITDDLIAAGEVASSQAAIPSNYGTAETLKVAVVMGD 331

Query: 314 GENSGASAYQNT 325
           G+N+ +  + N 
Sbjct: 332 GQNTTSYFFSNG 343



 Score = 66.5 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 94/375 (25%), Gaps = 45/375 (12%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+   S  S     D              +         Y    A D  +    ++++
Sbjct: 203 ASLATGNSGFSSGQPLDQMIYTALYGNF--DEFSGSESSSDYRSCYANDYMEILPFSVSE 260

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
            + +      ++          ++   L+  +   ++       E +S   AI       
Sbjct: 261 TELHAKIDSLQASGNTSGNQGMIWGAALLDPSFRQITDDLIAAGEVASSQAAIPSNYGTA 320

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
            +  +  +     N  +                F+S                 +  V   
Sbjct: 321 ETLKVAVVMGDGQNTTS---------------YFFSNGGQWRGQNSDLYEVKSQKRVFKY 365

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +     N   K   ++   S       Y           L +N  +        N Y NT
Sbjct: 366 AYRK--NKKDKISYDQSKCSNNSWECVYESSGEIESAFYLHDNYGD--------NRYYNT 415

Query: 276 NTYPAMHHA-YRELYNEKESSHNTIGST-----RLKKFVIFITDGENSGA---------S 320
                +  + + +L +  E               +  +  +   G+ +            
Sbjct: 416 EEGEYLSSSDWDDLQDSDEFVSMRRLDWEEAWGYMSPYYYYQVTGDPNAYYDYYYYDRLD 475

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAP--PEGQDLLRKCTDSSGQFFAVNDSRELLE 378
             +        C   +N G+ ++S+          + +L+ C  S   +F       + +
Sbjct: 476 GSEKDTRMKASCTATKNEGVVVFSIGFEIDQGGTAEQVLKNCASSENHYFRAEGIN-IND 534

Query: 379 SFDKITDKIQEQSVR 393
           +F  I   +    + 
Sbjct: 535 AFSAIASNVVNLRLT 549


>gi|32474888|ref|NP_867882.1| hypothetical protein RB7557 [Rhodopirellula baltica SH 1]
 gi|32445428|emb|CAD75429.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 327

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/386 (12%), Positives = 114/386 (29%), Gaps = 73/386 (18%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI++ +  + + ++ID+A +   R +++S+ DAA  +   ++           +  Q 
Sbjct: 4   LIAIMMFLFLIVVAFSIDIAQMHLARTELRSSTDAAANAAATTLADTLDRNLAIQRGQQI 63

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQ--INITKDKNNPLQYIAESKAQYEIPTENL 118
           +       +  L      +    D     +   N  +   N ++   +           L
Sbjct: 64  AQANLVNGQPLLLADGDFQFGRSDRQVNGKYAFNAGEAPFNGVRVNGQRTTGSLSGPVPL 123

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
           F   +  +++      +T             I +V+D S SM                  
Sbjct: 124 FFGNVTGTSIFEPEAFATATYVE------RDITLVVDRSGSMAG---------------- 161

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
                                         + + L  +     + +     +      +I
Sbjct: 162 -----------------------------SRFNDLQAAIRIFTDLLATTPVD-----EQI 187

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
           G  +YN     +    L+ N  EV + +++L     T+    M          +      
Sbjct: 188 GLASYNDRASED--VQLTENFAEVNNAMDRLRTGGFTSISRGMQAGQEIALRGRPPEFVE 245

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                    +I +TDG ++             +   +   G+ I+++   A  +   +  
Sbjct: 246 RT-------MIVMTDGRHNRG------PEPRVVATDLAADGVTIHTITFGAGADFGRMQD 292

Query: 359 KCTDSSGQFFAVNDSRELLESFDKIT 384
                 G+ F   +  +L + + +I 
Sbjct: 293 VARIGGGRHFHATNGDQLRDIYREIA 318


>gi|114571147|ref|YP_757827.1| hypothetical protein Mmar10_2603 [Maricaulis maris MCS10]
 gi|114341609|gb|ABI66889.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 520

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/495 (9%), Positives = 124/495 (25%), Gaps = 103/495 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +    L    A+DL+  M  R+++  ALDAA L+   +     +           
Sbjct: 24  IFALTLVPVALLSGGAVDLSQSMNARSRLAQALDAAALAVGVNTNLSSSEATGIANDFIA 83

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA----------ESKAQ 110
           +    +++        YI +    +    +  +       +               ++ +
Sbjct: 84  ANYPGRELGVVQNVNVYIDDETDTVTVSGEARVRTTMLGMIGLDYITVHWESEVQRARQR 143

Query: 111 YEIPTENLFLKGLIPSALTNLSLRST---------GIIERSSENLAISICMVLDVSRSME 161
            E+         +  S + NL   +                 +   +     ++V  +  
Sbjct: 144 LELVMVLDNTGSMGGSKIRNLRESAELLTGILFDAADDPSDVKIGLVPFAATVNVGTNHA 203

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS--------KYAPAPAPANRKIDVL 213
             +    +  + + +      P   ++   +   +                    +    
Sbjct: 204 RAWWMDPDALSPVHAEWAGGNPVEIETCSGRGRGRRRRCQTEEIWVNHWDLFDQLRNTGW 263

Query: 214 IESAGNL-----VNSIQKAIQEKKNLSVRIGTIAYNI----------------------- 245
                       ++    +I     L V                                
Sbjct: 264 EGCVEARPIPMDIDDTPPSIGNPSTLFVPYFAPDEPDNGSYSNSYLSDGVSGGVSERLQA 323

Query: 246 ----------------GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
                                  TPL++    V + +  +     TN    +    R + 
Sbjct: 324 LDKYDNGRPNREGPNRSCTTTPVTPLTSTERTVLNAIGDMGASGTTNIPNGVGWGIRLIS 383

Query: 290 NEKE-SSHNTIGSTRLKKFVIFITDGENSGASAYQN------------------------ 324
                +  +        K ++ +TDG+N       +                        
Sbjct: 384 PGAPFTEGSAWDDDEYIKAMVILTDGDNVMRGRNTDQMSDYEAYGFVADGRLGRRSSSSN 443

Query: 325 ------TLNTLQICEYMRNAGMKIYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELL 377
                    T   C Y R+ G+++Y++         + L++ C  +   +F    S  L 
Sbjct: 444 VLSNELDDRTEAACAYARSLGIRVYTITFQVNSSSTRSLMQNCASNPSLYFDSPSSEALE 503

Query: 378 ESFDKITDKIQEQSV 392
           ++F+ I   +    +
Sbjct: 504 DAFEMIAGDLTNLRL 518


>gi|170746808|ref|YP_001753068.1| hypothetical protein Mrad2831_0362 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653330|gb|ACB22385.1| conserved hypothetical protein; putative vWFA domain protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 437

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 59/422 (13%), Positives = 122/422 (28%), Gaps = 63/422 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A++          A+D       + Q+ +ALD AVL+  +   +          + Q  
Sbjct: 31  FALVTLPVMFATAAAVDYGRRNAAKTQLDAALDGAVLAVMSQKTNTIPTTTLQNMETQFR 90

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           T   K        G  +              ++   +          +  +IP       
Sbjct: 91  TEAAKV------PGVTVTSFTPGAPVNTSKTLSLTASYTATVKTSLASMMQIPAMP---- 140

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN-KYL 180
                        S       + +  I+  ++LD S SM          N  + +N    
Sbjct: 141 ------------VSGTSSATRNTSQYINYYLLLDNSPSMGLAATDADVQNMKIATNGCAF 188

Query: 181 LPPPPKKSFWSKNT----TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                        T      + +         +I VL E+   LV+    ++   +    
Sbjct: 189 ACHQHTFDKKGNITGDDQNDNYHIALRNNIKLRIQVLREAVSALVDQANVSMLLPQQF-- 246

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTY-PAMHHAYRELYNEK 292
           ++    +N  +   +   ++  LN +K+    ++    Y N +        A   +    
Sbjct: 247 QMEMWTFNDSVTQTKLQAMTPTLNNIKNAAPNIDIAYAYYNQSDNQTDFERAIARMNTTI 306

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI-------------CEYMRNAG 339
            +S + +   +  +F+  +TDG      +  N     QI             C  ++N  
Sbjct: 307 PASGDGLTPDKPIRFLFLVTDGVEDTGGSVTNQSAGFQIQSNRFIGPLSPSTCSALKNKN 366

Query: 340 MKIYSVAVSA-PPEGQDL---------------LRKCTDSSGQFFAVNDSRELLESFDKI 383
           +KI  +     P    D                L+ C    G +F V  + ++  +  K+
Sbjct: 367 VKIGIIYTQYLPIYDNDFYNRYVRPYESQIGPSLQACAS-DGMYFPVTTNGDITAAMLKL 425

Query: 384 TD 385
             
Sbjct: 426 FS 427


>gi|163761157|ref|ZP_02168234.1| hypothetical protein HPDFL43_13595 [Hoeflea phototrophica DFL-43]
 gi|162281708|gb|EDQ32002.1| hypothetical protein HPDFL43_13595 [Hoeflea phototrophica DFL-43]
          Length = 444

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/434 (12%), Positives = 130/434 (29%), Gaps = 53/434 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +++         A+D ++ + ++   Q  +DA VL     I+ +           + 
Sbjct: 20  LAGLVMVALVWVAGLAVDFSNALRVKTTAQDIVDATVLRATRDIIEEG------KTLAEA 73

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK---DKNNPLQYIAESKAQYEIPTEN 117
               +K     L   S +            ++              + ++  + EIP   
Sbjct: 74  ELSARKYFDAELAFSSGVGLEVSTFTLTQGVDGIVKLGVSGKTSTSLLKAVGREEIPVSV 133

Query: 118 LFLKGLIPSA-------LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                +   +           S+        ++  +A ++  +   S SM   ++   + 
Sbjct: 134 DAAAHVGGGSVEIAIAFDVTNSMGFGTTWGEATSVIASALNALKANSGSMALTFIPFTDR 193

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI-- 228
            N       LL P  +         K  +         K     E+   + +S  +    
Sbjct: 194 VNVGMGRANLLNPGDQ-----TAVKKGGWGGCVDVRATKKKNKGETEYFMPDSAPEKGDR 248

Query: 229 -QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
             +  N +       Y +          ++N+++V S+L KL               +  
Sbjct: 249 FTKFDNGTPAAHKSGYKLACNPQSIIGPTSNVSDVTSQLGKLTKGGTGRFDLGFAWLWYA 308

Query: 288 LYNEKESSHNTI--------------GSTRLKKFVIFITDGENSGASAYQ---------- 323
           L    +   +                 ST  +K  +  TDG  +                
Sbjct: 309 LSPNWKGFWSGGAPADNGVNLADYPTASTNTRKIAVLATDGLTNAYVYEYGKTNLAGWNT 368

Query: 324 ----NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  N + IC+ M    ++++ + V+   + +   R+C   + G ++ V   + L++
Sbjct: 369 GSKDHFENVVAICKSMAAQKIEVHVMHVNGNDKAEPYFRECASATGGGYYKVASKQTLVD 428

Query: 379 SFDKITDKIQEQSV 392
           +   IT+      +
Sbjct: 429 ALTGITNGGGNLRL 442


>gi|85705211|ref|ZP_01036310.1| hypothetical protein ROS217_17122 [Roseovarius sp. 217]
 gi|85670084|gb|EAQ24946.1| hypothetical protein ROS217_17122 [Roseovarius sp. 217]
          Length = 580

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/362 (13%), Positives = 94/362 (25%), Gaps = 71/362 (19%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            I  +  +     +D       R  +Q+ LD AVL+G  +                  TI
Sbjct: 33  FIFVMFLMMGGIGLDTMRQEMARASLQATLDRAVLAGATASTEAG-----------ARTI 81

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
            +    K  +    + +  GDI+                   +  A  E+  +  +L  L
Sbjct: 82  VEDYFAKSGQSDYLLAQKDGDISTTLNAA-------------KVTAGAELSLD-TYLMKL 127

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                 + S  +T  +        +   +VLDVS SM      ++           ++  
Sbjct: 128 AGVPTLSASGTATAEVRI----PKLEAILVLDVSGSMASNSKIQNLQTAAKDFVTTVMNS 183

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANR-----KIDVLIESAGNLVNSIQKAIQE-------- 230
                        S     P          +            N  Q A           
Sbjct: 184 SKPGDTVMSIVPFSFSVTPPQSVFDALAVEETHNYSTCLEFKENDYQHATLSSGSSSLSS 243

Query: 231 --KKNLSVRIGT----------IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
               N  V                        +  P S ++ ++ ++++ L P  NT+  
Sbjct: 244 GIPVNQMVYTSVYGDFDNLDSGWRSCYTDEYIRILPYSTSITDLHAKIDALQPAGNTSGN 303

Query: 279 PAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDGENSGASA 321
             M+     L                      +  +        K +IF+ DG N+ +  
Sbjct: 304 EGMNWGAALLDPTFREVTASMIAAGHLSETLANVPSDYDEPETLKAIIFMGDGANTTSYF 363

Query: 322 YQ 323
           + 
Sbjct: 364 FD 365



 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/207 (11%), Positives = 57/207 (27%), Gaps = 18/207 (8%)

Query: 189 FWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV 248
            ++ N     +         +     ++    V  + +   E     +R         + 
Sbjct: 389 KYAYNIYNVDWKKYGDDGKSRC---SQNRWECVYDVAENSPEYSVYYLRNPDTGKFWSVA 445

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
             +    +N  N  +S ++       T     M           +++ N           
Sbjct: 446 EEKWIE-ANTFNNFESTMDGFISR--TQLDWEMAWGLMSPEYYGQTTGNWGPWNDYIGSE 502

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQ 366
                      S          +C+  +  G+ +YS+    P  G  ++ L  C  S   
Sbjct: 503 FV---------SGSMKNGLMQNVCKATKTEGVVVYSIGFEVPVNGTAENQLSACASSPAH 553

Query: 367 FFAVNDSRELLESFDKITDKIQEQSVR 393
           +F      ++  +F  I   +++  + 
Sbjct: 554 YFRA-SGTDIKSAFSAIAANVKQLRLT 579


>gi|312622403|ref|YP_004024016.1| von willebrand factor type a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202870|gb|ADQ46197.1| von Willebrand factor type A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 1166

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/346 (12%), Positives = 100/346 (28%), Gaps = 46/346 (13%)

Query: 57  KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
            DQT T  +   +  +     I     +        I       +     +  +      
Sbjct: 360 DDQTGTKVEIVAEGDISSFVEINNLKDEEVFSEIYGIVSTP---VDIEVYAPFKEATVFI 416

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDL-------YLQKHN 169
            +    +      N+ +        +   L       ++     +         +     
Sbjct: 417 PIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPVNKVVWAKTNHFTTFVLFYIPTW 476

Query: 170 DNNNMTSNKYLLPPPPKKSFWSKNTT---KSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                           ++  +         S       P   +          L+   + 
Sbjct: 477 KAIWEVPINKGEREINQQINYIDLVFVLDSSGSMSWNDPNGYRKIAAKSFVDALIQGDRA 536

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
           A+ +  +                    PL+ +   VK+ +++++ +  TN    +  A +
Sbjct: 537 AVVDFDDFGY--------------LLQPLTTDFQAVKNAIDRIDSWGGTNIAEGIRIANQ 582

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
           +L         ++ S    K +I +TDGE    +               +N G+ IY++ 
Sbjct: 583 QL--------ISLSSEDRIKVIILLTDGEGYYDNNLT---------TEAKNNGITIYTIG 625

Query: 347 VSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQS 391
           +      ++LLR     + G +F V+ + +L + F +IT+ + E  
Sbjct: 626 LGT-SVDENLLRDIATQTGGMYFPVSSASQLPQVFKRITEIVTEPI 670


>gi|238762416|ref|ZP_04623387.1| tight adherance operon protein [Yersinia kristensenii ATCC 33638]
 gi|238699401|gb|EEP92147.1| tight adherance operon protein [Yersinia kristensenii ATCC 33638]
          Length = 459

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/439 (10%), Positives = 110/439 (25%), Gaps = 69/439 (15%)

Query: 11  LFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKK 70
                 ++++  +  + ++  A++ A L+              T        +       
Sbjct: 37  ALTFIILEVSIFLQKKAKLSDAIEQATLALTVENDGIPNAAQQTK----NRELVLSYANA 92

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP-SALT 129
           +L    +               I    +N       +      P E L    L    +  
Sbjct: 93  YLPSEGFSD------------PIINIDDNTNYLGYNAAVTMTYPVEFLGRSPLTNSISNI 140

Query: 130 NLSLRSTGIIERS-SENLAISICMVLDVSRSMEDLYLQK--------------------H 168
             +     I  ++   +    +  V D S SM   +                       +
Sbjct: 141 QTTDNGEAIKNKTIEVSEPTDVVFVADYSGSMLLSFSDDVSIKNGERINALRSAFRILHN 200

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID------------VLIES 216
              NN   N     P    +    +           P + KI                 +
Sbjct: 201 TIKNNSNVNTIGFIPFGSGTKRKVSENGENKEYCHLPFSPKIYKPNGDYLSENAEATKNA 260

Query: 217 AGNLVNSIQKAIQEKK----NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR------- 265
              L         +K       +V+   I          C   +N+ +  + +       
Sbjct: 261 WTFLDVIGDHIDYKKTIMSITENVQPIDIPMRDIKHKEICLSGTNSYSLEREQFDYSIEN 320

Query: 266 LNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
           + ++ P   T     +  A        ++ H  +          + +    +       T
Sbjct: 321 IIEMAPLGGTLISSGILSANNIFKETADNGHKKLMIILSDGMDSYNSTMLPNKGFFISKT 380

Query: 326 LNTLQICEYMRNAGMKIYSVAV------SAPPEGQDLLRKCTDSSGQFFAVNDSRELL-E 378
           L    +CE +   G+++  +A+      +         ++C      ++  +++ EL  E
Sbjct: 381 LIDEGMCEMIIKNGIQMAFIAIAYSPENNVNAPEYINWKQCV-GEDNYYEAHNAHELELE 439

Query: 379 SFDKITDKIQEQSVRIAPN 397
               ++     +  R  P 
Sbjct: 440 LQQAVSVSATSEVGRNTPK 458


>gi|86144309|ref|ZP_01062641.1| Flp pilus assembly protein TadG [Vibrio sp. MED222]
 gi|218676258|ref|YP_002395077.1| putative Flp pilus assembly protein TadG [Vibrio splendidus LGP32]
 gi|85837208|gb|EAQ55320.1| Flp pilus assembly protein TadG [Vibrio sp. MED222]
 gi|218324526|emb|CAV26007.1| putative Flp pilus assembly protein TadG [Vibrio splendidus LGP32]
          Length = 438

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/447 (10%), Positives = 125/447 (27%), Gaps = 77/447 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++    +F+ +++ ++  M   +++  A + A L+  AS   D             
Sbjct: 14  LFVGLLPAMVIFMAFSMQMSQQMLAHSRLLEAAEVASLALIASPKEDEDKN-----VKYA 68

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +  + I  + +             +   +  + +      ++  + A+Y         
Sbjct: 69  RYLVDRYILDNSEDVDVAVFTRKCEYKDGCVQASGELAPFSDFVVSATAKYTSWI----- 123

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND------NNNM 174
                  L      S   + R     ++ +  + D S SM + +                
Sbjct: 124 -SYEDVDLEPEFTVSGRAVTRKYLPQSVDVYFIGDFSGSMGNSWKNGKMKLDVVKETIKR 182

Query: 175 TSNKYLLPPPPKKSFWSKNTTK-------SKYAPAPAPANRKIDVLIESAGNLVNSIQKA 227
             +        +KS  +             K     A           +     +S    
Sbjct: 183 VVDDIEKFNTEEKSRVALLGYNPFHVKQTDKTVRVNAYGYYGSWRKKYAYNYARSSPGTT 242

Query: 228 IQ-------------EKKNLSVRIGTIAYNI------GIVGNQCTPLSNNLNEVKSRLNK 268
           ++             E K    R      +               PL+ + +E +S+L  
Sbjct: 243 VRRMFDKPKLYNEILEPKRGMSRYEVERLHTHNVNFAKYYKFYDIPLTEDYDEFRSQLMN 302

Query: 269 --LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
             L     T+++  +  A +E             +   ++  I ++DG++   +  Q  +
Sbjct: 303 TKLQAGGGTSSWNGIIAAAQEANKA--------TNLNPEQVFIVLSDGQDGDKNYLQKLV 354

Query: 327 NTLQICEYMR-------------------NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQF 367
           +   +C+ +R                      + +  + ++      D    C       
Sbjct: 355 D-QGLCKKLRSTISAKRNRFQSNSPTEAEKTKVTMGVIGINYKVNESDGFGDC-FGKKNI 412

Query: 368 FAVNDSRELLESFDKITDKIQEQSVRI 394
           +   D     + +  I + I E++ ++
Sbjct: 413 YHAKDGE---DVYKYILNLINEETGKL 436


>gi|116753518|ref|YP_842636.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
 gi|116664969|gb|ABK13996.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
          Length = 795

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 76/227 (33%), Gaps = 21/227 (9%)

Query: 167 KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                + +++    L           +   S  +      +   D+   +A   V  +  
Sbjct: 39  DVISPSEISTVTITLRGGEIPCASPVDVVLSIDSSGSMTTSDPGDLRKSAAKEFVTGLDL 98

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYR 286
           ++     +S     I++          PL+NN  +++S ++      NT     +  A  
Sbjct: 99  SMDRVGVVSWNTSAISW----------PLTNNTKDIESAIDSTGADGNTCLDTGLKSAID 148

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            L                 K ++ +TDG ++    Y          +  R+ G+ ++++ 
Sbjct: 149 LLSE-----------CSGSKVIVLLTDGISTDGGHYTPPGVPGSPVDEARSKGILVFTIG 197

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +    + ++L      + G+F++  D+  L   + +I   I     +
Sbjct: 198 LGPDADARNLTEIAHSTGGEFYSAPDANALAGIYKRIRSSITGIVAK 244


>gi|254420933|ref|ZP_05034657.1| hypothetical protein BBAL3_3243 [Brevundimonas sp. BAL3]
 gi|196187110|gb|EDX82086.1| hypothetical protein BBAL3_3243 [Brevundimonas sp. BAL3]
          Length = 646

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/428 (11%), Positives = 102/428 (23%), Gaps = 50/428 (11%)

Query: 15  YAIDLAHIMYIRNQ------MQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQI 68
             +++      R +       QS   A  L+G    ++  +                  I
Sbjct: 217 MGVNVGDTYASRARGSLDSNTQSITAATWLTGSVKTITSISRAYTAVVTASKHGFKTGDI 276

Query: 69  KKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSAL 128
                  +    N   +   +    T            + +      +       I   L
Sbjct: 277 VTIWSAETMAPLNGVALTVGSVTTNTFSLVGEDSRYYSAFSGQAYVAKCARTDCNIVITL 336

Query: 129 TNLSLRSTGIIERSSENLAISIC----MVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
               L S G          +S        +              +  N  T+ K      
Sbjct: 337 ARHGLSSEGDAAVLGNMGGLSQLNNIGFRVASVTPTTATLALDASQANLATTAKGGAAYT 396

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI-AY 243
                       S      A                  S           S    +  + 
Sbjct: 397 SGGQLICGVDGCSNRDFVNAIGAWTRFPGTPCVSERAGSQAYTDAAPSASSWVGRSYASG 456

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-----SSHNT 298
                 +Q  PL+N    +   ++ +    +T  +  +   +  +           +   
Sbjct: 457 GNACPASQIVPLTNVKKTLTDAVDGMTAVGSTAGHIGLAWGWYLVSPNFGLWSGLGAPAA 516

Query: 299 IGSTRLKKFVIFITDGENSGASA-------------------------YQNTLNTLQICE 333
             S++  K V+ +TDGE +                               +     ++CE
Sbjct: 517 YDSSKTLKAVVLMTDGEFNTPYFRGVIASDAGNGSGGADTHINQPATNGSSFEQAYRLCE 576

Query: 334 YMRNAGMKIYSVAVSAPPEGQ---------DLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
            M+ A + +Y+V                  +L+ +C  +  + F  + S +L ++F  I 
Sbjct: 577 NMKAADVIVYTVGFDIGAARNMTGPIDSAGELMARCATNPDRAFQASSSTDLSDAFRDIG 636

Query: 385 DKIQEQSV 392
             I    +
Sbjct: 637 RDITRLRI 644


>gi|86361153|ref|YP_473040.1| hypothetical protein RHE_PF00423 [Rhizobium etli CFN 42]
 gi|86285255|gb|ABC94313.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 545

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/327 (13%), Positives = 100/327 (30%), Gaps = 32/327 (9%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LDAA+++    I +          K++ S
Sbjct: 122 VALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQINNTEDTD---ALKEKVS 178

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q+      G                       + + +   + A   +PT  +   
Sbjct: 179 DWFHAQVDNSYTLGD-------------------IDIDTVNHNITATANGTVPTTFM--- 216

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                A       S     +      +++ +V+D S SM                     
Sbjct: 217 ---KIANIETVPVSVASAVKGPATSYLNVYVVIDTSPSMLLAATTSGQSTMYSGIGCQFA 273

Query: 182 PPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K    + YA + A     + DV  ++   +++ I ++  ++ +  +++G 
Sbjct: 274 CHTGDAHTVGKTKYANNYAYSTAKKIKLRADVAGDAVREVLDMIDES--DENHERIKVGL 331

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPAMHHAYRELYNEKESSHNTI 299
            +    +       LS +    +           T+        +   L  +  +  +  
Sbjct: 332 YSLGDTLSEVLAPTLSTDTARTRLADASYGLTSATSKAATYFDVSLATLKQKVGAGGDGT 391

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTL 326
            S    K V+ +TDG  S      + +
Sbjct: 392 SSGSPLKLVLLLTDGVQSKREWVTDGV 418


>gi|323138519|ref|ZP_08073587.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
 gi|322396153|gb|EFX98686.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
          Length = 458

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 57/433 (13%), Positives = 136/433 (31%), Gaps = 55/433 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + +   F+ +  A+D    + +R+++    D A L+   +     +        +  
Sbjct: 33  IFGLALIPMFMMMGAAVDYTQAVTVRSRLNHLADRAALAAVKAAAQKESDCVANPAGNNV 92

Query: 61  STI----FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
           S       K  IK  +  G         +    +    +  ++   + A      +IPT 
Sbjct: 93  SNFQGCGQKDIIKAGVAAGVQYMNGDPLMRGADRKPTIELSSSEGSWSATVNYSADIPTN 152

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
              +  L+      ++ + T  I     ++ ++  ++LD S SM               +
Sbjct: 153 ---IARLMGVQTIPVNGKVTSNIALG-THMYLNFHLLLDRSMSMGIGATSDDISRLQALT 208

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                              +    P       +ID L ++ G LV   +          +
Sbjct: 209 GCAFACHSEG------YEAQYYDQPKAQGIRFRIDDLRDATGALVAQAKMVASANAREHI 262

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           ++G  A+N     +    ++++L  V + +  L+   + +   A       + N+ + + 
Sbjct: 263 QMGVYAFNH--HVSPLVEMTSDLTNVANAVKNLDLPTHDDGTQAADAVTWLVANKIKGNG 320

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLN----------------------TLQICEY 334
             + S    + V  +TDG   G     N +                        +  C+ 
Sbjct: 321 TGLTSAAPLEIVFLVTDGVEDGIYTGWNKMVGPTGLPLPWWPSWMTKAPTSAFPVTACDA 380

Query: 335 MRNAG---MKIYSVAVSAPPEGQ-------------DLLRKCTDSSGQFFAVNDSRELLE 378
           +++ G     +Y+  V  P   Q               L+ C    G FF  ++  ++  
Sbjct: 381 LKSKGAIVAVVYTTYVPFPGTVQYDRLIGPFAPNISPNLQGCASQ-GYFFTASEPGDITR 439

Query: 379 SFDKITDKIQEQS 391
               + ++  ++ 
Sbjct: 440 GMQSLFNRALQEL 452


>gi|302382135|ref|YP_003817958.1| von Willebrand factor A [Brevundimonas subvibrioides ATCC 15264]
 gi|302192763|gb|ADL00335.1| von Willebrand factor type A [Brevundimonas subvibrioides ATCC
           15264]
          Length = 560

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 68/530 (12%), Positives = 133/530 (25%), Gaps = 138/530 (26%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQ---------------------SALDAAVLS 39
           M A+ +    L     +D+A +  +R  +Q                     +A+  A L 
Sbjct: 29  MFALALPPMMLMTLGGVDIARVSTVRMNVQDALDAATLAAARSQYTDNPRINAVGLAALQ 88

Query: 40  GCASIVSDRTIKDPTT--------------KKDQTSTIFKK--------QIKKHLKQGSY 77
              +   D T+    T               K     +                L   ++
Sbjct: 89  ANLAPYGDVTLDTTQTNFRLNTATGAVEADAKVNVRALVANIFLPPYGQFFDDQLPANAH 148

Query: 78  IRENAGD--IAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
                 +  I     I+ T   +       ++ A   I          I      +SL  
Sbjct: 149 SEVLRSNNRIEVALVIDNTGSMDGAKLTNTKTAAIDLINRLEAADGRSIEQDAIKISLVP 208

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQ----------------------------- 166
             +  R ++    +    +  + +                                    
Sbjct: 209 FSMTVRVAQGGTNTPPSFMSNADTHTGGGAWNSGSNPYSAFDTAVGRFTLFGRLNTTWGG 268

Query: 167 ---------KHNDNN------NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
                       D              Y  P  P ++ +  ++T   +            
Sbjct: 269 CVESRPQPYDIRDTAPSSGTQATMFVPYFAPDEPDRADYPNHSTWQNWQYEGNDYLDDGR 328

Query: 212 VLIESAGNLVNSIQKAI-----------QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
               +     N+  +                   +        N G        L++N  
Sbjct: 329 PGSNANSPFANTAARTTEWFARVRSVSRYSTTPRNTLNTGFGPNRGCDLQPIIRLTDNYT 388

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGEN--- 316
            +++ +N +    NTN        +  L            G+ RLKK +I +TDG N   
Sbjct: 389 ALRTAVNNMIASGNTNVPLGTMWGWHTLSPNAPFGDGRPYGTERLKKIIIIMTDGANVMS 448

Query: 317 ----------------------------------SGASAYQNTLNTLQICEYMRNAGMKI 342
                                                     T  T  +C  M++  +++
Sbjct: 449 DTTSPNDSTYNGLGYIWQNRLGIVSGNDTTRRTRMDNRFDHATAATEDMCGNMKDKDIEV 508

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           Y+VAV      Q LLR+C   +  +F V+ +  +  +FD+I   I+   +
Sbjct: 509 YTVAVQVDSTAQTLLRRCATDTDHYFPVDSAAGIGAAFDRIAGAIENLRI 558


>gi|83312851|ref|YP_423115.1| Flp pilus assembly protein TadG [Magnetospirillum magneticum AMB-1]
 gi|82947692|dbj|BAE52556.1| Flp pilus assembly protein TadG [Magnetospirillum magneticum AMB-1]
          Length = 464

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 58/473 (12%), Positives = 120/473 (25%), Gaps = 111/473 (23%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +      I   +D+A    ++++M            A   +   +   +    Q 
Sbjct: 20  ILAIGLLPIITTIGLGVDVARAYAVKSRMS----------AALDAAALAVGSSSGTDAQL 69

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           S + +K    +   G                 +    +  ++   +  +   +   +   
Sbjct: 70  SAVAQKFFDANYPTG----------------ALGAHPSVAVKVTGDVISASAVAEVDTVF 113

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN------- 173
             ++      +          + +   + + MVLD + SM      +   +         
Sbjct: 114 MKVVGLNDVPV----HADSTVNRQIAGLELAMVLDNTGSMTTNNNIQAVRDAANQLTDIL 169

Query: 174 -----------MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN 222
                      +    Y           S  TT   YAP      +   V    A  + +
Sbjct: 170 FGTATVHPYLKIALVPYSAAVNVGSVAPSLITTGDTYAPNDLLGWKGCVVERAGANGVGD 229

Query: 223 SIQKAIQEKKNLSVRIGTIAY--------------------NIGIVGNQCTPLSNNLNEV 262
           +        +   +      Y                             TPL+N    +
Sbjct: 230 TSAATAPWTRYKWLPAVDNNYDATKSSTVLANPSNGNASTGPNLGCPTAITPLTNVKATL 289

Query: 263 KSRLNKLNP--YENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGENSGA 319
              +N +       T +   M    R L  E   +     G+ +  K VI +TDG+N   
Sbjct: 290 TPAINAMEAWSRGGTLSDVGMAWGLRVLSPEPPFTEGLPWGTPKWSKAVILMTDGDNQFY 349

Query: 320 SAYQNTLNTL--------------------------------------QICEYMRNAGMK 341
                T                                           +C  M+   + 
Sbjct: 350 KLTSTTGGNKVNSAVNSDYGAYGRLDELGRIGTTNATTAKTTINTRLTSVCNAMKAKNII 409

Query: 342 IYSVAV--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           +Y+V          +D+ + C   + ++F      EL  +F  I   +    V
Sbjct: 410 VYTVTFTSGINQATKDIYKACATDASKYFDSPSQDELKSAFRAIATSLSNLRV 462


>gi|329848392|ref|ZP_08263420.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328843455|gb|EGF93024.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 434

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 68/431 (15%), Positives = 146/431 (33%), Gaps = 59/431 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL-SGCASIVSDRTIKDPTTKKDQ 59
           +  + + V FL I  A+D + +M ++ ++Q A D A + S   +  + +      +    
Sbjct: 19  IIGLALPVVFLAIGGAVDFSRVMQLKKELQDAADVASVGSVAVNSYAYKANTKGHSSFKT 78

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
                      ++K+ + +         K Q      +           A Y       +
Sbjct: 79  GENQALAIFNSNVKKHNDLNNIKVKAKIKKQSTNLVSEIG-------VTADYRP-----Y 126

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           L GL+      ++++ST     S+    I   ++LD S SM      K  D     ++  
Sbjct: 127 LLGLMGMNTMPITIKSTS---SSTFPPYIDFYLLLDNSPSMGVGATTKDIDTMVANTSDK 183

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                 +      +               +IDV+ ++  NL+ + +          + I 
Sbjct: 184 CAFACHQMDKAGNDYYALAK---KLKVTTRIDVVRQATQNLMTTAKNTQTLTDQYRMAIY 240

Query: 240 TIAYNIG------IVGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMHHAYREL- 288
                            + + L+ NL+   S   K++    PY+N N+    +     L 
Sbjct: 241 HFGMAADQIDSKNPAPYEVSALTTNLSTSASNAAKIDLMTIPYQNYNSDRQTNFPSYLLG 300

Query: 289 -YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ--------ICEYMRNAG 339
                 SS +   S++ ++ + F++DG N G     +   + +         C+ M+  G
Sbjct: 301 MNKVIPSSGDGSSSSKPQQVLFFVSDGANDGYDCAYSNGASCRRISPLDTPQCKAMKARG 360

Query: 340 MKI---YSVAVSAPPEG----------------QDLLRKCTDSSGQFFAVNDSRELLESF 380
           +KI   Y+  +  P                      +++C  + G +F V  +  + E+ 
Sbjct: 361 VKIAVLYTTYLPLPTNAFYNSHLAKYVSPTSQLAAKMQECA-TEGLYFEVGPNEGISEAM 419

Query: 381 DKITDKIQEQS 391
           + +  K+    
Sbjct: 420 NALFAKVISTV 430


>gi|32472883|ref|NP_865877.1| signal peptide [Rhodopirellula baltica SH 1]
 gi|32444120|emb|CAD73562.1| hypothetical protein-signal peptide and transmembrane prediction
           [Rhodopirellula baltica SH 1]
          Length = 434

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/417 (12%), Positives = 132/417 (31%), Gaps = 44/417 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++ +  L   + I+LA +  ++ ++  A DAA  +G  +   ++T++        T
Sbjct: 26  LMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEAAKAAARLT 85

Query: 61  STIFKKQIKKHLKQGSYIRENAG------DIAQKAQINITKDKNNPLQYIAESKAQYEIP 114
           + + +   + +                        +   TK   + +     + +   I 
Sbjct: 86  AAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLVAVSSVRIN 145

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSE----NLAISICMVLDVSRSMED--LYLQKH 168
            +      L P      +  S G     +      +   I +VLD S SM+         
Sbjct: 146 GKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDWKTYDWPDD 205

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP--APAPANRKIDVLIESAGNLVNSIQK 226
            D     S             W     + +Y    +      + D+   +   +      
Sbjct: 206 ADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWEEVFGLGPA 265

Query: 227 AIQ----------------EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                              ++   + ++   +YN     +    L ++ + V++ + +L 
Sbjct: 266 PNTPWEDLVLAVDAFLRVLDQTPQNEQVSIASYNSHGTLDCW--LLDDFDSVRAAVAQLA 323

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P  +T     M+       +E              K ++ +TDG ++  +          
Sbjct: 324 PNGSTGIGNGMNSGKTAFTHENAR-------PYASKTMVVMTDGNHNYGTQPNTVAQ--- 373

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
             + M ++ + I +V      + + +        G+ +  +   EL+ +F++I + +
Sbjct: 374 --QLMSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIANNL 428


>gi|312793553|ref|YP_004026476.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180693|gb|ADQ40863.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 726

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/147 (21%), Positives = 62/147 (42%), Gaps = 19/147 (12%)

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
              G    PL+ +   VK+ +++++ +  TN    +  A  +L         +  S    
Sbjct: 81  DDYGYLLQPLTTDFQTVKNAIDRIDSWGGTNIAEGIRIANHQL--------ISQSSDDRI 132

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SS 364
           K +I +TDGE    +               +N G+ IY++ +      ++LLR     + 
Sbjct: 133 KVIILLTDGEGYYDNNLT---------TEAKNNGITIYTIGLGT-SVDENLLRNIATQTG 182

Query: 365 GQFFAVNDSRELLESFDKITDKIQEQS 391
           G +F V+ + +L + F +IT+ + E  
Sbjct: 183 GMYFPVSSASQLPQVFKRITEIVTEPI 209


>gi|163745746|ref|ZP_02153106.1| hypothetical protein OIHEL45_09145 [Oceanibulbus indolifex HEL-45]
 gi|161382564|gb|EDQ06973.1| hypothetical protein OIHEL45_09145 [Oceanibulbus indolifex HEL-45]
          Length = 554

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 51/362 (14%), Positives = 98/362 (27%), Gaps = 74/362 (20%)

Query: 1   MTAIIISVCFL---FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           M  +++ V F    F   A+DLA+    R   Q+ LD AVL+  +            ++ 
Sbjct: 18  MLVLMLIVFFGITIFGGLAVDLANHERTRTTFQTHLDNAVLAAASL-----------SQD 66

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT-E 116
                + +  +                    +++ I   +      +     +  +P   
Sbjct: 67  LDAEEVVRSYLTSAGLD-------------PSEVEIETREEKIGGILVGRTVEASLPAGL 113

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMED------LYLQKHND 170
           N +           +++ S            I I +VLDVS SM D              
Sbjct: 114 NTYFFRFFDIDTLGMTISSEATERVE----DIEISLVLDVSGSMGDITSDRSGIKMDLLK 169

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPA-----PANRKIDVLIESAGNLVNSIQ 225
                  + +L    +          S      +         +            +   
Sbjct: 170 RAAGDFVETILSDAEEGRVSISIVPYSTKVNPGSALLGQYTVSQEHSYSHCVDFDADDFT 229

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGN--------------QCTPLSNNLNEVKSRLNKLNP 271
               +      R G          N                TPLS+++ E+K+++  L P
Sbjct: 230 HLRIDTATELQRTGHFLIGSESTSNRTAGQWVCRFDSGFAVTPLSSSVAELKAQIAALTP 289

Query: 272 YENTNTYPAMHHAYRELYNE-----------------KESSHNTIGSTRLKKFVIFITDG 314
             +T+           L                     +   +  G+    K ++ +TDG
Sbjct: 290 LGSTSIDMGAKWGLALLDPSAQTPIAAMIASGQVNRAFQGRPHVYGADNSMKVLVLMTDG 349

Query: 315 EN 316
           EN
Sbjct: 350 EN 351



 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 52/181 (28%), Gaps = 7/181 (3%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT 277
           G    S+  +    +N S      +    I       + +N     +  +      +T  
Sbjct: 375 GYTYYSVASSESNYENDSDWTYPESNFYAIHPFGTQRMWSNYTLANNS-DFRQARMSTEV 433

Query: 278 YPAMHHAYRELYNE----KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
                  + E+                S    +      D       + +      QIC 
Sbjct: 434 RLDWPEVWAEMSPYYYGYNMYGRRYNSSWYWYQRATDFRDYIQWTVDSVEKDRRLRQICG 493

Query: 334 YMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               AG+ IYS+ +        +LL+ C  S   +F V    E+  +FD I   I    +
Sbjct: 494 VANAAGVVIYSIGMDVDNTNSLNLLKDCASSESHYFDVEGL-EIQTAFDMIAASISMLRL 552

Query: 393 R 393
            
Sbjct: 553 T 553


>gi|327193254|gb|EGE60160.1| hypothetical protein RHECNPAF_1700073 [Rhizobium etli CNPAF512]
          Length = 457

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/334 (14%), Positives = 103/334 (30%), Gaps = 38/334 (11%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LDAA+++    I +          K +  
Sbjct: 44  VALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQINNSEDTD---ALKQKVY 100

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q++     G                     + +   +   + A     T      
Sbjct: 101 DWFHAQVENSYALGE-------------------IEIDTTNHNITATAS---GTVPTTFM 138

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            +       +S+ S     +      +++ +V+D S SM                     
Sbjct: 139 KIANIDTVPVSVGS---AVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFA 195

Query: 182 PPPPKKSFWSKNTTKSKYAPAP-APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K T  + Y  +       + DV  ++   +++ I ++     +   RI  
Sbjct: 196 CHTGDAHTVGKKTYANNYDYSTEKNIKLRADVAGDAVREVLDMIDESD----SNHERIKV 251

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT----YPAMHHAYRELYNEKESSH 296
             Y++G    +    + + +  + RL+  + Y  T+     Y     A   L     +  
Sbjct: 252 GLYSLGDTTKEVLAPTLDTSNARKRLSD-DSYGLTSATSMNYTYFDVALAALQKIVGTGG 310

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           +   S    K V+ +TDG  S         + L+
Sbjct: 311 DGTSSANPLKLVLLLTDGVQSQRGWVVKNSSNLK 344


>gi|85716351|ref|ZP_01047324.1| hypothetical protein NB311A_19225 [Nitrobacter sp. Nb-311A]
 gi|85696867|gb|EAQ34752.1| hypothetical protein NB311A_19225 [Nitrobacter sp. Nb-311A]
          Length = 542

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/226 (12%), Positives = 77/226 (34%), Gaps = 18/226 (7%)

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
            P +   +     +  A     A            +       +       S    +  +
Sbjct: 316 HPWRDTDNPGAAAAAPAAPQPSAAANDGGWTGCINDRDREYDISNTAPSTGSDGTPSTKF 375

Query: 244 ----NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES--SHN 297
                   +    T +S+  + +K++++ + P  NTN    +   ++ L        +  
Sbjct: 376 YAEQWKDCLPATITAMSSQWSTLKNQIDAMTPSGNTNQSIGLAWGWQSLSTTNGPIAAPG 435

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNT---------LNTLQICEYMRNAGMKIYSVAVS 348
                  + +++ ++DG N+    Y                 +C+ ++++G+ I+++ V+
Sbjct: 436 KESGYVYQDYIVLLSDGLNTQNRWYSCPPSGPCPTIDARQALLCQKVKDSGVTIFTIQVN 495

Query: 349 APPEG--QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              +     +L+ C    G F  +  + E  ++F  I  +I +  +
Sbjct: 496 VGSKDPLSQVLQNCAS-DGNFQMITSATETADAFQNILTQISQLRL 540



 Score = 76.5 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/278 (11%), Positives = 62/278 (22%), Gaps = 27/278 (9%)

Query: 10  FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK 69
             F+  A+D       R+ MQ+ALD+AVL       ++ T+                   
Sbjct: 1   MGFVGAAVDYTRANAARSSMQAALDSAVLMVSKDAAANPTMTSQQITNAVQR-------- 52

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALT 129
            +       +   G          +      +    +   Q            +      
Sbjct: 53  -YFTSLYNDKSAFGVTVSATYTPSSSSAAAKILASGQGAIQ-------TDFMKIAGFPQL 104

Query: 130 NLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL--LPPPPKK 187
           +    ST     +  N  + + +VLD + SM                   L         
Sbjct: 105 SFGTSSTS----TWGNSRMRVALVLDNTGSMSSNGKMSALQRAAKDMIDSLSAFAKKTGD 160

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
            + S            +  N       E  G        +       S     +  +   
Sbjct: 161 VYISIIPFSKDVNVDTSNYNAAWINWAEWLGEPPVLDPASSYGGSKPSNWDDIVEDSNCP 220

Query: 248 VGNQCTPLS-----NNLNEVKSRLNKLNPYENTNTYPA 280
                   +       L+  KS   ++        Y  
Sbjct: 221 FKKNSHGFTCADRPATLSGAKSDTKRIPSSGKYAGYIC 258


>gi|89069885|ref|ZP_01157219.1| hypothetical protein OG2516_06272 [Oceanicola granulosus HTCC2516]
 gi|89044561|gb|EAR50680.1| hypothetical protein OG2516_06272 [Oceanicola granulosus HTCC2516]
          Length = 536

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/340 (12%), Positives = 85/340 (25%), Gaps = 69/340 (20%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQ 74
            A+D       R ++Q+ LD AVL+          +       +       K        
Sbjct: 36  MAVDFMRTETARGRLQATLDGAVLAAA-------DLDQDKDPVEVVRDYVAKAGLDPFLI 88

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
              + E AG                  Q I  + A+ ++    +    ++         R
Sbjct: 89  DVDVTEIAG------------------QRIVTASAKSDVT---MHFMKMVGIDFLPAPAR 127

Query: 135 STGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNT 194
           ST     S     + + +VLD+S SME                  +      +       
Sbjct: 128 STASEAVS----NLDVSLVLDMSGSME-GDKLDQLQAAAKNFVGIVYDTMGAEKILLNVV 182

Query: 195 TKSKYAPAPAPANR------KIDVLIESAGNLVNSIQKAIQ---------EKKNLSVRIG 239
             +    APA          +                +               +     G
Sbjct: 183 PYATQVAAPAGLLDMLGAFLREHSYSNCVSFSAADFTETSILEAAALPQGGHFDPFYTWG 242

Query: 240 TIAY------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN--- 290
            + Y             +   L++   E++  ++ L    NT+    M      +     
Sbjct: 243 PLRYDDVTFVCNPDPSTEVLTLASTQREIEDYIDGLVAEGNTSIDVGMKWGAALIDPDLG 302

Query: 291 ------------EKESSHNTIGSTRLKKFVIFITDGENSG 318
                          +     G     K ++ +TDG+N+ 
Sbjct: 303 STLNEFANGPSAAGINPVALWGDRSTDKVIVLMTDGKNTT 342



 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 46/132 (34%), Gaps = 5/132 (3%)

Query: 267 NKLNPYENTNTYPAMHHAYRELYN-----EKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           N+                Y EL++          H+ + +    +   +  D  +   S 
Sbjct: 404 NRFPHGGGRIEDNVRRLTYEELFSRVSVYYNAYYHHYLQNFDRTELDTWYWDFLDMSLST 463

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFD 381
                    IC   +N G+++++V      +   ++  C  S   FF V+   +L  +F+
Sbjct: 464 SAKNARLEAICTAAKNQGVQVFTVGFEVEDDEAIIMEDCASSRAHFFRVSGGGDLTTAFE 523

Query: 382 KITDKIQEQSVR 393
            I  +I E  + 
Sbjct: 524 SIARQITELRLT 535


>gi|297581617|ref|ZP_06943539.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
 gi|297534024|gb|EFH72863.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
          Length = 467

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 47/448 (10%), Positives = 121/448 (27%), Gaps = 66/448 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+++     F ++ + +  +    +++    DA + S   S  +    +  +       
Sbjct: 21  AALMLLGMLTFFSFVLLVIVLSTTDSRLSMLADAVLYSTTNSYNAKADAQQMSEANTPQP 80

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA-------QYEIP 114
            +    ++          +               D       +   +A         EI 
Sbjct: 81  NLGLSSLQVDTGNNENAAQVQVSGRVDRGSLALTDTLGTSDVLVTHQAQSKIHQTTLEIV 140

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-------- 166
                   +    +T          +            V+ +  +   + +         
Sbjct: 141 VMLDVSNSMKGEPMTQSIKGLRDFADILYAEERRDFSKVVSIVPATGLVNIGHRPEFFSA 200

Query: 167 ------KHNDNNNMTSNKYLLPPPPKKSFWSKN---------TTKSKYAPAPAPANRKID 211
                 +   +         L  P     W K             +  +       R+++
Sbjct: 201 SAFAIPRDWRSLAKERGWKDLLHPEVPGRWRKAMCTALPEEQDELTSVSALTPNWIRRLE 260

Query: 212 VL--IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI--------------------GIVG 249
           +    ++    +  + K   E     + + T  Y+                         
Sbjct: 261 LSPPDQNLRLHMEWMSKPAIEHYENDMPLFTYYYSGNPKEKYSPNKHEQRGLFDSPDCGV 320

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL----- 304
           +Q  PL +        L+ L P  NTN    +  A+R L        +   S        
Sbjct: 321 SQIQPLLSTRRAFIKALDTLYPEFNTNNAEGVMWAWRLLSPHWRGYWDKGKSELPRDYQH 380

Query: 305 ---KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT 361
              +K ++  TDG +    A ++      +C  M+  G++I S+          +++ C 
Sbjct: 381 PNNRKVMLLFTDGNHLVDVAKRDRKQV-ALCREMKKQGIEIISIDF---NNRSQVMKSCA 436

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQE 389
             +GQ++  ++   +     ++   + +
Sbjct: 437 S-AGQYYIADNRT-IRSVLKQVATTLSK 462


>gi|188580137|ref|YP_001923582.1| hypothetical protein Mpop_0869 [Methylobacterium populi BJ001]
 gi|179343635|gb|ACB79047.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 477

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/459 (12%), Positives = 122/459 (26%), Gaps = 90/459 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ +      +   ID    +  + ++ +A DAAVL+G  +                 
Sbjct: 29  MFALALLPTLGLVGLGIDYGMAITSKTRLDNAADAAVLAGVVTAKEYIASNAKQGDATAA 88

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                +       Q +            A +++++           +   Y    +N   
Sbjct: 89  GLTAGRN------QATKAFAINTGKVPFATVSVSRLDVTRSGQTLTATVIYTATIQNT-F 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++  + T  +   T   + +     +   +++DVS SM           +        
Sbjct: 142 GKILGLSSTTFTNTITASADLA---SYLDFYLMVDVSGSMG----LPTAAADAEKLASIT 194

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F      +  +  A      + D +  +   L+               RIG 
Sbjct: 195 KEDQGNCQFACHFPGRKGWNNAAGKIQLRSDAVNNAVCELLKRAATP---VVPNQYRIGF 251

Query: 241 IAYNIG-IVGNQCTPLSNNLNEVKSRLN----------KLNPYENTNTYPA--------- 280
             +       +  +  + ++  +++              L    +T  +           
Sbjct: 252 YPFINRLATLSPLSDTTTSMTALRTAAQCDKTWPLAFTNLLDTGSTQLFTGNNPTTGTGS 311

Query: 281 ----MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL------- 329
                  A  ++    +   +   +T  K FV  ITDG  +  S   N            
Sbjct: 312 GGTHFEKALPQMKATIQPYGDGSSTTNSKPFVFLITDGMQNSQSYSTNNDARTFPGSPSL 371

Query: 330 -------------------QICEYMRNAGMKIYSVAV----------------------S 348
                                C+ +++AG  I  + +                       
Sbjct: 372 FKGYGNAGWDGSQPAQIDPSKCKELKDAGAIISILYIPYNQVKNYTNDSYIVWENNRVNG 431

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
             P   D LRKC    G F+  N + ++  S   + D+ 
Sbjct: 432 FSPTLADPLRKCASQ-GFFYTANSADDITASLGAMFDQA 469


>gi|170740935|ref|YP_001769590.1| hypothetical protein M446_2717 [Methylobacterium sp. 4-46]
 gi|168195209|gb|ACA17156.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 432

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/415 (13%), Positives = 118/415 (28%), Gaps = 59/415 (14%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
             A+D       R ++ +  D AVL+  ++     +  D      +  T     +     
Sbjct: 43  GAAVDFTSYQKARTELDAVADQAVLAAVSAAGMKMSQADAEAAMAKLFTDAAAALPNVSA 102

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
                     D  + A +  +                         +  L   +      
Sbjct: 103 SPRAATAPTTDGVRTASLTYSAT-------------------IRTGIMRLAGFSTVAFGG 143

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
            +T     S   +     ++LD S SM               ++             S  
Sbjct: 144 TATA---ASPNPIFTDFYLLLDNSPSMGVAATTADIATMVANTSDQCAFACHD---MSAG 197

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI-AYNIGIVGNQC 252
                          +IDV+ ++   L+++            + I +      GI  NQ 
Sbjct: 198 GNDYYAKAKNLGVKMRIDVVRDATQQLMDTASAKAIAAGQYRMAIYSFGTSCSGIGLNQV 257

Query: 253 TPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
           + L+ NL+  K+    L+         N +        +  L +   +  +   +   +K
Sbjct: 258 SALTANLSTSKTDAGALDLMTVPYQNYNNDQCTDFDGIFARLNSAVPNPGSGASAASPQK 317

Query: 307 FVIFITDGENSGASAYQNTL----------NTLQICEYMRNAGMKI---YSVAVSAPPEG 353
            V F++DG          T            TL  C+ +++ G+++   Y+  +  P  G
Sbjct: 318 VVFFVSDGVADANYPSTCTKPTTNGRCQEPITLANCQALKDRGIRVAVLYTTYLPLPTNG 377

Query: 354 -------------QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                           +  C      ++ V+ S  + ++   +  K+ +   RI 
Sbjct: 378 WYNTWIAPFSSQIATNMAACAS-PDLYWPVSPSEGIADAMKGLFKKVVDSQRRIT 431


>gi|51597679|ref|YP_071870.1| membrane protein. [Yersinia pseudotuberculosis IP 32953]
 gi|51590961|emb|CAH22619.1| Putative membrane protein [Yersinia pseudotuberculosis IP 32953]
          Length = 518

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/472 (11%), Positives = 124/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  AL+ A L+                     +
Sbjct: 29  FMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVT 88

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 89  SYAQSYLPSERFSQPRVVNTYNESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 148

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++   +        +      N  I    
Sbjct: 149 GAARKYLSSIAEPIDVVFVTDFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSND 208

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 209 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDRNGHYLQRYTASNLKNIPGLDN 268

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 269 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 328

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 329 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 387

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 388 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 447

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 448 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 498


>gi|238759128|ref|ZP_04620297.1| tight adherance operon protein [Yersinia aldovae ATCC 35236]
 gi|238702676|gb|EEP95224.1| tight adherance operon protein [Yersinia aldovae ATCC 35236]
          Length = 448

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/436 (10%), Positives = 117/436 (26%), Gaps = 57/436 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             I + +    +  + +++H +    ++  A++ A L+      ++       T+ ++  
Sbjct: 29  FIIFLPLFIGLLYLSFEISHYLQKAAKLSDAIEQATLALTIENNTN---NPDETQTEKNI 85

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           ++     + +L   S+       I+             P      +        + L  +
Sbjct: 86  SLVNAYARAYLPSESFSAPVIDIISH------------PNYIEYRAATTLNYTPKFLTKE 133

Query: 122 GLIPSA-LTNLSLRSTGIIERSSENLAI-SICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
            +        +S     I  + +    I  +  V+D S SM+  +  +          + 
Sbjct: 134 LITNIDRRIIVSDNGVAIKNKFTSPGEITDVVFVVDYSVSMDGNFGDEKKTTKIQELRRI 193

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                      +   T      +          +          + K           + 
Sbjct: 194 FEDLNNTILKNNNTHTIGFVPFSWGTKKIIGKGIHRKIYCHFPFVPKTPMPPSYYLGDLK 253

Query: 240 TIAY---------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYE----------------- 273
           +            N          ++ N N +   ++ + P                   
Sbjct: 254 SYNPAKELTDAVKNNIDYDETIKSITANYNFINIPIDDIKPSSFCLKGSDAYTLRSDDIT 313

Query: 274 NTNTYPAMHHAYRELYNEKE-----SSHNTIGSTRLKKFVIFITDGENSGASAY------ 322
           N N    + H    L          +      S    K +I I+DG +   S+       
Sbjct: 314 NDNIQENIEHEVNGLTLISSGILVANDIFRKDSKNKDKLMIIISDGNDQEISSDLTQEKI 373

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL-ESFD 381
             TL    +CE ++   +++  + ++   +       C      ++   ++ EL  +   
Sbjct: 374 TKTLIEKGMCERIKENNIRMVFIGIAYTVKEIK-WEDCVGKR-NYYEAQNAHELEADLRQ 431

Query: 382 KITDKIQEQSVRIAPN 397
            +      +  R  P 
Sbjct: 432 ALGTIEASEVGRNIPK 447


>gi|239908012|ref|YP_002954753.1| hypothetical protein DMR_33760 [Desulfovibrio magneticus RS-1]
 gi|239797878|dbj|BAH76867.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 451

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/457 (11%), Positives = 119/457 (26%), Gaps = 112/457 (24%)

Query: 18  DLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
           DL  +   ++++Q+A+D+A L+G   +  D  +         T  +              
Sbjct: 17  DLGRVSVEQSRLQNAVDSAALAGSLQLPDDPDVSTGAVTAAATQNLLANDADA------- 69

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
                              ++          A+ ++    + L  +I      ++  +  
Sbjct: 70  --------------TGILVESGGATRSVCVSAEAKVE---MTLSQVIGIGDQTVTAEACA 112

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN-------------KYLLPPP 184
                     I + MVLD + SM+   +    +      N             K  L P 
Sbjct: 113 GYN------DIELVMVLDATGSMKGTPIANVKEAATNLVNLIMPSSSSTSTRSKIGLVPF 166

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT---- 240
             K     N   +  A          +         + +       K N+          
Sbjct: 167 QGKVRIDGNDPVTAEANPDGVGPGCRNADGTLNNGKLRTEYSKTTTKTNIFYGYTLSGVS 226

Query: 241 -IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSH 296
             +       +    LS++ + + S +  LN       T     +      L        
Sbjct: 227 TTSDKTCSGMSPIRALSSDKSAILSNITALNAGQVTSGTIISEGIKWGRHVLTPTAPYVE 286

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQN-------------------------------- 324
            +  +  ++K +I +TDG+        +                                
Sbjct: 287 GSTDTK-VRKIMIVLTDGDTEDGRCGGSYASASKTINTYWTNAYFGQGLKPDSSASPYST 345

Query: 325 --------------------TLNTLQICEYMR---NAGMKIYSVAVS-APPEGQDLLRKC 360
                                   +      +   N  ++I+S+    +    ++L+++ 
Sbjct: 346 LSTAALTLAQIPDCKDGGLLNTYVVNEATLAKTDANYPIEIFSIRFGDSDSTDKNLMKQI 405

Query: 361 TD----SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 +   +F   D   + E F KI  ++ ++ + 
Sbjct: 406 ASSKPGTEDHYFDAPDEAGIKEMFKKIGQQLGQRLMT 442


>gi|186896818|ref|YP_001873930.1| hypothetical protein YPTS_3520 [Yersinia pseudotuberculosis PB1/+]
 gi|186699844|gb|ACC90473.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+]
          Length = 518

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/472 (12%), Positives = 125/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  AL+ A L+                     +
Sbjct: 29  FMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVT 88

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 89  SYAQSYLPSERFSQPRVVNTYNEILGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 148

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++ L +        +      N  I    
Sbjct: 149 GAARKYLSSIAEPIDVVFVTDFSGSMNLPFGDIELNNRITKLDELKAIFVKLNNRIFSND 208

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 209 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDN 268

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 269 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 328

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 329 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 387

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 388 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 447

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 448 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 498


>gi|323493925|ref|ZP_08099042.1| putative Flp pilus assembly protein TadG [Vibrio brasiliensis LMG
           20546]
 gi|323311866|gb|EGA65013.1| putative Flp pilus assembly protein TadG [Vibrio brasiliensis LMG
           20546]
          Length = 427

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/445 (9%), Positives = 125/445 (28%), Gaps = 75/445 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++ +  + + +++ ++  M    ++  A + A L+          I  P   +D+ 
Sbjct: 5   LFIGLLPIMVILMAFSMQMSQQMLAHARVLEAAEVASLAL---------IASPKESEDEN 55

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               ++ + +++       +      +    +    ++  +   ++     +   ++   
Sbjct: 56  VKYARQLVDRYVVDNINDVDVEVYTRKCEYKDGCVQESGEVAPFSDFVVSAKAEHKSWIA 115

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND------NNNM 174
                  L      +   + R      + +  + D S SM   +                
Sbjct: 116 YE--KVDLKPEFEVAGKSVTRKYLPQPVDVYFIGDFSGSMNGHWKGGKTKLDVVKQTIER 173

Query: 175 TSNKYLLPPPPKKSFWSKNTTK------SKYAPAPAPANRKIDVLIESAGNLVNSIQKA- 227
                      +KS  +           +      +   R+      +      +  +  
Sbjct: 174 VVEDIENFNTEEKSRVALLGYNPLHVKQTGTVYLNSYGYRRSWPKKVAYDYARGTTAQTV 233

Query: 228 --IQEKKNLSVRIGTI----------------AYNIGIVGNQCTPLSNNLNEVKSRLNK- 268
             + +  ++  R+                      +        PL+ +    KSRL   
Sbjct: 234 AKMFDPPSVYSRVQEYVRGMSRHDVKNLVVNNDRFVDYYKFYDIPLTEDYTNFKSRLANA 293

Query: 269 -LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     T+++  +  A +E             +   ++  I ++DG ++  +  Q  +N
Sbjct: 294 SLGAEGGTSSWNGIIAAAQEANRA--------TNINPEQVFIVLSDGADNDTNYLQRLVN 345

Query: 328 TLQICEYMR------------------NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
              +C  +R                     + +  + V    +  D    C       + 
Sbjct: 346 -QGLCTKLRSTISAKRNRFQSKTGSAGKTKVTMGVIGVDYRVKESDGFGDC-FGRKNIYH 403

Query: 370 VNDSRELLESFDKITDKIQEQSVRI 394
             D     + +  I + I E++ R+
Sbjct: 404 AKDGD---DVYKYILNLINEETGRL 425


>gi|261251272|ref|ZP_05943846.1| protein TadG associated with Flp pilus assembly [Vibrio orientalis
           CIP 102891]
 gi|260938145|gb|EEX94133.1| protein TadG associated with Flp pilus assembly [Vibrio orientalis
           CIP 102891]
          Length = 436

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/445 (9%), Positives = 125/445 (28%), Gaps = 75/445 (16%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++ +  +F+ +++ ++  M    ++  A + A L+          I  P   +D  
Sbjct: 14  LFIGLLPIMVIFMAFSMQMSQQMLAHARVLEAAEVASLAL---------IASPKESEDDN 64

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               ++ + +++       +      +    +     +  +   ++     +   ++   
Sbjct: 65  VKYARQLVDRYVVDNINDVDVEVYTRKCEYKDGCVQASGEVAPFSDFVVSAKAEHKSWIA 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND------NNNM 174
                + L      +   + R      + +  + D S SM   +                
Sbjct: 125 YE--EAELKPEFEVAGKSVTRKYLPQPVDVYFIGDFSGSMTGHWKGGKTKLDVVKQTIER 182

Query: 175 TSNKYLLPPPPKKSFWSKNTTK------SKYAPAPAPANRKIDVLIESAGNLVNSIQKA- 227
                      +KS  +           S      A   R+      +      +  +  
Sbjct: 183 VVEDIADFNTEEKSRVALLGYNPLHVKQSGTVYLNAYGYRRSWPKKIAYDYARGTSAQTV 242

Query: 228 --IQEKKNLSVRIGTI----------------AYNIGIVGNQCTPLSNNLNEVKSRLNK- 268
             + +  ++  R+                      +        PL+ +    K+RL   
Sbjct: 243 AKMFDPPSVYSRVQEYVRGMSRLDVENLVVNNDRFVDYYKFYDIPLTEDYTHFKARLASA 302

Query: 269 -LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
            L     T+++  +  A +E             +   ++  I ++DG ++  +  Q  +N
Sbjct: 303 WLGAEGGTSSWNGIIAAAQEANRA--------TNINPEQVFIVLSDGADNDTNYLQRLVN 354

Query: 328 TLQICEYMR------------------NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFA 369
              +C  +R                     + +  + V    +  D    C       + 
Sbjct: 355 -QGLCTKLRSTISAKRNRFQSKTGSAGKTKVTMGVIGVDYRVKESDGFGDC-FGRKNIYH 412

Query: 370 VNDSRELLESFDKITDKIQEQSVRI 394
             D     + +  I + I E++ R+
Sbjct: 413 AKDGD---DVYKYILNLINEETGRL 434


>gi|22127367|ref|NP_670790.1| hypothetical protein y3493 [Yersinia pestis KIM 10]
 gi|45442761|ref|NP_994300.1| hypothetical protein YP_2999 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809099|ref|YP_653015.1| hypothetical protein YPA_3108 [Yersinia pestis Antiqua]
 gi|108810706|ref|YP_646473.1| hypothetical protein YPN_0541 [Yersinia pestis Nepal516]
 gi|150260286|ref|ZP_01917014.1| putative fimbrial anchor [Yersinia pestis CA88-4125]
 gi|162419964|ref|YP_001604884.1| hypothetical protein YpAngola_A0266 [Yersinia pestis Angola]
 gi|165939877|ref|ZP_02228416.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009017|ref|ZP_02229915.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211928|ref|ZP_02237963.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167466384|ref|ZP_02331088.1| hypothetical protein YpesF_00480 [Yersinia pestis FV-1]
 gi|218927875|ref|YP_002345750.1| hypothetical protein YPO0684 [Yersinia pestis CO92]
 gi|229837366|ref|ZP_04457529.1| putative fimbrial anchor [Yersinia pestis Pestoides A]
 gi|229840578|ref|ZP_04460737.1| putative fimbrial anchor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842872|ref|ZP_04463024.1| putative fimbrial anchor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229900904|ref|ZP_04516028.1| putative fimbrial anchor [Yersinia pestis Nepal516]
 gi|294502750|ref|YP_003566812.1| hypothetical protein YPZ3_0640 [Yersinia pestis Z176003]
 gi|21960452|gb|AAM87041.1|AE013952_8 hypothetical [Yersinia pestis KIM 10]
 gi|45437627|gb|AAS63177.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108774354|gb|ABG16873.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781012|gb|ABG15070.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115346486|emb|CAL19360.1| putative membrane protein [Yersinia pestis CO92]
 gi|149289694|gb|EDM39771.1| putative fimbrial anchor [Yersinia pestis CA88-4125]
 gi|162352779|gb|ABX86727.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165912188|gb|EDR30826.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165992356|gb|EDR44657.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206674|gb|EDR51154.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|229682243|gb|EEO78335.1| putative fimbrial anchor [Yersinia pestis Nepal516]
 gi|229690139|gb|EEO82196.1| putative fimbrial anchor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696944|gb|EEO86991.1| putative fimbrial anchor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229705489|gb|EEO91499.1| putative fimbrial anchor [Yersinia pestis Pestoides A]
 gi|262364727|gb|ACY61284.1| hypothetical protein YPD8_0594 [Yersinia pestis D182038]
 gi|294353209|gb|ADE63550.1| hypothetical protein YPZ3_0640 [Yersinia pestis Z176003]
 gi|320016753|gb|ADW00325.1| putative fimbrial anchor [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 518

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/472 (11%), Positives = 124/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  AL+ A L+                     +
Sbjct: 29  FMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVT 88

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 89  SYAQSYLPSERFSQPRVVNTYNESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 148

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++   +        +      N  I    
Sbjct: 149 GAARKYLSSIAEPIDVVFVTDFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSND 208

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 209 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDN 268

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 269 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 328

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 329 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 387

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 388 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 447

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 448 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 498


>gi|306821351|ref|ZP_07454960.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550638|gb|EFM38620.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 467

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 78/209 (37%), Gaps = 26/209 (12%)

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI 238
             L    K  +   N      +      N    +  E     ++ +        N    +
Sbjct: 14  TFLIEDEKDKYDGINIAFVIDSSGSMFYNDPNGLRREVTHKFIDRLTD------NDMAAV 67

Query: 239 GTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT 298
               Y   ++       ++N  ++   ++K+     TN   A+  AY  L+N  +++   
Sbjct: 68  IGFDYKATVLEQ----FTSNKEKLHDAVDKIRSDGGTNIGRAVSIAYD-LFNNLDNNRKE 122

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLR 358
                  KF+I +TDG+   +  Y             + AG+KIY++ +      + LL+
Sbjct: 123 K----YPKFLILLTDGDGDYSEEYTI---------LAKKAGIKIYTIGLG-NGVSEKLLK 168

Query: 359 KCT-DSSGQFFAVNDSRELLESFDKITDK 386
                + G++F   D+ +L + F+KI DK
Sbjct: 169 DIAKGTDGEYFHAKDASKLNKIFEKIADK 197


>gi|145597778|ref|YP_001161854.1| hypothetical protein YPDSF_0468 [Yersinia pestis Pestoides F]
 gi|145209474|gb|ABP38881.1| membrane protein [Yersinia pestis Pestoides F]
          Length = 513

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 56/472 (11%), Positives = 124/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  AL+ A L+                     +
Sbjct: 24  FMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVT 83

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 84  SYAQSYLPSERFSQPRVVNTYNESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 143

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++   +        +      N  I    
Sbjct: 144 GAARKYLSSIAEPIDVVFVTDFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSND 203

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 204 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDN 263

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 264 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 323

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 324 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 382

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 383 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 442

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 443 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 493


>gi|190894968|ref|YP_001985261.1| hypothetical protein RHECIAT_PC0000634 [Rhizobium etli CIAT 652]
 gi|190700629|gb|ACE94711.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 444

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/334 (14%), Positives = 104/334 (31%), Gaps = 38/334 (11%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LDAA+++    I +          K + S
Sbjct: 31  VALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQINNSEDTD---ALKQKVS 87

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q++     G                     + +   +   + A     T      
Sbjct: 88  DWFHAQVENSYALGE-------------------IEIDTTNHNITATAS---GTVPTTFM 125

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            +       +S+ S     +      +++ +V+D S SM                     
Sbjct: 126 KIANIDTVPVSVGS---AVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFA 182

Query: 182 PPPPKKSFWSKNTTKSKYAPAP-APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K T  + Y  +       + DV  ++   +++ I ++     +   RI  
Sbjct: 183 CHTGDAHTVGKKTYANNYDYSTEKNIKLRADVAGDAVREVLDMIDESD----SNHERIKV 238

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNT----YPAMHHAYRELYNEKESSH 296
             Y++G    +    + + +  + RL+  + Y  T+     Y     A   L     +  
Sbjct: 239 GLYSLGDTTKEVLAPTLDTSNARKRLSD-DSYGLTSATSMNYTYFDVALAALQKIVGTGG 297

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           +   S    K V+ +TDG  S         + L+
Sbjct: 298 DGTSSANPLKLVLLLTDGVQSQRGWVVKNSSNLK 331


>gi|260576512|ref|ZP_05844501.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021235|gb|EEW24542.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 529

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 90/363 (24%), Gaps = 66/363 (18%)

Query: 16  AIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQG 75
           A+DL      R  +Q  LD + L+  +                         +++ L   
Sbjct: 56  ALDLMRHEQKRTTLQQTLDRSTLAAAS-------------------------LQQSLDPE 90

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
           S +R+          ++              + A  +      F   ++     +    S
Sbjct: 91  SVVRDYFAKANMTQYLSGVTVDEGMNYREVNALAAADTNP---FFMQMVGIDSFDAKAAS 147

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
           T     S     + + MVLD+S SM                   ++              
Sbjct: 148 TAEQRIS----NVEVSMVLDISGSMASNSRLTRLRPAAKEFIDTVINGSDPGRVSISVVP 203

Query: 196 KSKYAPAPAPANRKIDV-----LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
            +      A    + +V              +        +    V  G          +
Sbjct: 204 YNAQVNLGAGMMSQFNVNALHSTSYCVELPNSVFGSTGLSQATSFVHNGHFDPWGTGNSS 263

Query: 251 Q----------CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES------ 294
                       TP+S +   +K R++ L     T+    +      L    +       
Sbjct: 264 NYNCPPTANVAVTPMSGDAAYLKGRVDLLASMGYTSIDVGVKWGTLLLDPSAQPLINGLV 323

Query: 295 -----------SHNTIGSTRLKKFVIFITDGENS--GASAYQNTLNTLQICEYMRNAGMK 341
                               + K ++ ++DGEN+               I +   N+ + 
Sbjct: 324 GLGQVDEDFTDRPLDPDEANVLKVLVVMSDGENTEEYKLTAPYRSGPSAIYKKTSNSKLT 383

Query: 342 IYS 344
           +YS
Sbjct: 384 LYS 386



 Score = 77.3 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 56/188 (29%), Gaps = 15/188 (7%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
            D        L    +         +       Y+            ++ ++  + ++  
Sbjct: 352 SDGENTEEYKLTAPYRSGPSAIYKKTSNSKLTLYSDRASTTSDYYWFSD-SKWHTTID-- 408

Query: 270 NPYENTNTYPAMHH----AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                T     M      A   +    +  +          +    TD      S  Q  
Sbjct: 409 ---GGTTGSVQMTWPEVWAKWSVRYVAKDIYTKALGGSENSWFETFTDEI----SYGQKD 461

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD 385
           +   QIC+  +++G+ I+S+   AP  G++ LR C      +F      ++  +F  I  
Sbjct: 462 VRLQQICDAAKDSGIVIFSIGFEAPENGRNQLRDCASQPSNYFNATGV-QITTAFRAIAT 520

Query: 386 KIQEQSVR 393
           ++    + 
Sbjct: 521 QLSHLRLT 528


>gi|13476511|ref|NP_108081.1| hypothetical protein mlr7847 [Mesorhizobium loti MAFF303099]
 gi|14027272|dbj|BAB54226.1| mlr7847 [Mesorhizobium loti MAFF303099]
          Length = 548

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 60/531 (11%), Positives = 136/531 (25%), Gaps = 138/531 (25%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDP------- 53
           +  + +      + +A+D++ +M  ++ +Q+ALDAA L+       D +  D        
Sbjct: 17  LMGLGLPAILSAVAFAVDVSTVMRAKSNLQNALDAANLASSHLGDLDISRTDAFDRYFQA 76

Query: 54  -----------------------TTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQ 90
                                     K   S               +I  +A  +    Q
Sbjct: 77  NIAGHGELANAQATLTVDRGVNFIKTKAVASADVNLNFGFLFGHNRHIAVDASAVESDNQ 136

Query: 91  INITKDKNNPLQYIAESKAQYEIPTENLFLKG-LIPSALTNLSLRSTGIIERSSENLAIS 149
           + +    +N               T++L        S    +       +   + N    
Sbjct: 137 LEVVLVLDNTGSMAGARMTALRTATKSLLDTLEATKSPTRQIRASLVPFVTAVNVNGDEF 196

Query: 150 ICMVLDV------------------------------SRSMEDLYLQKHND--------- 170
               +D+                              +   E  +               
Sbjct: 197 DPSWIDMDGKSSTNGVNFPVIDGKRPNHMALFKQLKDTGWTEAGWNGTGWKGCVEARPGA 256

Query: 171 -----------NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK-IDVLIES-- 216
                        +     Y  P  P+ +    ++  +              D    +  
Sbjct: 257 YNISDTPPDPDKPDTLFVPYFAPDDPEDAQKPSSSYGNAAKYYNNSYLDDVSDKTKTAKL 316

Query: 217 --------AGNLVNSIQKAIQEKKNLSVRIGTIAY-------------NIGIVGNQCTPL 255
                     +L + +  A ++ K    +                              L
Sbjct: 317 KGNRLGIDLSSLADPVPPADKDAKEKVAKYVAPTKALITETGSPITVGPNRACPTPVVSL 376

Query: 256 SNNLNEVKSRLNKLN--PYENTNTYPAMHHAYRELYNEKESSHNTI-GSTRLKKFVIFIT 312
           +++ ++++   +++       TN    +    R L      +      +  + K V+ +T
Sbjct: 377 TDDFDKLRKAASEMTEWNGSGTNVSEGLSWGMRVLSPAAPYTDGAPWKTPGISKIVLLLT 436

Query: 313 DGENSGASAYQNTLN-----------------------------TLQICEYMRNAGMKIY 343
           DGEN    A +                                 T  +C  ++N G++IY
Sbjct: 437 DGENVVYGASEQPTKSDYTSYGYLAGGRFGSDDQTAAARNVDGWTKSVCTQLKNQGVQIY 496

Query: 344 SVAVSAP-PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++ + +     + L   C      ++AVND  +L + F  I +K     + 
Sbjct: 497 TMVLQSDTAANRALYSACASDPSGYYAVNDPAKLPDVFQHIANKFSRLQLT 547


>gi|149202124|ref|ZP_01879097.1| hypothetical protein RTM1035_12393 [Roseovarius sp. TM1035]
 gi|149144222|gb|EDM32253.1| hypothetical protein RTM1035_12393 [Roseovarius sp. TM1035]
          Length = 584

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/321 (12%), Positives = 76/321 (23%), Gaps = 59/321 (18%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            AI   +  +     ID+      R  +Q+ LD AVL+G  ++ +               
Sbjct: 27  FAIF-VMFLVMGGIGIDMMRQEMARASLQATLDRAVLAGATAVNN-----------ATAR 74

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            + +    K  +      + AGDI           + N  +  A +    +      +L 
Sbjct: 75  AVIEDYFAKSGQSDYLAAQEAGDID---------IRLNSSKVTARATQTLD-----TYLM 120

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            L        +  ST  +        + I M LDVS SM             +     +L
Sbjct: 121 RLAGVDTLTSAGNSTAEVTI----PKLEIAMALDVSGSM-IGARIDALKPAAIEFVDSIL 175

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPAN-----RKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                          S                +            +       +      
Sbjct: 176 DSTEPNDAVISVVPFSWGVTPSKEIYEALTVNETHKYSSCLELNDSHFTDTTIDPNTAYN 235

Query: 237 R--------------------IGTIAYNIGIVGN---QCTPLSNNLNEVKSRLNKLNPYE 273
           +                         YN            P +     +  ++N L    
Sbjct: 236 QLIYTSREGVTFGDLTTTPLGDFLDTYNQTCYTQDYFNILPYATTKTALHDKINGLQAGG 295

Query: 274 NTNTYPAMHHAYRELYNEKES 294
           +T+    +  A   L    + 
Sbjct: 296 STSNDEGVKWAAALLDPAFQP 316



 Score = 47.6 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 38/121 (31%), Gaps = 10/121 (8%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           S   +   +  +   P   ++   +   A+  +      +                 +  
Sbjct: 453 SVTWSTFNNYNSNTLPGFISSERLSWETAWGLMSPRFYGNTTGNWGPW--------NNFL 504

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAV--SAPPEGQDLLRKCTDSSGQFFAVNDS 373
           N+  +  +       IC   ++ G+ IY++A    + P G D ++KC  S    +     
Sbjct: 505 NNPINRSKKDERLDDICREAKSEGIVIYTIAFEMGSQPTGADKIKKCASSVNHHYNATTV 564

Query: 374 R 374
            
Sbjct: 565 N 565


>gi|153946957|ref|YP_001399586.1| hypothetical protein YpsIP31758_0593 [Yersinia pseudotuberculosis
           IP 31758]
 gi|152958452|gb|ABS45913.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
          Length = 518

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 56/472 (11%), Positives = 125/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  A++ A L+                     +
Sbjct: 29  FMALIPVFIGLIFLSFEFSHFIQKRAKLSDAIEQASLALSTENNYRNDRASNNRNNYLVT 88

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 89  SYAQSYLPSERFSQPRVVNTYNEILGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 148

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++ L +        +      N  I    
Sbjct: 149 GAARKYLSSIAEPIDVVFVTDFSGSMNLPFGDIELNNRITKLDELKAIFVKLNNRIFSND 208

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 209 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDN 268

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 269 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 328

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 329 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 387

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 388 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 447

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 448 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 498


>gi|103487755|ref|YP_617316.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
 gi|98977832|gb|ABF53983.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
          Length = 666

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 47/400 (11%), Positives = 106/400 (26%), Gaps = 43/400 (10%)

Query: 32  ALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQI 91
           A ++A  +      +       +   +QT        +                   +  
Sbjct: 269 ASNSAACAALTPPANTTPSPSGSPDYNQTGQYVDGDTRVTTYDTVQTYTFRTYRYVWSSN 328

Query: 92  NITKDKNNPLQYIAESKAQYEIPTE-----NLFLKGLIPSALTNLSLRSTGIIERSSENL 146
              +   N       +    E  T+       +   +   +              S  ++
Sbjct: 329 RCRRQYRNGNFTRTYTTTVTETKTDVFDNKYTYEDRVFDVSGVKSGSAIVTDTGDSGVSI 388

Query: 147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
           + +    L + R+           ++ +  +  L+P     + W     +  +  A  P 
Sbjct: 389 SHNWGGCL-IERATTPFDADDTAPSDALDMDIDLVPDADADTQWRILIPEIAFPRARHPQ 447

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP--------LSNN 258
                    +     +   + I    + + R    +   G     C           +++
Sbjct: 448 YAPSSSDPMTVNVFNSDGTRNITSDTSSNGRWQRYSKYWGSGWGVCPAAAMKLTTMTASD 507

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNE---KESSHNTIGSTRLKKFVIFITDG- 314
                + +  L P   T     M    R L       + +        + + ++F+TDG 
Sbjct: 508 RATFNTYVQSLQPLGGTYHDAGMVWGARLLSPTGLFADENATAPNDRPISRHIVFMTDGA 567

Query: 315 ----------------------ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                                  +      ++     Q+C   R  G+ I+ V+      
Sbjct: 568 MAPNMGNLTFQGYEFLMHRVGGTSDSDLRDRHNNRFTQLCRAARQRGITIWVVSFGVGSN 627

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               L  C  S GQ F  +++ EL E F  I  +I +  +
Sbjct: 628 DS--LNNCASS-GQAFEADNAAELNEQFQAIARQISKLRL 664



 Score = 79.2 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/327 (13%), Positives = 87/327 (26%), Gaps = 31/327 (9%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA  I     F+  A+D+      + ++Q A DA VL+G  ++          +  +  
Sbjct: 27  LTAAAIIPVIGFVGSAVDIGRAYMTQLRLQQACDAGVLAGRRAMG-------GASYDEAA 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                K    +  +                I  +    N      ++ A          L
Sbjct: 80  QAEANKMFNFNFPEA---------KYGATGILFSSRALNASDVEGQASA-----VLPTEL 125

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH-NDNNNMTSNKY 179
             +       LS   T  +E S     + + +VLDV+ SM         N    +     
Sbjct: 126 MFMFGKEEFRLSADCTAKLEIS----NVDVMLVLDVTGSMAQTNAGDSVNRITALKDATM 181

Query: 180 LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG 239
                   +       +    P  + AN    +L ++   L +++    +      V   
Sbjct: 182 DFFDTLTNADVGDGRLRFGVVPYSSTANVGQILLAKNPAWLADTVTLPSRTPIFREVYTE 241

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
           T         +  T  S+N        +   P  N+    A+        +   S     
Sbjct: 242 TGTETSDDYTDSPTTYSSNWTN-----DGTVPASNSAACAALTPPANTTPSPSGSPDYNQ 296

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTL 326
               +       T       +      
Sbjct: 297 TGQYVDGDTRVTTYDTVQTYTFRTYRY 323


>gi|218509981|ref|ZP_03507859.1| hypothetical protein RetlB5_22275 [Rhizobium etli Brasil 5]
          Length = 448

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/328 (13%), Positives = 101/328 (30%), Gaps = 32/328 (9%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LDAA+++    I +          K + S
Sbjct: 28  VALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQINNTEDTD---ALKQKVS 84

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q++     G                     + +   +   + A   +PT  +   
Sbjct: 85  DWFHAQVENSYALGE-------------------IEIDTTNHNITATASGTVPTTFM--- 122

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                A  +    S     +      +++ +V+D S SM                     
Sbjct: 123 ---KIANIDTVPVSVASAVKGPATSYLNVYIVVDTSPSMLLAATTAGQSTMYSGIKCQFA 179

Query: 182 PPPPKKSFWSKNTTKSKYAPAP-APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K T  + Y  +       + DV  ++   +++ I ++  +  +  +++G 
Sbjct: 180 CHTGDTHTIGKKTYANNYDYSTEKGIKLRADVAGDAVREVLDMIDES--DSNHERIKVGL 237

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPAMHHAYRELYNEKESSHNTI 299
                 +       LS ++   +   +       T+        +   L  +  +  +  
Sbjct: 238 YGLGDTLTEVLAPTLSTDIARTRLADSSYGLTSATSKAATYFDVSLATLKQKVGAGGDGT 297

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLN 327
            S    K V+ +TDG  S      + +N
Sbjct: 298 TSGTPLKLVLLLTDGVQSQREWVTDKVN 325


>gi|165924896|ref|ZP_02220728.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|167418907|ref|ZP_02310660.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425152|ref|ZP_02316905.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|270487722|ref|ZP_06204796.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|165923096|gb|EDR40247.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|166962901|gb|EDR58922.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167055915|gb|EDR65696.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|262360782|gb|ACY57503.1| membrane protein [Yersinia pestis D106004]
 gi|270336226|gb|EFA47003.1| conserved hypothetical protein [Yersinia pestis KIM D27]
          Length = 492

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 56/472 (11%), Positives = 124/472 (26%), Gaps = 98/472 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
              +I V    I  + + +H +  R ++  AL+ A L+                     +
Sbjct: 3   FMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVT 62

Query: 62  TIFKKQI-----------------------KKHLKQGSYIRENAGDIAQKAQINITKDKN 98
           +  +  +                          L+    +      + Q        ++N
Sbjct: 63  SYAQSYLPSERFSQPRVVNTYNESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNEN 122

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSE------NLAISICM 152
              +    S A+           G +     ++   +        +      N  I    
Sbjct: 123 GAARKYLSSIAEPIDVVFVTDFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSND 182

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            ++    +   +  K    N   S+ Y   P   K          +Y  +       +D 
Sbjct: 183 GINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDN 242

Query: 213 LIE----SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV------ 262
           L      + G L      AI  +     R   I              +  +N++      
Sbjct: 243 LSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKI 302

Query: 263 -------KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG--------------- 300
                  K  +N ++    T     M       +  KE++  ++                
Sbjct: 303 VEEHIDYKETINSIDRNGET-IDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNM 361

Query: 301 ---------------------STRLKKFVIFITDGENSGASAY------------QNTLN 327
                                S    K +I ++DG+++                    L 
Sbjct: 362 KAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLI 421

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQ--DLLRKCTDSSGQFFAVNDSRELL 377
           T  +C+ +++ G+K+  + +   P+    D  + C  + G F+   ++ EL 
Sbjct: 422 TEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVGT-GNFYLAKNAHELE 472


>gi|209884898|ref|YP_002288755.1| hypothetical protein OCAR_5764 [Oligotropha carboxidovorans OM5]
 gi|209873094|gb|ACI92890.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 600

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 74/195 (37%), Gaps = 16/195 (8%)

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
                  +             + S RI    +    +    TP+SN    + S++N +NP
Sbjct: 406 TWTGCVNDRDQDADTTN-AVMSGSGRIYPEQWKD-CLSATITPMSNQWATLNSKVNAMNP 463

Query: 272 YENTNTYPAMHHAYRELYNEKES--SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT- 328
             NTN    +   ++ L    +   + +   +   + +++ ++DG N+    Y       
Sbjct: 464 SGNTNQAIGLFWGWQTLNTANDPFKAPSKDPNWVYQDYIVILSDGLNTQNRWYTCPNAGP 523

Query: 329 --------LQICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFA-VNDSRELL 377
                     +C+ ++   + I+++ V+   +     +L+ C  S   +F  +  + +  
Sbjct: 524 CPTIDGREKTLCDNIKADKITIFTIQVNINSKDPESQVLKDCASSGSGYFQLITSANDTA 583

Query: 378 ESFDKITDKIQEQSV 392
            +FD + +KI +  +
Sbjct: 584 TAFDNVLNKIAKLRI 598



 Score = 72.6 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/211 (10%), Positives = 53/211 (25%), Gaps = 27/211 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  ++       +  A+D   +   R  MQSALD+A L       +    +  T  +   
Sbjct: 27  IFTLVAIPLVALVGAAVDYTRVSSARTAMQSALDSAALMISKDAATMSDSEITTRARQYV 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +++                            +     NN         A         + 
Sbjct: 87  NSL-----------------YTNTETPIQTFSAVYTPNNGSGATILLNAGGN---MPTYF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT----- 175
             ++ +  + L + +         +  + + +VLD + SM+                   
Sbjct: 127 MKIVGTNFSTLPINTAS--TTKWGSSRMRVALVLDNTGSMDQNGKMTALKKAAANATTGL 184

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPA 206
             K       +   +      +K        
Sbjct: 185 IKKLSAFNTNEGDVYISVVPFAKDVNVGTSN 215


>gi|114704798|ref|ZP_01437706.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
 gi|114539583|gb|EAU42703.1| hypothetical protein FP2506_07676 [Fulvimarina pelagi HTCC2506]
          Length = 545

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 50/358 (13%), Positives = 113/358 (31%), Gaps = 27/358 (7%)

Query: 57  KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
            +  + +        +K  S +   AG+++    +              ++    +    
Sbjct: 191 SNDLTQVALVPFDTQVKATSSLFGAAGNVSVANPLATGSCATISDPLDRDACYASQNAAP 250

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
            +     +   +  +      +  +        +  + D                    +
Sbjct: 251 PVVDCSKLTDLIDAVLCGVNNLGFKVGTTAITDLRYISDRRYDAFIDGNMFRITRKIGEA 310

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ----------- 225
           +   +     K  +S  T     A   APA  K +       +L+               
Sbjct: 311 DCSSVCT--WKKTYSTTTIFETAAGGGAPATSKPNDAETPNNDLIAQYPGPWPRCFVDRS 368

Query: 226 ---KAIQEKKNLSVRIGTIAYNIGIV--GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
               A     N+S +                 T L+ +L  V++ +NKL P  NTN    
Sbjct: 369 QPYDANATAMNISQKDTIYPEAHCATGSLEPITGLTFDLQSVETAVNKLTPSGNTNVTIG 428

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN------TLNTLQICEY 334
           +      L      +    GS  ++K +I +TDG N+    + +         TL  C  
Sbjct: 429 VQWGMEALTAAAPLTGVRTGSE-VRKVMIVLTDGLNTQNRWWGSRDRNKIDARTLAACNN 487

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +  G+++Y+V +      +DLL+ C ++  ++  V  + +L  +F  +  +++   +
Sbjct: 488 AKAMGIELYTVRLVEG--NEDLLKTCAETEDKYHYVTSASQLKTTFADLARQVKGVRL 543



 Score = 56.8 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 37/299 (12%), Positives = 86/299 (28%), Gaps = 38/299 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +T + +         A+DL +   ++N +Q+A+D + L+  +    ++T ++        
Sbjct: 42  ITCLALVPLIAAAGGAVDLWNARRVQNAVQNAVDTSALAAVSYSGEEQTEREKRA----- 96

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                               +   +   A I I     +        KA+Y+I T  L  
Sbjct: 97  --------------------DTLFLNNTAGIAIEDTDLSEEDGAWVYKAEYKIKTNFL-- 134

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++      +  +       +  N  + + +VLD S SM           +     +  
Sbjct: 135 -RVVGIDEFEMESQGAA----ALANSPMDVVLVLDSSGSMAQDNRMVELKASVKLFLEEF 189

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 +              A +        +  +   L       I +  +       
Sbjct: 190 KSNDLTQV---ALVPFDTQVKATSSLFGAAGNVSVA-NPLATGSCATISDPLDRD--ACY 243

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
            + N       C+ L++ ++ V   +N L     T     + +     Y+     +   
Sbjct: 244 ASQNAAPPVVDCSKLTDLIDAVLCGVNNLGFKVGTTAITDLRYISDRRYDAFIDGNMFR 302


>gi|315266493|gb|ADT93346.1| von Willebrand factor type A [Shewanella baltica OS678]
          Length = 627

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/377 (11%), Positives = 105/377 (27%), Gaps = 36/377 (9%)

Query: 22  IMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIREN 81
               + +M+   DAA +         +   +        + + +      L Q  + ++ 
Sbjct: 67  ASQRQAEMR---DAAKVEMARVAAPMQMSSNGAVMGMSIAPMPRDYAAIPLAQNKFEQQV 123

Query: 82  AGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIER 141
              I    +I ++           +    Y      L    L       +          
Sbjct: 124 QNGIMVAGEIPVS-----TFSIDVD-TGSYATLRRMLREGHLPEKGTVRVEEMLNYFAYD 177

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
                 +        S + E      ++D   +         P  +   S        + 
Sbjct: 178 Y----PLPAKNAAPFSVTTELAPSPYNDDMMLLRIGLKGYDLPKSQLGASNLVFLLDVSG 233

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           + A    K+ +L  +   L   +            ++  + Y             N+   
Sbjct: 234 SMASV-DKLPLLQTALKLLTAQLSAQD--------KVSIVVYAGAAGVVLDGASGNDTQT 284

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           +   L +L+   +TN    +  AY+        +            VI  TDG+ +    
Sbjct: 285 LNYALEQLSAGGSTNGGQGITQAYQLAKKHFIPNGINR--------VILATDGDFNVGVT 336

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESF 380
             +  + + + E  ++ G+ + ++          L+ +  D   G +  ++    L E+ 
Sbjct: 337 DFD--DLIALIEKEKDHGIGLTTLGFGLGNYNDQLMEQLADKGNGNYAYIDT---LNEAR 391

Query: 381 DKITDKIQEQSVRIAPN 397
             + D++      IA +
Sbjct: 392 KVLVDELSSTLFTIAKD 408


>gi|304412560|ref|ZP_07394165.1| von Willebrand factor type A [Shewanella baltica OS183]
 gi|307303576|ref|ZP_07583329.1| von Willebrand factor type A [Shewanella baltica BA175]
 gi|304349036|gb|EFM13449.1| von Willebrand factor type A [Shewanella baltica OS183]
 gi|306912474|gb|EFN42897.1| von Willebrand factor type A [Shewanella baltica BA175]
          Length = 627

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 47/410 (11%), Positives = 111/410 (27%), Gaps = 45/410 (10%)

Query: 1   MTAIIISVCFLFI----TYAIDLAHIMY-IRNQMQSAL-------DAAVLSGCASIVSDR 48
           M A+++    L         ++          + Q A        DAA +         +
Sbjct: 31  MAALLLVAVSLTACGGKGAEVEHRQAEQQAEQRHQEASQRQAEMRDAAKVEMARVAAPMQ 90

Query: 49  TIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
              +        + + +      L Q  + ++    I    +I ++           +  
Sbjct: 91  MSSNGAVMGMSIAPMPRDYAVIPLAQNKFEQQVQNGIMVAGEIPVS-----TFSIDVD-T 144

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH 168
             Y      L    L    +  +                 +      V+  +        
Sbjct: 145 GSYATLRRMLREGRLPEKGIVRVEEMLNYFAYDYPLPAKNAAPFS--VTTELAPSPYNDD 202

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
                +    Y L   PK    + N            +  K+ +L  +   L   +    
Sbjct: 203 MMLLRIGLKGYDL---PKSQLGASNLVFLLDVSGSMASADKLPLLQTALKLLTAQLSAQD 259

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                   ++  + Y             N+   +   L +L+   +TN    +  AY+  
Sbjct: 260 --------KVSIVVYAGAAGVVLDGASGNDTQTLTYALEQLSAGGSTNGGQGITQAYQLA 311

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
                 +            VI  TDG+ +      +  + + + E  ++ G+ + ++   
Sbjct: 312 KKHFIPNGINR--------VILATDGDFNVGVTDFD--DLIALIEKEKDHGIGLTTLGFG 361

Query: 349 APPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
                  L+ +  D   G +  ++    L E+   + D++      IA +
Sbjct: 362 LGNYNDQLMEQLADKGNGNYAYIDT---LNEARKVLVDELSSTLFTIAKD 408


>gi|299143633|ref|ZP_07036713.1| von Willebrand factor type A domain protein [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518118|gb|EFI41857.1| von Willebrand factor type A domain protein [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 1217

 Score = 99.6 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/277 (14%), Positives = 79/277 (28%), Gaps = 8/277 (2%)

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
                      ++          I +V+D S SM+D    K   N        +L     
Sbjct: 180 PNIANKWTVKMLVAARDSVKTSKIVLVIDTSGSMKDFGRMKGAKNAANAFVDNVLDGS-- 237

Query: 187 KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
           +S        +      +        L  +   L        Q     +  +   +    
Sbjct: 238 QSTQIGIVRFASNVSIVSDFTSNKAKLHSAINALSAEGGTFTQAGVKQARTMLAGSGADK 297

Query: 247 IV----GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST 302
                  +     +  ++   + L    P  +T+            +   ES+  +  S 
Sbjct: 298 KYMVVLSDGVPTFNYKISHPNNYLIDGGPGSHTHEKQTGKQLPENEFLYNESATGSGNSM 357

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEY--MRNAGMKIYSVAVSAPPEGQDLLRKC 360
             +   + I  G       +        I E    + A M++++V +     G  +LR  
Sbjct: 358 WKQYERVKIGGGIFPTYEYHYYNSGNCAIAESGFAKAANMRVFTVGLQTDATGSGVLRDI 417

Query: 361 TDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
             + G F  V D  +L   F++I  +I +   +   N
Sbjct: 418 ASAPGDFTEVTDVSQLTPVFEQIAAQILKTVNQATVN 454


>gi|328470527|gb|EGF41438.1| hypothetical protein VP10329_07002 [Vibrio parahaemolyticus 10329]
          Length = 461

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 56/467 (11%), Positives = 133/467 (28%), Gaps = 94/467 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +    + +  +  ++++     +   ++++ A + A L+          I  P       
Sbjct: 14  IFVSFLPILIITFSFSVGYTQRLLAHSKIEEAAEVASLAL---------IASPGKDNKDD 64

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               ++ +  ++       E +    +    +    +NN L   A+         ++   
Sbjct: 65  QDYAQRIVDLYITDNISDIEISVSTKKCEYKDGCVQRNNELSPFADFTVVATAEHDSWIS 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY- 179
              I          S   I R      + I  +LD S+SM + +  + N           
Sbjct: 125 HNEIGVE--PKFKVSGDSITRKYLPQPVDIYFILDTSQSMSNPWYGERNKTQMQVVKDTI 182

Query: 180 ---------LLPPPPKKSFWSKNTTKSKYA-PAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                        P KKS  +  T  +  A         K+        +   S +  + 
Sbjct: 183 TRVVKELENFKTGPDKKSRVALLTYNAYNAKFDKGAGRVKLYDYASEFSHTEASFESIVD 242

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK---LNP-YENTNTYPAMHHAY 285
           +  + SV      Y      +Q  PL++   E    LN    +      T ++  +  A 
Sbjct: 243 KMFDESVVEQKPHYASDYNKSQDIPLTDKYQEFIDILNSNKVMPARGGGTQSWLGLIAA- 301

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGEN---------SGASAYQNTLNTLQ------ 330
                 KE+          ++  I ++DG +         +   +Y++  + +       
Sbjct: 302 -----AKEADKVKKEDRNPEQVFIILSDGADTDVQFPMGLNRNRSYRDKYDVVTKYYVDQ 356

Query: 331 -----------------------ICEYMRNA--------------------GMKIYSVAV 347
                                  +CE ++N                      + +  + V
Sbjct: 357 YDGRTYYYQVYDKFLKSLVGEHGLCESLKNRISSKENKFQSEHVKLEGEKTKVTMGVIGV 416

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +   +  D   +C       +   +     + +  I + I E++ R+
Sbjct: 417 NYNVQKDDGFGECV-GEKNIYHAKNG---KDVYKYILNLINEETGRL 459


>gi|160874259|ref|YP_001553575.1| von Willebrand factor type A [Shewanella baltica OS195]
 gi|160859781|gb|ABX48315.1| von Willebrand factor type A [Shewanella baltica OS195]
          Length = 642

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/377 (11%), Positives = 105/377 (27%), Gaps = 36/377 (9%)

Query: 22  IMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIREN 81
               + +M+   DAA +         +   +        + + +      L Q  + ++ 
Sbjct: 82  ASQRQAEMR---DAAKVEMARVAAPMQMSSNGAVMGMSIAPMPRDYAAIPLAQNKFEQQV 138

Query: 82  AGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIER 141
              I    +I ++           +    Y      L    L       +          
Sbjct: 139 QNGIMVAGEIPVS-----TFSIDVD-TGSYATLRRMLREGHLPEKGTVRVEEMLNYFAYD 192

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
                 +        S + E      ++D   +         P  +   S        + 
Sbjct: 193 Y----PLPAKNAAPFSVTTELAPSPYNDDMMLLRIGLKGYDLPKSQLGASNLVFLLDVSG 248

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           + A    K+ +L  +   L   +            ++  + Y             N+   
Sbjct: 249 SMASV-DKLPLLQTALKLLTAQLSAQD--------KVSIVVYAGAAGVVLDGASGNDTQT 299

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           +   L +L+   +TN    +  AY+        +            VI  TDG+ +    
Sbjct: 300 LNYALEQLSAGGSTNGGQGITQAYQLAKKHFIPNGINR--------VILATDGDFNVGVT 351

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESF 380
             +  + + + E  ++ G+ + ++          L+ +  D   G +  ++    L E+ 
Sbjct: 352 DFD--DLIALIEKEKDHGIGLTTLGFGLGNYNDQLMEQLADKGNGNYAYIDT---LNEAR 406

Query: 381 DKITDKIQEQSVRIAPN 397
             + D++      IA +
Sbjct: 407 KVLVDELSSTLFTIAKD 423


>gi|238782874|ref|ZP_04626903.1| tight adherance operon protein [Yersinia bercovieri ATCC 43970]
 gi|238716297|gb|EEQ08280.1| tight adherance operon protein [Yersinia bercovieri ATCC 43970]
          Length = 530

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/480 (9%), Positives = 118/480 (24%), Gaps = 90/480 (18%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             II+      +  + +++ ++  + ++  A++ A L+                  D  S
Sbjct: 45  FIIILPFFIALLFLSFEISQLLQKKAKLSDAIEQATLALTVENDDLPDELQMRKNVDLVS 104

Query: 62  TIFKKQI---------------------KKHLKQGSYIRENAGDIAQKAQINITKDKNNP 100
                 +                        +    +    +      A   I  + N  
Sbjct: 105 NFSSAYLPLEHFSVPEIDIKNNCGQLTYNAKITMSYFANFLSKTAMTNAITTIGTEDNGA 164

Query: 101 LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSM 160
                 +          +       +   +  +     I    +        +L  S   
Sbjct: 165 AIKQVSTIQDKATDVIFVADYSGSMNEGFHGKVPRGEKINALRDVFNRLNGSILKNSNIN 224

Query: 161 EDLYLQKHNDNNNMTSNK-----YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI----D 211
              ++        +         Y   P   K + + N    +Y  +       +    D
Sbjct: 225 LIGFVPFSWGTKRIVIENSQEKKYCHFPFVPKQYRADNNYFRQYTVSGLKKFPGLEGLTD 284

Query: 212 VLIESAGNLV----NSIQKAIQEKKNLSVRIGTIAY-------NIGIVGNQCTPLSNNLN 260
           +   + G L     N++   I+       R   + +          +        + + +
Sbjct: 285 IDKINYGELTLGEYNTLTNVIKNMAKQEYRNKALEFLRITLNIPTYMQQMIFITTTIDYD 344

Query: 261 EVKSRLNK------------------------------------------LNPYENTNTY 278
                +N                                           ++P   T   
Sbjct: 345 ATIKSINSDAQYIDIPLDDIINESICLNNSNAYSLDSHNSHDDLIDKMIAMSPLGQTLVS 404

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA 338
             + +A      E  +S+N +         +FI D     +     TL    +CE ++  
Sbjct: 405 SGILYANTLFKKESNNSNNKLMVIISDGIDVFINDTTIQQSIYISKTLIDKGMCERIKEN 464

Query: 339 GMKIYSVAVSAPPEGQDL------LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +K+  +A+       +        +KC      ++ V+D+ EL  +  +       + V
Sbjct: 465 NIKMVFIAIKDGSNETNEPANYIDWKKCV-GEDNYYYVSDAHELEAALRQSLTTTSSEVV 523


>gi|296120496|ref|YP_003628274.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
 gi|296012836|gb|ADG66075.1| von Willebrand factor type A [Planctomyces limnophilus DSM 3776]
          Length = 396

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/397 (13%), Positives = 119/397 (29%), Gaps = 41/397 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A ++        + + L+++   R ++++A DAA  S    +V  ++           
Sbjct: 25  LAAFVMVALLALAGFFLSLSYVELTRAELRAATDAAARSAVIRLVETQSTTSGRAAARDI 84

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQ--KAQINITKDKNNPLQYIAESKAQYEIPTENL 118
           ++ F+   K      + I+               I     N  +               L
Sbjct: 85  ASRFEVGGKALSLNDNDIQFGRSTRQSNGSYSFAINGTPTNAARVFGRKTKTSAAGPVEL 144

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
              G + +   +  L +  +           I +VLD S SM                  
Sbjct: 145 PFGGFVGAPEYSTELNAVAMRLDY------DIVIVLDRSGSMGWDLSG------------ 186

Query: 179 YLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK---AIQEKKNLS 235
                        +      Y   P P   +  +L  S  + +  + +   A +      
Sbjct: 187 ---VEFEYPEAVRQRPLVENYFSPPDPTGSRWAILSASVNDFLTILNQRQVAARVGLVTY 243

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVK---SRLNKLNPYENTNTYPAMHHAYRELYNEK 292
               T      +     + L++  + +    + + ++     T+    +  A   L    
Sbjct: 244 AGDYTFGKYSSVKLTVESDLTSTFSTITSKLTAIGQVPLIGGTDIGAGITAAQTMLTTSS 303

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
           ++   T      +  +I  +DG  +  +   +             +   I+SV   A  +
Sbjct: 304 QARLKTG-----QPIIIVFSDGMFNQGTEPVSL-----AASAYSQSSTIIHSVTFGATAQ 353

Query: 353 GQDLLRKCTDSSGQ--FFAVNDSRELLESFDKITDKI 387
           G+  +   T ++G+      N + EL ESF  I + I
Sbjct: 354 GRATMNSVTATAGKGLSLHANTAAELAESFRSIANAI 390


>gi|217974408|ref|YP_002359159.1| von Willebrand factor type A [Shewanella baltica OS223]
 gi|217499543|gb|ACK47736.1| von Willebrand factor type A [Shewanella baltica OS223]
          Length = 627

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/410 (11%), Positives = 110/410 (26%), Gaps = 45/410 (10%)

Query: 1   MTAIIISVCFLFI----TYAIDLAHI-MYIRNQMQSAL-------DAAVLSGCASIVSDR 48
           M A+++    L         +           + Q A        DAA +         +
Sbjct: 31  MAALLLVAVSLTACGGKGAEVQHRQAKQQAEQRHQEASQRQAEMRDAAKVEMARVAAPMQ 90

Query: 49  TIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
              +        + + +      L Q  + ++    I    +I ++           +  
Sbjct: 91  MSSNGAVMGMSIAPMPRDYAAIPLAQNKFEQQVQNGIMVAGEIPVS-----TFSIDVD-T 144

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH 168
             Y      L    L    +  +                 +      V+  +        
Sbjct: 145 GSYATLRRMLREGRLPEKGIVRVEEMLNYFAYDYPLPAKNAAPFS--VTTELAPSPYNDD 202

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
                +    Y L   PK    + N            +  K+ +L  +   L   +    
Sbjct: 203 MMLLRIGLKGYDL---PKSQLGASNLVFLLDVSGSMASTDKLPLLQTALKLLTAQLSAQD 259

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                   ++  + Y             N+   +   L +L+   +TN    +  AY+  
Sbjct: 260 --------KVSIVVYAGAAGVVLDGASGNDTQTLTYALEQLSAGGSTNGGQGITQAYQLA 311

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
                 +            VI  TDG+ +      +  + + + E  ++ G+ + ++   
Sbjct: 312 KKHFIPNGINR--------VILATDGDFNVGVTDFD--DLIALIEKEKDHGIGLTTLGFG 361

Query: 349 APPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
                  L+ +  D   G +  ++    L E+   + D++      IA +
Sbjct: 362 LGNYNDQLMEQLADKGNGNYAYIDT---LNEARKVLVDELSSTLFTIAKD 408


>gi|153836414|ref|ZP_01989081.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AQ3810]
 gi|260365465|ref|ZP_05778002.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus K5030]
 gi|260877530|ref|ZP_05889885.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AN-5034]
 gi|260897529|ref|ZP_05906025.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus Peru-466]
 gi|260901731|ref|ZP_05910126.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AQ4037]
 gi|149750316|gb|EDM61061.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AQ3810]
 gi|308087122|gb|EFO36817.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus Peru-466]
 gi|308090607|gb|EFO40302.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AN-5034]
 gi|308108829|gb|EFO46369.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus AQ4037]
 gi|308114384|gb|EFO51924.1| Flp pilus assembly protein TadG [Vibrio parahaemolyticus K5030]
          Length = 461

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/467 (11%), Positives = 132/467 (28%), Gaps = 94/467 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +    + +  +  ++++     +   ++++ A + A L+          I  P       
Sbjct: 14  IFVSFLPILIITFSFSVGYTQRLLAHSKIEEAAEVASLAL---------IASPGKDNKDD 64

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               ++ +  ++       E +    +    +    +NN L   A+         ++   
Sbjct: 65  QDYAQRIVDLYITDNISDIEISVSTKKCEYKDGCVQRNNELSPFADFTVVATAEHDSWIS 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY- 179
              I          S   I R      + I  +LD S+SM + +  + N           
Sbjct: 125 HNEIGVE--PKFKVSGDSITRKYLPQPVDIYFILDTSQSMSNPWYGERNKTQMQVVKDTI 182

Query: 180 ---------LLPPPPKKSFWSKNTTKSKYA-PAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                        P KKS  +  T  +  A         K+        +   S +  + 
Sbjct: 183 TRVVKELENFKTGPDKKSRVALLTYNAYNAKFDKGAGRVKLYDYASEFSHTEASFESIVD 242

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK---LNP-YENTNTYPAMHHAY 285
           +  + SV      Y      +Q  PL++   E    LN    +      T ++  +  A 
Sbjct: 243 KMFDKSVVEQKPHYASDYNKSQDIPLTDKYQEFIDILNSNKVMPARGGGTQSWLGLIAA- 301

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGEN---------SGASAYQNTLNTLQ------ 330
                 KE+          ++  I ++DG +         +   +Y++  + +       
Sbjct: 302 -----AKEADKVKKEDRNPEQVFIILSDGADTDVQFPMGLNRNRSYRDKYDVVTKYYVDQ 356

Query: 331 -----------------------ICEYMRNA--------------------GMKIYSVAV 347
                                  +CE ++                       + +  + V
Sbjct: 357 YDGRTYYYQVYDKFLKSLVGEHGLCESLKKRISSKENKFQSEHAKLEGEKTKVTMGVIGV 416

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +   +  D   +C       +   +     + +  I + I E++ R+
Sbjct: 417 NYNVQKDDGFGECV-GEKNIYHAKNG---KDVYKYILNLINEETGRL 459


>gi|28900585|ref|NP_800240.1| hypothetical protein VPA0730 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808965|dbj|BAC62073.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
          Length = 466

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/467 (11%), Positives = 132/467 (28%), Gaps = 94/467 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +    + +  +  ++++     +   ++++ A + A L+          I  P       
Sbjct: 19  IFVSFLPILIITFSFSVGYTQRLLAHSKIEEAAEVASLAL---------IASPGKDNKDD 69

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               ++ +  ++       E +    +    +    +NN L   A+         ++   
Sbjct: 70  QDYAQRIVDLYITDNISDIEISVSTKKCEYKDGCVQRNNELSPFADFTVVATAEHDSWIS 129

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY- 179
              I          S   I R      + I  +LD S+SM + +  + N           
Sbjct: 130 HNEIGVE--PKFKVSGDSITRKYLPQPVDIYFILDTSQSMSNPWYGERNKTQMQVVKDTI 187

Query: 180 ---------LLPPPPKKSFWSKNTTKSKYA-PAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                        P KKS  +  T  +  A         K+        +   S +  + 
Sbjct: 188 TRVVKELENFKTGPDKKSRVALLTYNAYNAKFDKGAGRVKLYDYASEFSHTEASFESIVD 247

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK---LNP-YENTNTYPAMHHAY 285
           +  + SV      Y      +Q  PL++   E    LN    +      T ++  +  A 
Sbjct: 248 KMFDKSVVEQKPHYASDYNKSQDIPLTDKYQEFIDILNSNKVMPARGGGTQSWLGLIAA- 306

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGEN---------SGASAYQNTLNTLQ------ 330
                 KE+          ++  I ++DG +         +   +Y++  + +       
Sbjct: 307 -----AKEADKVKKEDRNPEQVFIILSDGADTDVQFPMGLNRNRSYRDKYDVVTKYYVDQ 361

Query: 331 -----------------------ICEYMRNA--------------------GMKIYSVAV 347
                                  +CE ++                       + +  + V
Sbjct: 362 YDGRTYYYQVYDKFLKSLVGEHGLCESLKKRISSKENKFQSEHAKLEGEKTKVTMGVIGV 421

Query: 348 SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +   +  D   +C       +   +     + +  I + I E++ R+
Sbjct: 422 NYNVQKDDGFGECV-GEKNIYHAKNG---KDVYKYILNLINEETGRL 464


>gi|148261962|ref|YP_001236089.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|326405471|ref|YP_004285553.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
 gi|146403643|gb|ABQ32170.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|325052333|dbj|BAJ82671.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
          Length = 431

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 52/429 (12%), Positives = 119/429 (27%), Gaps = 63/429 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA++       +   ID    +  ++QM+S                             
Sbjct: 22  ITALVSLTLIFILGMGIDYGLAIDRKSQMES----------------YADAAALAAVTPA 65

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                +       Q  +  +           N              +  QY+  ++ + L
Sbjct: 66  MVAAGQSSAITTAQNVFNAQALTMTGVTYNANDVTVSIATSGDKRTATVQYQAQSQAM-L 124

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS---- 176
             ++      +  ++T     +     I   ++LD S SM     Q   +     +    
Sbjct: 125 PDVMGFGSIKIGGQATATTTIA---PNIDFYLLLDDSPSMAIAATQSGINTMVANTTAQG 181

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPA---PAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
                      S         +   A         +ID+L ++  +L+ + Q    +K  
Sbjct: 182 GCAFGCHEENPSADKLGNPYGEDNYALARSLGVTLRIDMLRQATQDLMTTAQTTETQKGT 241

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP------------YENTNTYPAM 281
                    Y   I  N    L+++L++ ++    +                N +     
Sbjct: 242 TY---RMAIYTFDIGLNTIGNLTSDLSQAQTEAGNIQLLEVYSNNWLTQNDYNDDEDTNY 298

Query: 282 HHAYRELYN--EKESSHNTIGSTRLKKFVIFITDG--ENSGASAYQNTLNTLQICEYMRN 337
             A   +        +         ++ + F+TDG  +       Q +L    +C  ++N
Sbjct: 299 DTALNGINAIMPNPGNGTGAAGDTPQEVLFFVTDGVEDEDVNGNRQQSLLNTDLCTAIKN 358

Query: 338 AGMKI---YSVAVSAPPEG-------------QDLLRKCTDSSGQFFAVNDSRELLESFD 381
            G++I   Y+  +  P                   L++C    G +F V    ++  +  
Sbjct: 359 RGIRIAVLYTEYLPLPTNSWYNTYIAPFQNSIAPTLQQCAS-PGLYFEVKSGGDISAAMS 417

Query: 382 KITDKIQEQ 390
            +     + 
Sbjct: 418 ALFQTAVQS 426


>gi|75675889|ref|YP_318310.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
 gi|74420759|gb|ABA04958.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
          Length = 605

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 96/256 (37%), Gaps = 20/256 (7%)

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
           V+  + S         N +   +           K +W  + T +  A   APA+     
Sbjct: 352 VVVSTGSGASCPSTTPNCSCTGSGRNRKCTQAKYKHYWRAHPTDTNQAKDAAPAHS---T 408

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN----IGIVGNQCTPLSNNLNEVKSRLNK 268
                 +   +   +  +  + S    +  +      G +    TP+S+  + +K++++ 
Sbjct: 409 WTGCINDRDQAYDISNADPSSGSSGTPSTKFYAEQLNGCLPATITPVSSQSSTLKNQIDS 468

Query: 269 LNPYENTNTYPAMHHAYRELYNEKE--SSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
           ++P  +TN    +   ++ L        +     +   + +++ ++DG N+      N  
Sbjct: 469 MSPSGSTNQAIGLAWGWQTLSTTNGPFPAPAKDKAYVYQDYLVLLSDGLNTRNRWSGNGS 528

Query: 327 NTL--------QICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFAVNDSREL 376
           +           +C+ ++++G  I++V V+         +L+ C   +G F  +  + + 
Sbjct: 529 DHSPEVDVRQALLCQKVKDSGTVIFTVQVNVGNRDPLSQVLQDCAS-NGNFQMITSANQT 587

Query: 377 LESFDKITDKIQEQSV 392
            ++F  I  +I +  +
Sbjct: 588 ADAFQNILTQISQLRI 603



 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 51/209 (24%), Gaps = 21/209 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     F+  A+D       R+ MQ+A+D+AVL       ++  +       D  
Sbjct: 28  IFAIALLPVLGFVGAAVDYTRANAARSSMQAAMDSAVLMVSRDAAANPAMTSQQIT-DAV 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
              F             +          A   I       ++                  
Sbjct: 87  QRYFNSLYNDKSAFNVSVSAAYTPSTSSAAAKILASGQGAIE---------------TDF 131

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +      +    ST     +  N  + + +VLD + SM D                 L
Sbjct: 132 MKIAGFPQLSFGTSSTS----TWGNSRMRVALVLDNTGSMRDNGKMAALQRAAKDMIDSL 187

Query: 181 -LPPPPKKSFWSKNTTKSKYAPAPAPANR 208
                     +      +K          
Sbjct: 188 SAFAKTADDVYISIIPFAKDVNVDKSNYN 216


>gi|320158392|ref|YP_004190770.1| protein TadG, associated with Flp pilus assembly [Vibrio vulnificus
           MO6-24/O]
 gi|319933704|gb|ADV88567.1| protein TadG, associated with Flp pilus assembly [Vibrio vulnificus
           MO6-24/O]
          Length = 442

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/435 (10%), Positives = 126/435 (28%), Gaps = 64/435 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++ V  + + +++ +        ++  A + A L+          I  P    ++ 
Sbjct: 29  IFMGMLPVLVIIMVFSMQMTQRHMAHAKITEAAEVASLAL---------IASPKEGDEKN 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +K +  ++              +    +    ++  L    +     +   ++   
Sbjct: 80  QEYAQKIVDHYIPDNKGEVVARVFNRRCEYKDGCVQRSGELAPFTDFVVSAKTKHDSWIS 139

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                  LT           R      + I  ++D+S SM + +        ++ ++   
Sbjct: 140 YNDGEMGLTKDFEVMGTSTSRKFLPQPLDIYFIIDMSGSMVNPWGGSGKTKYDVVADTIN 199

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 + F +   ++         A +K+     +     +S +       N+      
Sbjct: 200 RIVDDLREFKTDRKSRVAVIGFHHTAVKKVGRQRTAFDY--SSYRTPSATVNNMFTAPKI 257

Query: 241 IAYNIGIV--GNQCTPLSNNLNEVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKES 294
            + N        +  PL+ + +   ++ N  N     Y  T ++  +  A +      + 
Sbjct: 258 HSRNDSSNIKTFEDIPLTEDYDAFLTKFNSSNYYASRYGLTESWQGIIGAAQMAEQATD- 316

Query: 295 SHNTIGSTRLKKFVIFITDGENSG---------------ASAYQNTLNTLQICEYMRNA- 338
                     ++  I ++DG +                  + Y N L    +CE ++   
Sbjct: 317 -------LNPEQVFILLSDGRDGDFVRYYLEGRQWREVRYNKYLNRLVKAGLCEKLKTRI 369

Query: 339 -------------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
                               + +  + V+   +  D +  C       +   +     + 
Sbjct: 370 SQKRNVFQSENPSDKASKTKVTMGVIGVNYVVDKSDGIGDC-FGHDNIYHAKEG---NDV 425

Query: 380 FDKITDKIQEQSVRI 394
           +  I + I E++ R+
Sbjct: 426 YKYILNLINEETGRL 440


>gi|255066322|ref|ZP_05318177.1| von Willebrand factor type A domain protein [Neisseria sicca ATCC
           29256]
 gi|255049532|gb|EET44996.1| von Willebrand factor type A domain protein [Neisseria sicca ATCC
           29256]
          Length = 538

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/363 (9%), Positives = 99/363 (27%), Gaps = 29/363 (7%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+ C+  +   +      +    + +    + +     +   E   D   +   ++ +
Sbjct: 23  AALAACSGPLEHSSSSPEGLQSPPNAALSTAAVAEENLPLAENTERYQDQPDQPVKSVAQ 82

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
           +  +      +    Y      L      P     +                     V  
Sbjct: 83  EPVSTFSIDVD-TGSYANVRRFLTNGEQPPKDAVRIEEIVNYFPYNYPLPTDNRPFAV-- 139

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
                 +           +           KK     N               K+ ++ +
Sbjct: 140 ----HTETIDSPWQPEAKLIKIGIQAQDTAKKDLPPANLVFLVDVSGSMDEENKLPLVQK 195

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L   ++           ++  I Y  G           +   + S ++KL     T
Sbjct: 196 TLRILTQQLRPQD--------KVTLITYASGEDLVLPPTSGADKETILSAIDKLRAGGAT 247

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           +   A+  AY +       +            ++  TDG+ +   +   TL    +    
Sbjct: 248 DGESALQMAYEQAQKAFVPNGINR--------ILLATDGDFNVGVSDTETL--KSMVAEK 297

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           R +G+ + ++        +D++ +  D+  G +  +++ +E  +       ++      +
Sbjct: 298 RKSGVSLSTLGFGMGNYNEDMMEQIADAGDGNYSYIDNEKEAKKVLQ---QQLTSTLATV 354

Query: 395 APN 397
           A +
Sbjct: 355 AQD 357


>gi|152999639|ref|YP_001365320.1| von Willebrand factor type A [Shewanella baltica OS185]
 gi|151364257|gb|ABS07257.1| von Willebrand factor type A [Shewanella baltica OS185]
          Length = 642

 Score = 98.1 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/410 (10%), Positives = 107/410 (26%), Gaps = 45/410 (10%)

Query: 1   MTAIIISVCFLFI----TYAIDLAHIMY-IRNQMQSAL-------DAAVLSGCASIVSDR 48
           + A+++    L         ++          + Q A        DAA +         +
Sbjct: 46  IAALLLVAVSLTACGGKGAEVEHRQAEQQAEQRHQEASQRQAEMRDAAKVEMARVAAPMQ 105

Query: 49  TIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
              +        + + +      L Q  + ++    I    +I ++           +  
Sbjct: 106 MSSNGAVMGMSIAPMPRDYAAIPLAQNKFEQQVQNGIMVAGEIPVS-----TFSIDVD-T 159

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH 168
             Y      L    L       +                +        S + E      +
Sbjct: 160 GSYATLRRMLREGRLPEKGTVRVEEMLNYFAYDY----PLPAKNAAPFSVTTELAPSPYN 215

Query: 169 NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
           +D   +            +   S              +  K+ +L  +   L   +    
Sbjct: 216 DDMMLLRIGLKGYDLLKSQLGASNLVFL-LDVSGSMASTDKLPLLQTALKLLTAQLSAQD 274

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYREL 288
                   ++  + Y             N+   +   L +L+   +TN    +  AY+  
Sbjct: 275 --------KVSIVVYAGAAGVVLDGASGNDTQTLTYALEQLSAGGSTNGGQGITQAYQLA 326

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
                 +            VI  TDG+ +      +  +   + E  +  G+ + ++   
Sbjct: 327 KKHFIPNGINR--------VILATDGDFNVGVTDFD--DLTALIEKEKAHGIGLTTLGFG 376

Query: 349 APPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
                  L+ +  D   G +  ++    L E+   + D++      IA +
Sbjct: 377 LGNYNDQLMEQLADKGNGNYAYIDT---LNEARKVLVDELSSTLFTIAKD 423


>gi|170681089|ref|YP_001744470.1| von Willebrand factor type A domain-containing protein [Escherichia
           coli SMS-3-5]
 gi|218700745|ref|YP_002408374.1| hypothetical protein ECIAI39_2418 [Escherichia coli IAI39]
 gi|170518807|gb|ACB16985.1| von Willebrand factor type A domain protein [Escherichia coli
           SMS-3-5]
 gi|218370731|emb|CAR18544.1| conserved hypothetical protein [Escherichia coli IAI39]
          Length = 588

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/381 (10%), Positives = 111/381 (29%), Gaps = 45/381 (11%)

Query: 20  AHIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
           A     +  +Q  L AA           + +     T +  Q      KQ+ ++      
Sbjct: 75  AQQYSDKQALQGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPVKQVAQNPLATFS 134

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
           +  + G  A   +         P     E    Y  P++ +             S     
Sbjct: 135 LDVDTGSYANVRRFLNHGQLPPPDAVRVEEMVNY-FPSDWVINDKSNNKEPVPASKPIPF 193

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
            +         +    L     +      +    +N+                       
Sbjct: 194 AMRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI------------------- 234

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                   ++ ++ ++  S   LV  +++           I  + Y         +   +
Sbjct: 235 -DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGS 285

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           +  E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +
Sbjct: 286 HKAEINAAIDSLDADGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFN 337

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSREL 376
                 +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L
Sbjct: 338 VG--IDDPKSIESMVKKQRESGVSLSTFGVGDSNYNEAMMVRIADVGNGNYSYIDT---L 392

Query: 377 LESFDKITDKIQEQSVRIAPN 397
            E+   +  ++++  + +A +
Sbjct: 393 AEAQKVLNSEMRQTLISVAKD 413


>gi|163759224|ref|ZP_02166310.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
 gi|162283628|gb|EDQ33913.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
          Length = 541

 Score = 98.1 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 70/202 (34%), Gaps = 34/202 (16%)

Query: 226 KAIQEKKNLSV-RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
           K      N    +        G       PL+ + +++++ +  L    +TN    +   
Sbjct: 339 KVDNSPSNFYSNKKDPKGPGFGCEMEPLVPLTTDFSKIRTTVKALEANGSTNMLEGVMWG 398

Query: 285 YRELYNEKESSHNTIGST-RLKKFVIFITDGENSGASAYQN------------------- 324
           +R L + +  +     S   ++K +IF+TDG+NS  +   +                   
Sbjct: 399 WRVLSDREPFAQGAPKSDASVEKIMIFLTDGQNSFGNLNNDLGSAYTSMGYLVDGRLDGM 458

Query: 325 ------------TLNTLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVN 371
                          T   CE  +  G+ IY++ +     G   +L +C  SS  +F   
Sbjct: 459 TAANIGQTNNALDKKTKAACENAKEDGVTIYTIRLEEADVGTGKMLEECATSSAHYFDAP 518

Query: 372 DSRELLESFDKITDKIQEQSVR 393
             ++L   FD I   + +  + 
Sbjct: 519 SRQQLTPIFDAIKKGVVKLRLT 540



 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/339 (10%), Positives = 94/339 (27%), Gaps = 35/339 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             I+     +    A+D   +   ++++Q+A+D+A L    +     T      K   T+
Sbjct: 19  FGILAVPVMVAGGLAVDYVGLSVEKSKLQNAVDSAALLIARAGDMSETQAMKLAKTTITT 78

Query: 62  TIFKKQIK---------KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYE 112
                  K           +K         G    +    ++ +      Y     A   
Sbjct: 79  NYGINVAKVAVSMVDGDATVKASMDQALVFGGFMGRKNAAVSAEATATYAYTKYEIALVL 138

Query: 113 IPTENLFLKGLIPSALTNL----SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ-- 166
             T ++    L       +     + + G+ +   +   +     ++V            
Sbjct: 139 DTTGSMLGGKLTSLQNAVIGLVDGMEALGLNKEQLKFAVVPYAGFVNVGPEYGPTINGAG 198

Query: 167 -------KHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP---APANRKIDVLIES 216
                     D +          P     F   N  K ++        PA++ +  + ++
Sbjct: 199 KVKKPAAAWIDQDAKAPIPQSDLPSDFSRFAMFNHLKVEWPGCVETRVPADKILHDVKDT 258

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE--- 273
             ++ +  +        +        Y    + +   P+  N      + ++L  Y    
Sbjct: 259 VPDITDP-KSLFTPFFAIDEPDNKWGYPNSYLPDGGKPVKGNKATEAEKQDQLARYGKTG 317

Query: 274 ------NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
                 NT+   A+   ++++  +   S+        K 
Sbjct: 318 EYKKPKNTDDAIALTGKWKKVKVDNSPSNFYSNKKDPKG 356


>gi|284922261|emb|CBG35346.1| putative lipoprotein [Escherichia coli 042]
          Length = 588

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/381 (10%), Positives = 111/381 (29%), Gaps = 45/381 (11%)

Query: 20  AHIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
           A     +  +Q  L AA           + +     T +  Q      KQ+ ++      
Sbjct: 75  AQQYSDKQALQGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPVKQVAQNPLATFS 134

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
           +  + G  A   +         P     E    Y  P++ +             S     
Sbjct: 135 LDVDTGSYANVRRFLNHGQLPPPDAVRVEEMVNY-FPSDWVINDKSNNKEPVPASKPIPF 193

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
            +         +    L     +      +    +N+                       
Sbjct: 194 AMRCELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI------------------- 234

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                   ++ ++ ++  S   LV  +++           I  + Y         +   +
Sbjct: 235 -DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGS 285

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           +  E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +
Sbjct: 286 HKAEINAAIDSLDAEGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFN 337

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSREL 376
                 +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L
Sbjct: 338 VG--IDDPKSIESMVKKQRESGVSLSTFGVGDSNYNEAMMVRIADVGNGNYSYIDT---L 392

Query: 377 LESFDKITDKIQEQSVRIAPN 397
            E+   +  ++++  + +A +
Sbjct: 393 AEAQKVLNSEMRQTLISVAKD 413


>gi|319638170|ref|ZP_07992933.1| von Willebrand factor type A domain-containing protein [Neisseria
           mucosa C102]
 gi|317400443|gb|EFV81101.1| von Willebrand factor type A domain-containing protein [Neisseria
           mucosa C102]
          Length = 530

 Score = 97.7 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/363 (10%), Positives = 98/363 (26%), Gaps = 29/363 (7%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+ C+  +               S +    + +     +   E   D   +   ++ +
Sbjct: 15  AALTACSGPLDRSDSSTENLHGAPDSALPATAVAEENLSLTENTERYQDQPDQPVKSVAQ 74

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
           +  +      +    Y      L      P     +                     V  
Sbjct: 75  EPVSTFSIDVD-TGSYANVRRFLNSGKQPPKDAVRIEEIINYFPYNYPLPTDGRPFAV-- 131

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
                 +           +           KK     N               K+ ++ +
Sbjct: 132 ----HTETIDSPWQPEAKLIKIGIQAQDTAKKDLPPANLVFLVDVSGSMDEENKLPLVQK 187

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L   ++           ++  I Y+ G          ++   +   ++KL    +T
Sbjct: 188 TLRILTQQLRPQD--------KVTLITYSSGEELVLPPTSGSDKETILKAIDKLKAEGST 239

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           +   A+  AY E       +            ++  TDG+ +   +   TL    +    
Sbjct: 240 SGESALRMAYEEAQKAFVPNGINR--------ILLATDGDFNVGVSDTETL--KSMVAEK 289

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           R  G+ + ++        +D++ +  D+  G +  +++ +E  +       ++      +
Sbjct: 290 RKTGISLSTLGFGTDNYNEDMMEQIADAGDGNYSYIDNEKEAKKVLQ---QQLTSTLATV 346

Query: 395 APN 397
           A +
Sbjct: 347 AQD 349


>gi|146337717|ref|YP_001202765.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
 gi|146190523|emb|CAL74522.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
          Length = 418

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 61/425 (14%), Positives = 120/425 (28%), Gaps = 61/425 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI       F+   ID +    +R ++Q A+D AVL+G A+              D  
Sbjct: 22  LFAIACVPVLAFVGAGIDYSMANKLRTKLQMAIDEAVLAGVAA---------GKAALDSG 72

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T             SY   N   I     IN T      L     + +       N   
Sbjct: 73  ATQAAAIAMAQAASSSYFTGNTAKIDATPTINFT-TMGRTLSGTGSATS-----VMNTSF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+      L+  S            +++ +++D+S SM     Q         +   L
Sbjct: 127 MRLVGFPTMTLNASSASSAT---MQPYLNVYLLVDISSSMLLPATQAGITQMRNGTGCAL 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     S +               +  V+ +   NL+  +  +   K    V++G 
Sbjct: 184 ACHETTNGTDSYSYALKNNV------LLRYQVVNQGVQNLLTYLNSSAVYKN--YVKVGL 235

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG 300
            +++  +        S +          L   +                +   ++ +   
Sbjct: 236 WSFDNQLTQLSSLTSSFSSVAANFPAPGLAYNDA-AAATPFDSLIGSFVSSVGTAGDGST 294

Query: 301 STRLKKFVIFITDGENSGASAYQNTLN--------TLQICEYMRNAGMKIYSV------- 345
           S   +K VI  TDG N    A+ +  +            C   ++ G+ +  +       
Sbjct: 295 SATPQKLVIIATDGVNDPTRAWTSQTSLRSQVRVFNTAFCNTFKSNGVTVAIINTPYYPM 354

Query: 346 ----AVSAP-------------PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
                 +A               +    L+ C      F   +D   +  +F  + +K  
Sbjct: 355 TWDWGYNATLGQPGSLGGATRVDDIPIALKSCA--GSNFIIASDVATIQNAFTTLFNKAS 412

Query: 389 EQSVR 393
              + 
Sbjct: 413 PVRLT 417


>gi|37676262|ref|NP_936658.1| hypothetical protein VVA0602 [Vibrio vulnificus YJ016]
 gi|37200803|dbj|BAC96628.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 442

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/435 (9%), Positives = 126/435 (28%), Gaps = 64/435 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++ +  + + +++ +        ++  A + A L+          I  P    ++ 
Sbjct: 29  IFMGMLPILVIIMVFSMQMTQRHMAHAKITEAAEVASLAL---------IASPKEGDEKN 79

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +K +  ++              +    +    ++  L    +     +   ++   
Sbjct: 80  QEYAQKIVDHYIPDNKGEVVARVFHRRCEYKDGCVQRSGELAPFTDFVVSAKTKHDSWIS 139

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                  LT           R      + I  ++D+S SM + +        ++ ++   
Sbjct: 140 YNEGEMGLTKDFEVMGTSTSRKFLPQPLDIYFIIDMSGSMVNPWGGSGKTKYDVVADTIN 199

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 + F +   ++         A +++     +     +S +       N+      
Sbjct: 200 RIVDDLREFKTDRKSRVAVIGFHHTAVKQVGRQRTAFDY--SSYRTPSATVNNMFTAPKI 257

Query: 241 IAYNIGIV--GNQCTPLSNNLNEVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKES 294
            + N        +  PL+ + +   ++ N  N     Y  T ++  +  A +      + 
Sbjct: 258 HSRNDSGNIKTFEDIPLTEDYDAFLTKFNSSNYYASRYGLTESWQGIIGAAQMAEQATD- 316

Query: 295 SHNTIGSTRLKKFVIFITDGENSG---------------ASAYQNTLNTLQICEYMRNA- 338
                     ++  I ++DG +                  + Y N L    +CE ++   
Sbjct: 317 -------LNPEQVFILLSDGRDGDFVRYYLEGRQWREVRYNKYLNRLVKAGLCEKLKTRI 369

Query: 339 -------------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
                               + +  + V+   +  D +  C       +   +     + 
Sbjct: 370 SQKRNVFQSENPSDKASKTKVTMGVIGVNYVVDKSDGIGDC-FGHDNIYHAKEG---NDV 425

Query: 380 FDKITDKIQEQSVRI 394
           +  I + I E++ R+
Sbjct: 426 YKYILNLINEETGRL 440


>gi|254512360|ref|ZP_05124427.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221536071|gb|EEE39059.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 668

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 53/415 (12%), Positives = 101/415 (24%), Gaps = 100/415 (24%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGC------------------- 41
           +T  +I + F    +A+DL      R ++Q ALD AVL+                     
Sbjct: 37  LTLFLIMIVFTVAGFAVDLMRYDRERVRLQYALDRAVLAAADLDQELCPRVVVNDYISKE 96

Query: 42  -----------ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQ 90
                          +        +  D T +             +     +G     + 
Sbjct: 97  GFDPGIIDEIKVDPETCLNTDSSDSDGDGTDSSDASGSDSDPSDTASSGTESGSDGTSSG 156

Query: 91  INITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISI 150
            +             + K + E   +       +  +  + ++ ST +         + I
Sbjct: 157 GDTAGTSTTTNAVELQGKRKVEASAQLNIETHFMKWSGVD-TINSTAVSAAEESIGNVEI 215

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
            +VLDVS SME      +         K +L      S        S+    P     KI
Sbjct: 216 SLVLDVSGSME-GAKLTNLQKAAKDFVKEMLEKSADDSLSISIIPYSEQVGVPDYMMDKI 274

Query: 211 DV-----LIESAGNLVNSIQKAIQE----------------------------------- 230
           +      +                                                    
Sbjct: 275 NTTGGNKVANCIEFQPADFTAIPFTAFSIGAPSEATNPPPSVPQSLHFTNRSNDFRRGGN 334

Query: 231 -----KKNLSVRIGTIAYNIGIVGNQCTP------LSNNLNEVKSRLNKLNPYENTNTYP 279
                  ++  R      N     +  T       + N+L+ +  ++N L    +T+   
Sbjct: 335 RDHRSTNDVVSRFSPWDANFPCREDTPTDRREMVVIQNDLDTLNKQINNLVAAGSTSINI 394

Query: 280 AMHHAYRELYNEKES-----------------SHNTIGSTRLKKFVIFITDGENS 317
            +      L    +                        +T   K V+ +TDG+N 
Sbjct: 395 GLKWGLALLDESIQPLIKTVANDTNVPKIFEDRPRPTNTTDTLKVVVLMTDGKND 449



 Score = 58.0 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 29/74 (39%), Gaps = 1/74 (1%)

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
              +     + +C       + I+S+A  AP   + +L+ C     +++      ++   
Sbjct: 595 DISKKNEQVVSLCGKAEEKEVLIFSIAFEAPSSVKQMLKDCAVKPARYYEAT-GTQIERV 653

Query: 380 FDKITDKIQEQSVR 393
           FD I+  IQ   + 
Sbjct: 654 FDSISTSIQNLRLT 667


>gi|84688081|ref|ZP_01015939.1| hypothetical protein 1099457000215_RB2654_05415 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84663909|gb|EAQ10415.1| hypothetical protein RB2654_05415 [Rhodobacterales bacterium
           HTCC2654]
          Length = 595

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/398 (10%), Positives = 97/398 (24%), Gaps = 85/398 (21%)

Query: 1   MTAIIISVCF-LFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQ 59
           +  I + +   L    A+D       R  +Q  LD A+L+  +    D+ +       D 
Sbjct: 31  IFGIAVFMLMCLAGGIAVDTMRYETHRVHVQGTLDRAILAAASL---DQDLDPEEVVLDY 87

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
            +      +         + EN  +      + +T           E+     +PT  L 
Sbjct: 88  FTKAGLGHVISQ--DDIDVFENQTNGEVADDVAVTT-------RRVEASVSALMPTTFLR 138

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
           L  +           +   +  S  +L + +   +  S S     + +         N  
Sbjct: 139 LAHMYDLG-LYTEGGAEEALSLSEISLVLDVSGSMGNSSSSGYSKIYELRRAAKRFVNVM 197

Query: 180 LLPPPP----------KKSFWSKNTTKSKYAPAPAPANRKI-----DVLIESAGNLVNSI 224
           L  P            +          ++    P+   ++                 +  
Sbjct: 198 LCNPADADETEDCTLTEGDISINIVPYAEQVLLPSNLLQRFNHTSEHTESRCITFYEDEF 257

Query: 225 QK---------------------------------------AIQEKKNLSVRIGTIAYNI 245
                                                    +     + S      + + 
Sbjct: 258 DTVAVPTFSLDTFVTNGRPLPALYGDPIQLTGYFDPSGGTNSTPNPGSNSPCYNDYSGST 317

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH-----------------AYREL 288
                +  P+  +   ++  ++ L    NT+    M                   A  E+
Sbjct: 318 NDYWREIYPMGFSAEALRDEIDDLGASGNTSIDLGMKWGAALLDPAAQPAISDLVAANEV 377

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
               +          ++K ++ +TDGEN+     +   
Sbjct: 378 NEAFDGRPFEYTQRGIEKVIVLMTDGENTSQDYLRRGY 415



 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 38/102 (37%), Gaps = 3/102 (2%)

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     +    ++        +   +  +   N  +IC   +NAGM ++++     
Sbjct: 495 TFPQLWLQKTANWYDQWNFLA--DAHDYFNYSEKNDNLDEICTAAKNAGMVVFTIGFEVS 552

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               D++R C  +   +F V D  ++  +F  I  +I +  +
Sbjct: 553 GSQHDIMRSCASAPAYYFDV-DGLDISAAFAAIAREISKLRL 593


>gi|209546922|ref|YP_002278840.1| hypothetical protein Rleg2_4864 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538166|gb|ACI58100.1| hypothetical protein Rleg2_4864 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 462

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 43/327 (13%), Positives = 99/327 (30%), Gaps = 32/327 (9%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LDAA+++    I +          K + S
Sbjct: 39  VALSLVPMLVAVGASFDYIRSYNVRQKMQSDLDAALIAAVKQINNTADAD---ALKAKVS 95

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q+                        + +   +   +   + A     T      
Sbjct: 96  DWFHAQVDNSY-------------------TLGEIDIDTANHNITATAS---GTVPTTFM 133

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            +       +S+ S     +      +++ +V+D S SM                     
Sbjct: 134 KIANIDTVPVSVGS---AVKGPATSYLNVYIVIDTSPSMLLAATTSGQSTMYSGIGCQFA 190

Query: 182 PPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K T  + Y  + A     + DV  ++  ++++ I  +  +  +  +++G 
Sbjct: 191 CHTGDAHTVGKKTYANNYEYSTAKNIKLRADVAGDAVKDVLSLIDTS--DSNHERIKVGL 248

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPAMHHAYRELYNEKESSHNTI 299
            +    +       LS +    +           T+        +   L  +  +  +  
Sbjct: 249 YSLGDTLTEVLAPTLSTDTARTRLSTASYGLTSATSKAATYFDVSLATLKQKVGAGGDGT 308

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTL 326
            S    K V+ +TDG  S      +++
Sbjct: 309 TSGTPLKLVLLLTDGVQSKREWVTDSV 335


>gi|307941972|ref|ZP_07657325.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307945282|ref|ZP_07660618.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307771155|gb|EFO30380.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774878|gb|EFO34086.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 412

 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 57/405 (14%), Positives = 127/405 (31%), Gaps = 61/405 (15%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVL-SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
             ID++     R+Q Q   D   L +                 + +  T  +K +    K
Sbjct: 37  VGIDMSFAYNKRDQSQLVADEVSLFAVTTFRKYVADGMSKNQARKRAETDARKFLTARTK 96

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
                 E          INI   +   ++       ++E      ++   +     + + 
Sbjct: 97  SLDGTTEKFSIK-----INIVDREAKVVKANVNISGKHES-----YMTHAMGFDNIDYTA 146

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
            S      S          ++DVS SM      +                 P  S  S+ 
Sbjct: 147 DSES--TISFGQGKYEFIFLVDVSPSMGIGASNRDRQIMQRAIGCQFACHEPWYSSVSR- 203

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                     A A  +IDV+ ++  +LV  +++A      + +R G  +++     +  T
Sbjct: 204 -------AKSAGARLRIDVVKDALKSLVTQLEEA----TEVDLRTGLYSFSN--YLHIQT 250

Query: 254 PLSNNLNEVKSRLNKLN------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
            L+  +++ K   NK+           TN +           +      +      +K+ 
Sbjct: 251 GLNKGISKFKREANKIAIHREYLRGGGTNFHG-------VFSDFNGVLRSLKPKADVKQH 303

Query: 308 VIFITDGEN--------------SGASAYQNTLN-TLQICEYMRNAGM-KIYSVAVSAPP 351
           +I I+DG N                 +      +   + C+  +   +  ++++ V    
Sbjct: 304 IIIISDGVNHLNLRSGTNRHLWNQTPNWRPYNYSFNPRWCDEFKKGEVRTVHTMLVEPDR 363

Query: 352 E-----GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                     +R C  S+  F++ N + E+ ++F  + + + +  
Sbjct: 364 AHYVRASTSSMRACATSADFFYSANSAAEIDKAFKDLFEALLKSV 408


>gi|54309668|ref|YP_130688.1| hypothetical protein PBPRA2504 [Photobacterium profundum SS9]
 gi|46914106|emb|CAG20886.1| hypothetical protein PBPRA2504 [Photobacterium profundum SS9]
          Length = 494

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 52/474 (10%), Positives = 134/474 (28%), Gaps = 97/474 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TA+ +   F  I +A++    +  +N++  A +AA L+   +   D+T ++        +
Sbjct: 15  TALALIPLFGMIFWALEGTRYIQKKNRLADATEAATLAVTTANQDDKTYEN-----QLAT 69

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
              +  I+ ++   + I+    +           ++    QY   +K  +     +  + 
Sbjct: 70  NYVQTYIR-NIAIINDIKVERSEGIDYYPTPDGNEEREYFQYRVTAKTDHTSWLSSDIIP 128

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND----------- 170
              P+        +         +  I I  V D S SM+   ++   D           
Sbjct: 129 SFSPTETVANRALAR-NYPIYLGDKDIDIVFVSDFSGSMKGNKIRALKDAIQAIANEILV 187

Query: 171 --------NNNMTSNKYLLPPPPKKSF-------WSKNTTKSKYAPAPAP---ANRKIDV 212
                    N +    Y +    K+S               +    +       +     
Sbjct: 188 PRDGEVEVTNRIAFVPYNMRVQEKRSNTRWCLTQLDYRPNFNGGNYSSYEDIDWSTWSTW 247

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK--------- 263
                 +  N       +K+  +  +  I               +  + +          
Sbjct: 248 TRNQVRDCSNGYYSCTGKKRRDARTVYAILNTSKSETGSGWYFPDPYSYINFPDSVAKTF 307

Query: 264 -SRLNKLN--------PYEN------------------------------TNTYPAMHHA 284
            ++ N L                                           T+ Y  +   
Sbjct: 308 TAKANNLQFQSTNQKLYSGGMCSGNFWTIPLTSEKTTLSPIQNNMSPDGGTSVYQGLIRG 367

Query: 285 YRELYNEKESSHNTIGSTRLK---KFVIFITDGENSGASAYQNTLNTLQICEYMR----- 336
            + L   + +S +   S       K ++ ++DG+     +  N L    +C  ++     
Sbjct: 368 AQILEQGRPTSPSPETSAAYNSRIKMILMLSDGQEMPYVSTFNQLVNQGLCNTIKAQFND 427

Query: 337 -NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            +  + +  + +    +GQ   + C   +     + +  ++ +   +I + I+E
Sbjct: 428 SDQQLYMGVLGIEFDAQGQQGFKNCVGQNN----ITNVDDVDDLIKEILEMIKE 477


>gi|70733679|ref|YP_257319.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347978|gb|AAY95584.1| von Willebrand factor type A domain protein [Pseudomonas
           fluorescens Pf-5]
          Length = 582

 Score = 96.5 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 46/406 (11%), Positives = 111/406 (27%), Gaps = 45/406 (11%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTST 62
                +        +         +  Q AL AA          +    D T  K     
Sbjct: 14  GFAAGLLLAVAGCGVSSKPESAAGSSTQGALQAA-----PQAQYEVQHADATMAKRAVH- 67

Query: 63  IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAES----------KAQYE 112
              +         S           + +    K  +NP+  +AE+             Y 
Sbjct: 68  -PMRLSAPMPAPISSRDSLVAGYRDEPREQYQKLPDNPIHSVAEAPVSTFSADVDTGAYA 126

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNN 172
                L    L P     L           +     S   V             +     
Sbjct: 127 NVRRLLNQGSLPPEGAVRLEELVNYFPYDYALPTDGSPFGVTTELAPSPWNPHTRLLRIG 186

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              S++ +    P    +  + + S       P      ++  +   LV+ ++       
Sbjct: 187 IKASDRAVAELAPANLVFLVDVSGSMDRREGLP------LVKSTLKLLVDQLRDQD---- 236

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
               R+  + Y              +  ++++ +++L    +T     +  AY+      
Sbjct: 237 ----RVSLVVYAGESRVVLEPTSGRDKAKIRTAIDQLTAGGSTAGASGIQLAYQMAQQGF 292

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                          ++  TDG+ +   +  ++L    +    R +G+ + ++       
Sbjct: 293 IDQGINR--------ILLATDGDFNVGVSDFDSL--KAMAAEKRKSGVSLTTLGFGVDNY 342

Query: 353 GQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            + L+ +  D+  G +  +++   L E+   + D++      +A +
Sbjct: 343 NEHLMEQLADAGDGNYAYIDN---LREARKVLVDQLSSTLAVVAKD 385


>gi|315499132|ref|YP_004087936.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315417144|gb|ADU13785.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 519

 Score = 96.5 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 72/216 (33%), Gaps = 8/216 (3%)

Query: 183 PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ-KAIQEKKNLSVRIGTI 241
                +  + + +      +   ++           +   S          ++       
Sbjct: 304 TTSTGTSVAYSPSGYTAFSSSYFSSLATSSWGGCLTDRNQSFDVSVAPYATDVVDSNYIA 363

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIG 300
           A        +   L+++   V + L+ L+P  NTN    +      L   +  +     G
Sbjct: 364 ASCSTTALAKVLDLTSDFTSVNTYLSSLSPGGNTNITLGVQFGMEMLSPAEPYTKATAFG 423

Query: 301 STRLKKFVIFITDGENSGASAYQN----TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
            T +KK++I +TDG N+      +       T   C   +  G+ ++ V V        L
Sbjct: 424 DTDVKKYMIIVTDGANTQNRWSTSNSAINARTALACTAAKAQGITLFVVRV--EDGDSSL 481

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           L  C   S  ++ ++ + +L ++   I   I +  +
Sbjct: 482 LEACASQSSYYYDLSQASDLTKTMQDIFATINKLRL 517



 Score = 56.1 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/219 (11%), Positives = 53/219 (24%), Gaps = 27/219 (12%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  +   +       A+D+       +++Q A DAAVL     I                
Sbjct: 22  IFGLCAVILVGAAGGAVDMMRYFDTSSRLQDATDAAVLKATQKIEVSEAAAKTAAAMAFE 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             +      +       I  +           IT+                       + 
Sbjct: 82  MNLSDHPELQTASHTFAIETSDNAKVVHYTSEITQRP---------------------YF 120

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+      + + S+   E    +    +  VLD + SM       +   +  +    L
Sbjct: 121 LQLLGLGEQTIRVASSAQSE----SDPFELLFVLDTTGSMASNNKMTYLKTSVSSVLSSL 176

Query: 181 LPPPPKKSFWSK--NTTKSKYAPAPAPANRKIDVLIESA 217
           +      +   K      +     PA  +       +  
Sbjct: 177 ISTYGDGNEDVKVGVVAFNTQVRLPASTSYSFVDYTQCY 215


>gi|312958282|ref|ZP_07772803.1| von Willebrand factor type A domain [Pseudomonas fluorescens WH6]
 gi|311287346|gb|EFQ65906.1| von Willebrand factor type A domain [Pseudomonas fluorescens WH6]
          Length = 546

 Score = 96.1 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 43/366 (11%), Positives = 106/366 (28%), Gaps = 29/366 (7%)

Query: 33  LDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQIN 92
           +D   LS             P       +    KQ    L   S  RE   ++       
Sbjct: 38  VDTGPLSVLEPYPVPVARSKPMPMPAPMTARLAKQESATLDYRSEPREQYANLPDNPVHR 97

Query: 93  ITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM 152
           + +   +      +    Y      L    L P     L           +     S   
Sbjct: 98  VAETPVSTFSVDVD-TGSYANVRRFLNQGSLPPEGAVRLKEMVNYFPYHYALPTDGSPFG 156

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
           V     +       +        S++ +    P    +  + + S       P      +
Sbjct: 157 VTTEVAATPWNPRTQLLRIGIKASDRAVAELAPANLVFLVDVSGSMDRREGLP------L 210

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
           +  +   LV+ +++          R+  + Y              +  ++++ +++L   
Sbjct: 211 VQSTLKLLVDQLREQD--------RVSLVVYAGESRVVLPPTSGRDKAKIRTAIDQLTAG 262

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
            +T     +  AY+                     ++  TDG+ +   +  ++L   Q+ 
Sbjct: 263 GSTAGASGIQLAYQMAREGFIDKGINR--------ILLATDGDFNVGISDFDSL--KQMA 312

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQS 391
              R +G+ + ++        + L+ +  D+  G +  ++    L E+   + D++    
Sbjct: 313 AEQRKSGVSLTTLGFGVDNYNEHLMEQLADAGDGNYAYIDT---LREARKVLVDQLSSTL 369

Query: 392 VRIAPN 397
             +A +
Sbjct: 370 TVVARD 375


>gi|327262385|ref|XP_003216005.1| PREDICTED: vitrin-like [Anolis carolinensis]
          Length = 748

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/352 (12%), Positives = 91/352 (25%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            +  + + +K+   K  Q   +            ++  ++ G+      + I      P 
Sbjct: 418 KTYANSKDLKNAIEKILQKGGLSNVGKALSFVNKNFFEDSNGNRGAAPNVAIVMVDGWPT 477

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E+         N+F   +                         +    ++V     
Sbjct: 478 DKVEEASRLARESGINIFFVTIEGPDENEKQNVVEANF-VDKAVCRTNGYYSINVPSWFS 536

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +         VL   A    
Sbjct: 537 LHK---VVQPLVKRICDSDHLACSKTCLNSADIGFVIDGSSSVGTGNFRTVLQFVAN--- 590

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
                   E  +   RIG + Y             +   +V + + ++N     T+T  A
Sbjct: 591 ---ISKEFEISDTDTRIGAVQYTYEQRLEFGFEKQSTKQDVLNAIKRINYWSGGTSTGAA 647

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +++A+ +L+               +K +I ITDG +          +           G+
Sbjct: 648 INYAFEQLF--------IKSKPNKRKIMILITDGRSYD--------DVQGPATAAHQNGV 691

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSG--QFFAVNDSRELLESFDKITDKIQEQ 390
             YSV +      QD L            F V++   L     +I   I  +
Sbjct: 692 ITYSVGI--AWAAQDELEAIATDPDKEHSFFVDEFDSLYRFVPRIIQNICTE 741



 Score = 47.2 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 31/321 (9%), Positives = 82/321 (25%), Gaps = 41/321 (12%)

Query: 92  NITKDKNNPLQYIAESKAQYEIPTE--NLFLKGLIPSALTNLSLRSTGIIERSSENLAIS 149
           +I     +P      + A  ++         + L  ++    +               I+
Sbjct: 250 DIGSSNVHPAYSSVAAVASRQVQAVQGRTQNQALRGASSYASNRNIPRPNTGLQRQEPIA 309

Query: 150 ICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP----KKSFWSKNTTKSKYAPA--- 202
                  +        +      +   +                 S      K       
Sbjct: 310 AFR-KPANNPANLAMERDLWKPASTLLDTGFSSKEDLVPKTLEPASHGNPNCKVDVCFLI 368

Query: 203 ---PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
               +   R+  +      ++  S+   +         +G I Y              N 
Sbjct: 369 DGSWSIGKRRFQIQKHFLKDVAQSLDVGVAGPL-----MGIIQYGDDPSTEFNLKTYANS 423

Query: 260 NEVKSRLNK-LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
            ++K+ + K L     +N   A+    +  + +   +     +       I + DG  + 
Sbjct: 424 KDLKNAIEKILQKGGLSNVGKALSFVNKNFFEDSNGNRGAAPN-----VAIVMVDGWPTD 478

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD-------LLRKCTDSSGQFFAVN 371
                      +     R +G+ I+ V +  P E +         + K    +  ++++N
Sbjct: 479 --------KVEEASRLARESGINIFFVTIEGPDENEKQNVVEANFVDKAVCRTNGYYSIN 530

Query: 372 DSR--ELLESFDKITDKIQEQ 390
                 L +    +  +I + 
Sbjct: 531 VPSWFSLHKVVQPLVKRICDS 551


>gi|323138635|ref|ZP_08073702.1| hypothetical protein Met49242DRAFT_3090 [Methylocystis sp. ATCC
           49242]
 gi|322396123|gb|EFX98657.1| hypothetical protein Met49242DRAFT_3090 [Methylocystis sp. ATCC
           49242]
          Length = 547

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/413 (11%), Positives = 119/413 (28%), Gaps = 66/413 (15%)

Query: 46  SDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA 105
           S  +  D  +K     +     +     + + ++     +   + +          +  A
Sbjct: 137 SMNSSSDGQSKISILKSAANSFVDTMFSKSNNVK--FSVVPFSSGVAAVDPSEPSSRNAA 194

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
                       +   G   +     + R     +  + N A+      +      ++  
Sbjct: 195 WVDKNGANSQHWIAFGGKTAANAAGFTSRFDIFDKLKARNSALDWRGCFEPQVYPLNVND 254

Query: 166 QKHNDNNN-MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI 224
              N ++       +L P  P  S W  N   + Y      A         +  +     
Sbjct: 255 TTPNPSDAETLFVPFLAPDEPDNSGWGGNPYWNNYFGDNPSACSSSASGAWARLSRACKY 314

Query: 225 QKAIQEKKNL--SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMH 282
                   +   S   G+ ++       +   L+   ++V++++N+L     TN +    
Sbjct: 315 NATGSLGGSFGPSDFKGSSSFCPDPGTQRILQLTQKKSDVQNKINQLVANGATNLHEGFM 374

Query: 283 HAYRELYNEKE-SSHNTIGSTRLKKFVIFITDG---------------ENSGASAYQNTL 326
             +R L      S      + + +K ++F+TDG                ++      N  
Sbjct: 375 WGWRTLSPNAPFSGGRAYQAPKNRKIMVFMTDGFNSWNSRVNTATGSTYDTLGYYSYNGA 434

Query: 327 N----------------------------------------TLQICEYMRNAGMKIYSVA 346
                                                    T Q C   + AG++++++ 
Sbjct: 435 ENERFPDGSQGNGVNYRSLLAAAANNSSSYQTISRAMQDELTRQACTNAKTAGIEVFTIG 494

Query: 347 VSA-----PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            S        +G  L+++C  +   +F   D+ +L  +F +I   + +  + +
Sbjct: 495 FSVSGDPIDAQGLALMKECATNEDHYFKAEDASQLNAAFSQIGIGLGKLRLSL 547



 Score = 63.8 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 53/205 (25%), Gaps = 28/205 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  + +    L +    D       R  +Q A D+AVL+  + +    T      +    
Sbjct: 2   IFGLSLMPVMLMLGATADYTRFTTTRAALQQAADSAVLTVASKMTESTTNAQAKDQAQVV 61

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                                     +     +T    +  +    + A+  I    + +
Sbjct: 62  LNA---------------------QPRMTTAIVTGATVSEDKRTVCATAKVTIQNSFMQM 100

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH----NDNNNMTS 176
             L  + LT        +   +       I +VLD S SM      +       +   + 
Sbjct: 101 AQL--ATLTPTVKSCANLAGGADPGTTYEIALVLDNSGSMNSSSDGQSKISILKSAANSF 158

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAP 201
              +         +S     S  A 
Sbjct: 159 VDTMFS-KSNNVKFSVVPFSSGVAA 182


>gi|229587743|ref|YP_002869862.1| hypothetical protein PFLU0165 [Pseudomonas fluorescens SBW25]
 gi|229359609|emb|CAY46451.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 551

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/401 (9%), Positives = 116/401 (28%), Gaps = 51/401 (12%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIR-----NQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
              +++        +  +     +      ++Q+A     L     +     ++   +  
Sbjct: 25  GFAVTMVVALAGCGLSSSP-ELAKPAEPVAELQTASPQGAL--VKRMAMPAPMRMQESAA 81

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
               +  ++Q   +L                    + +   +      +    Y      
Sbjct: 82  MDYRSEPREQY-ANLPDN-------------PVHRVAETPVSTFSVDVD-TGSYANVRRF 126

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           L    L P     L           +     S   V     +       +        S+
Sbjct: 127 LNQGSLPPEGAVRLEEMVNYFPYHYALPTDGSPFGVTTEVAATPWNPRTQLLRIGIKASD 186

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
           + +    P    +  + + S       P      ++  +   LV+ +++          R
Sbjct: 187 RPVAELAPANLVFLVDVSGSMDRREGLP------LVKSTLKLLVDQLREQD--------R 232

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHN 297
           +  + Y              +  ++++ +++L    +T     +  AY+        +  
Sbjct: 233 VSLVVYAGESRVVLKPTSGRDKVKIRNAIDQLTAGGSTAGASGIELAYQMAREGFIDNGI 292

Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLL 357
                     ++  TDG+ +   +  ++L   Q+    R +G+ + ++        + L+
Sbjct: 293 NR--------ILLATDGDFNVGISDFDSL--KQMAVEQRKSGVSLTTLGFGVDNYNEHLM 342

Query: 358 RKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            +  D+  G +  +++   L E+   + D++      +A +
Sbjct: 343 EQLADAGDGNYAYIDN---LREAHKVLVDQLSSTLAVVARD 380


>gi|329888464|ref|ZP_08267062.1| hypothetical protein BDIM_03870 [Brevundimonas diminuta ATCC 11568]
 gi|328847020|gb|EGF96582.1| hypothetical protein BDIM_03870 [Brevundimonas diminuta ATCC 11568]
          Length = 650

 Score = 95.4 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/283 (14%), Positives = 83/283 (29%), Gaps = 43/283 (15%)

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
             V  VS S   L   +       +  K  +         +            A     +
Sbjct: 368 YRVASVSGSQVVLDTTRSLGLAGAS--KGGVTYSSGGKLMNGRDGSEWRVFPTADGYVNV 425

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                     V   +          V    ++ +      + + LS + + +KS++++++
Sbjct: 426 HASSTCVSERVGVERYTDARPSTAYVGRSYLSSSNSCPSAELSALSTSASSLKSKIDQMS 485

Query: 271 PYENTNTYPAMHHAYRELYN------EKESSHNTIGSTRLKKFVIFITDGENS------- 317
              +T     +  A+  L          E        +   K  I +TDGE +       
Sbjct: 486 AGGSTAGQIGIAWAWYALSPDFASLFSGEGQPGAYAPSDTLKVAILMTDGEFNTPFRDGV 545

Query: 318 ------------------GASAYQNTLNTLQICEYMRNAGMKIYSVAV---------SAP 350
                              +S       ++ +C+ M+  G+ +Y+V              
Sbjct: 546 IALDAGTGSGGLDSHIDLNSSNGDPFAQSVALCQAMQAKGVVVYTVGFDLGSATGREGVV 605

Query: 351 PEGQDLLRKCTDSSG-QFFAVNDSRELLESFDKITDKIQEQSV 392
               D++R+C  +    FF  +D  +L E+F  I   I    +
Sbjct: 606 DTALDVMRECATNEQTHFFQADDGTDLKEAFRAIGRDITRLRI 648



 Score = 36.8 bits (83), Expect = 5.6,   Method: Composition-based stats.
 Identities = 18/212 (8%), Positives = 47/212 (22%), Gaps = 18/212 (8%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ + V  +    AID+     ++           L       +    +   T     
Sbjct: 31  MFAMALPVLLMITLGAIDIHQASKVKA---------QLQDALDAAALAAARSTFTDDVNI 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + +    +K ++                    +T +           K          + 
Sbjct: 82  NKVGLAALKANMPSYFGEASGDTASFVLLNNRVTGEA------TVNVKVLVANVVLPPYG 135

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDV-SRSMEDLYLQKHNDNNNMTSNKY 179
           K L      +               +A+ I   +D  SR+       +            
Sbjct: 136 KLLDDFLPVSSRSEVLRASRNVEVAMALDITGSMDNCSRNCPPTSKLEDLQAAAKELVDI 195

Query: 180 LLPPPPKKSFWS--KNTTKSKYAPAPAPANRK 209
           ++       +         +      +  + +
Sbjct: 196 VVQDQQTPFYSKVALIPYAAGVNVGSSAISAR 227


>gi|145224243|ref|YP_001134921.1| hypothetical protein Mflv_3659 [Mycobacterium gilvum PYR-GCK]
 gi|189040172|sp|A4T9I4|Y3659_MYCGI RecName: Full=UPF0353 protein Mflv_3659
 gi|145216729|gb|ABP46133.1| von Willebrand factor, type A [Mycobacterium gilvum PYR-GCK]
          Length = 335

 Score = 95.4 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 79/222 (35%), Gaps = 26/222 (11%)

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            ++        S+   A   A  ++    E+A    + +   I         +G IAY  
Sbjct: 95  NRAVVMLVIDVSQSMRATDVAPNRLTAAQEAAKQFADQLTPGIN--------LGLIAYAG 146

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                     + N    K+ ++KL   + T T   +  A + +      +    G     
Sbjct: 147 TATVLVSP--TTNRESTKTAIDKLQLADRTATGEGIFTALQAIATV--GAVIGGGDEPPP 202

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PE 352
             V+ ++DG+ +  S   N           ++ G+ I +V+   P             P 
Sbjct: 203 ARVVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPISTVSFGTPYGYVEINEQRQPVPV 262

Query: 353 GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++L+K  D S G+ F  +   +L + F  + ++I  ++++
Sbjct: 263 DDEMLKKIADLSGGEAFTASSLEQLKQVFTNLQEQIGYETIK 304


>gi|90412167|ref|ZP_01220173.1| hypothetical protein P3TCK_27759 [Photobacterium profundum 3TCK]
 gi|90326891|gb|EAS43276.1| hypothetical protein P3TCK_27759 [Photobacterium profundum 3TCK]
          Length = 504

 Score = 95.4 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 56/477 (11%), Positives = 139/477 (29%), Gaps = 103/477 (21%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TA+ +   F  I +A++    +  +N++  A +AA L+   +   D+T ++         
Sbjct: 25  TALALIPLFGMIFWALEGTRYIQKKNRLADATEAATLAITTANQDDKTYEN--------- 75

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL---QYIAESKAQYEIPTENL 118
            +    I+ +++  + I     + ++      T D N      QY   +K  +     + 
Sbjct: 76  QLATGYIQAYIRNITSINNIKIERSEGIDNYPTPDGNEEREYFQYRVTAKTNHISWLSSD 135

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND-------- 170
            +    P+        +         +  I I  V D S SM+   ++   D        
Sbjct: 136 IIPSFAPTETVANRALAR-NYPIYLGDKDIDIVFVSDFSGSMKGNKIRALKDAIQAIANE 194

Query: 171 -----------NNNMTSNKYLLPPPPKKSF-------WSKNTTKSKYAPAPAPANRKI-- 210
                       N +    Y +    K+S               +    +          
Sbjct: 195 ILVPRDGEVEVTNRIAFVPYNMRVQEKRSNTRWCITQLDYRPNFNGGNYSSYEDIDWSTW 254

Query: 211 -----DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN------NL 259
                + + + +    +   K  ++ + +   +       G       P S         
Sbjct: 255 STWTRNQVRDCSNGYYSCTGKKRRDARTVYAILNASKSETGSGWYFPDPYSYINFPGSVA 314

Query: 260 NEVKSRLNKLN--------PYEN------------------------------TNTYPAM 281
               ++ N L                                           T+ Y  +
Sbjct: 315 KTFTAKANNLQFQSTNQKLYSGGMCSGNFWTIPLTSEKTALSPIQNNMSPDGGTSVYQGL 374

Query: 282 HHAYRELYNEKESSHNTIGSTRLK---KFVIFITDGENSGASAYQNTLNTLQICEYMR-- 336
               + L   + +S +T  S       K ++ ++DG+     +  N L    +C  ++  
Sbjct: 375 IRGAQILEQGRPTSPSTETSAAYNSRIKMILMLSDGQEMPYVSTFNQLVNQGLCNTIKAQ 434

Query: 337 ----NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
               +  + +  + +    +GQ   + C   +     + +  ++ +   +I + I++
Sbjct: 435 FNDSDQPLYMGVLGIEFDAQGQQGFKNCVGQNN----ITNVDDVDDLIKEILEMIKK 487


>gi|146307722|ref|YP_001188187.1| von Willebrand factor, type A [Pseudomonas mendocina ymp]
 gi|145575923|gb|ABP85455.1| von Willebrand factor, type A [Pseudomonas mendocina ymp]
          Length = 566

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/366 (10%), Positives = 109/366 (29%), Gaps = 32/366 (8%)

Query: 33  LDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQIN 92
            D  V +  A +   R            S++    +  +       RE   +        
Sbjct: 48  ADELVAAAPAELTRKRAAPLAGQLAPMPSSVADAALPGY---RDVPREQYQNYPDNPVFA 104

Query: 93  ITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM 152
           +++   +      +    Y      L    L P     L                 +   
Sbjct: 105 VSETPVSTFSIDVD-TGSYANVRRFLNGGQLPPKDAVRLEELVNYFPYAYPLPQGDAPFG 163

Query: 153 VLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
           V             +        S++ +   PP    +  + + S +     P      +
Sbjct: 164 VSTELAVTPWNPQTRLLRIAIKASDRSVEELPPANLVFLVDVSGSMHRREGLP------M 217

Query: 213 LIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
           +  +   LV+ ++           R+  + Y         +   ++  ++++ +++L   
Sbjct: 218 VQGTLKLLVDQLRPQD--------RVSLVTYAGATQVVLDSTPGSDKAKIRAAIDQLTAG 269

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
            +T     +  AY++                    ++  TDG+ +   +  ++L   Q+ 
Sbjct: 270 GSTAGESGIQLAYQQASKHLIEGGINR--------ILLATDGDFNVGISDFDSL--KQLA 319

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQS 391
              R  G+ + ++        + L+ +  D+  G +  +++   L E+   + D++    
Sbjct: 320 ADKRKTGVSLTTLGFGVDNYNERLMEQLADAGNGNYAYIDN---LREARKVLVDQLASTL 376

Query: 392 VRIAPN 397
             +A +
Sbjct: 377 ATVASD 382


>gi|145299821|ref|YP_001142662.1| flp pilus assembly protein FlpL [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866595|gb|ABD57363.1| FlpL [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852593|gb|ABO90914.1| putative flp pilus assembly protein FlpL [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 460

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 52/452 (11%), Positives = 116/452 (25%), Gaps = 67/452 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A++++         I+L      ++ + +A D AVL   A   +         + +   
Sbjct: 15  FALMLTGILALTGVVIELVRGYSGQSLLSAAAD-AVLYSAADSDTAAEDAVALVQANLAG 73

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNP------LQYIAESKAQYEIPT 115
               +     L Q              A ++++                + ++ + EI  
Sbjct: 74  R-PLQVGPPSLSQSEQGARVILQGHVPALMDLSVIGEGGDMPVAAAARASSARTRIEIAL 132

Query: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK-------- 167
                  +  + +  +    T   E        +   V+ +  +   + +          
Sbjct: 133 VLDVSNSMSGAPMKAIKQGLTEFGEVLFGRERRNQDRVVSIIPATGLVNIGDHPELFHPE 192

Query: 168 ---------------HNDNN---------NMTSNKYLLPPPPKKSFWSKNTTKS------ 197
                             N                 L          ++ T         
Sbjct: 193 SLAFPFGLQTLAHERGWSNLLTRDVPGRQRKAFCARLPEHVDGIDRLAELTPGWIRKLEQ 252

Query: 198 --------KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
                   +   +  P   K                   +  +N   ++G        V 
Sbjct: 253 APVGETQPRLHYSTKPPAIKQYEDGTPLRAFAPRENPLERYLENRRDKLGIFDDADCGVS 312

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT--------IGS 301
                LS    E +  L+ L    NTNT   +   +R L  + +              G 
Sbjct: 313 PIQAHLST-RAEYRQALDTLYAAFNTNTAEGVMWGWRLLSPQWQGRWGQGAAELPRPYGQ 371

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT 361
              +K ++  +DGE+ G  A       L +C  M+  G+++Y+VA          + +C 
Sbjct: 372 ADNRKIMVLFSDGEHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFEGDAR---FVAQCA 428

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 +       +     ++   I +  + 
Sbjct: 429 SDRSHAYKATS-GNIRTVLTRLASAINDVVLT 459


>gi|315444579|ref|YP_004077458.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
 gi|315262882|gb|ADT99623.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
          Length = 335

 Score = 95.0 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 79/222 (35%), Gaps = 26/222 (11%)

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            ++        S+   A   A  ++    E+A    + +   I         +G IAY  
Sbjct: 95  NRAVVMLVIDVSQSMRATDVAPNRLTAAQEAAKQFADQLTPGIN--------LGLIAYAG 146

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                     + N    K+ ++KL   + T T   +  A + +      +    G     
Sbjct: 147 TATVLVSP--TTNRESTKTAIDKLQLADRTATGEGIFTALQAIATV--GAVIGGGDEPPP 202

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PE 352
             V+ ++DG+ +  S   N           ++ G+ I +V+   P             P 
Sbjct: 203 ARVVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPISTVSFGTPYGYVEINEQRQPVPV 262

Query: 353 GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++L+K  D S G+ F  +   +L + F  + ++I  ++++
Sbjct: 263 DDEMLKKIADLSGGEAFTASSLEQLKQVFTNLQEQIGYETIK 304


>gi|330830423|ref|YP_004393375.1| FlpL [Aeromonas veronii B565]
 gi|328805559|gb|AEB50758.1| FlpL [Aeromonas veronii B565]
          Length = 460

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/452 (10%), Positives = 124/452 (27%), Gaps = 67/452 (14%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+++         AI+L      ++ + +A DA + S   S  + +  +          
Sbjct: 15  FALMLVGVLALTGVAIELVRGYNGQSLLSAAADAVIYSAADSDTALQDAQALMQANLSGR 74

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY-------IAESKAQYEIP 114
            +  +     L QG    +        A ++++                 + ++++ E+ 
Sbjct: 75  NL--QVATPRLSQGEQGAQVILQGKVPALMDLSAIDEGEEGMPIAAAARASSARSRIEVA 132

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK------- 167
                   +  + +  +        E        +   V+ +  +   + +         
Sbjct: 133 LVLDISDSMSGAPMKAIKQGLVEFGEVLFGRERRNQERVVSIIPATGLVNIGDHPELFHP 192

Query: 168 -------HNDNNN------------------MTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
                                                L          ++ T        
Sbjct: 193 ESIEIPFGLRTLAEERGWLNLLSREVPGRQRKAFCARLPEHVDGIDRVAEVTPGWIRKLE 252

Query: 203 PAP---------ANRK---IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI-GIVG 249
            AP          + K   I    +    L  + ++   ++   + R     ++      
Sbjct: 253 QAPRDELRPHLFYSTKPPPIARYGDGTPLLAFAPKENPLDRYLENRRDKLGIFDDPDCGV 312

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNT--------IGS 301
           +      +   + +  L+ L    NTNT   +   +R L  E +                
Sbjct: 313 SPIQAHLSTRADYRQALDTLYAAFNTNTAEGVMWGWRLLSPEWQGRWRQGAAALPRPYEL 372

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT 361
              +K ++  +DGE+   +A ++    L +C  M+  G++IY+VA          + +C 
Sbjct: 373 QDNRKIMVLFSDGEHMTEAALRDRKQLL-LCREMKRKGIQIYTVAF---EGDTRFVAQCA 428

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
                 F       +     ++   I +  + 
Sbjct: 429 SDRSLAFKAT-KSNIRTVLTRLASSINDVVLT 459


>gi|315498201|ref|YP_004087005.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416213|gb|ADU12854.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 570

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/305 (13%), Positives = 83/305 (27%), Gaps = 8/305 (2%)

Query: 95  KDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVL 154
              +     +  +    +                  +  R+      +      +     
Sbjct: 267 YTTSGGTYRVFVTSNYVQNNGYCWPNYYTYTYCGYTVVSRTDYYSTTTWTRTNNASNSTP 326

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
             S S        +   N   +              +     S             D   
Sbjct: 327 WPSASYYGTPSYSYAQYNGTITATPTSAGGYGSGSTTTIKDNSTITANSDLLGVGTDSWN 386

Query: 215 ESAGNLVNSIQKAIQEKK-NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
               +       + Q    + +  +   A            L+ ++  V++   KL P  
Sbjct: 387 GCVIDRKQPYDVSGQSPIASNTDTLYPAAKCATNNLLPVMGLTTDIAAVRAHAQKLTPAG 446

Query: 274 NTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGENSGASAYQN----TLNT 328
           NTN    +      L  E   ++          K++I ITDGEN+      +       T
Sbjct: 447 NTNITIGVQWGMELLSPELPFNTAKPYSDKTNYKYMIVITDGENTQNRWSTSASTINART 506

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           L  C+  ++ G+ +Y++ V        +L+ C      F+ V  S +L  +  K+   IQ
Sbjct: 507 LLACQAAKDLGITVYTIRVMEGNSD--MLKSCASRPEYFYDVTASSQLTSTLAKVFYSIQ 564

Query: 389 EQSVR 393
              + 
Sbjct: 565 STRLT 569


>gi|27366553|ref|NP_762080.1| protein TadG, associated with Flp pilus assembly [Vibrio vulnificus
           CMCP6]
 gi|27358119|gb|AAO07070.1| Protein TadG, associated with Flp pilus assembly [Vibrio vulnificus
           CMCP6]
          Length = 426

 Score = 94.6 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/435 (9%), Positives = 126/435 (28%), Gaps = 64/435 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +   ++ +  + + +++ +        ++  A + A L+          I  P    ++ 
Sbjct: 13  IFMGMLPILVIIMVFSMQMTQRHMAHAKITEAAEVASLAL---------IASPKEGDEKN 63

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +K +  ++              +    +    ++  L    +     +   ++   
Sbjct: 64  QEYAQKIVDHYIPDNKGEVVARVFHRRCEYKDGCVQRSGELAPFTDFVVSAKTKHDSWIS 123

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                  LT           R      + I  ++D+S SM + +        ++ ++   
Sbjct: 124 YNDGEMGLTKDFEVMGTSTSRKFLPQPLDIYFIIDMSGSMVNPWGGSGKTKYDVVADTIN 183

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                 + F +   ++         A +++     +     +S +       N+      
Sbjct: 184 RIVDDLREFKTDRKSRVAVIGFHHTAVKQVGRQRTAFDY--SSYRTPSATVNNMFTAPKI 241

Query: 241 IAYNIGIV--GNQCTPLSNNLNEVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKES 294
            + N        +  PL+ + +   ++ N  N     Y  T ++  +  A +      + 
Sbjct: 242 HSRNDSSNIKTFEDIPLTEDYDAFLTKFNSSNYYASRYGLTESWQGIIGAAQMAEQATD- 300

Query: 295 SHNTIGSTRLKKFVIFITDGENSG---------------ASAYQNTLNTLQICEYMRNA- 338
                     ++  I ++DG +                  + Y N L    +CE ++   
Sbjct: 301 -------LNPEQVFILLSDGRDGDFVRYYLEGRQWREVRYNKYLNRLVKAGLCEKLKTRI 353

Query: 339 -------------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
                               + +  + V+   +  D +  C       +   +     + 
Sbjct: 354 SQKRNVFQSENPSDKASKTKVTMGVIGVNYVVDKSDGIGDC-FGHDNIYHAKEG---NDV 409

Query: 380 FDKITDKIQEQSVRI 394
           +  I + I E++ R+
Sbjct: 410 YKYILNLINEETGRL 424


>gi|317491692|ref|ZP_07950127.1| hypothetical protein HMPREF0864_00890 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920126|gb|EFV41450.1| hypothetical protein HMPREF0864_00890 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 416

 Score = 94.6 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/423 (12%), Positives = 126/423 (29%), Gaps = 65/423 (15%)

Query: 2   TAIIISVC----FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
            AI   +          + ++ +  +  R ++  A++ A L+  A    D          
Sbjct: 22  FAISFVMMSGFLLSMAAFGLEGSRYITERARLSDAMEQAALALTAEDNGDG--------A 73

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
            +  T+     + +++    + +          +      NN      E +   +   ++
Sbjct: 74  QRNYTLSSDYFRAYMRHDVDVFKPTVI------VKSGISPNNQNLSYVEYRVSGQTLQDS 127

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
            F     PS    + +   G   +   N  + +  V D S SM + +             
Sbjct: 128 WFSSTFFPSFDKQVVIGDNGAARKFRSN--MDVIFVTDFSGSMNEGFGGSTKLAELKRIV 185

Query: 178 --------------KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                         K    P         +      +  P P++       ++    ++ 
Sbjct: 186 LKLSDELFSYNIDNKVGFVPFGWGGKEGIDCDFPFVSHGPVPSDILAGGNYKALEKYIDI 245

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIV-----GNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
                     +      ++   G        +   PL+++L E+ +++N ++    T   
Sbjct: 246 SGSVAAIPNPVHDIQIPLSNVNGSTCLRNSHSWKVPLTSSLAEI-NQINGMSAEGGTLVS 304

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDG-ENSGASAYQNTLNTLQICEYMR- 336
             +      L +           T  +K ++ ++DG ++         L    +C+ +R 
Sbjct: 305 SGVLLGVPYLASG----------TASRKVMVIVSDGTDDPKNVMITPNLINAGMCDKIRQ 354

Query: 337 ----NAGM-KIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE-----SFDKITDK 386
               +  + KI  + ++  P      + C      F+      EL E      F+++   
Sbjct: 355 VLSTDESVGKISFIGIAYYPTVD--WKSCV-GDKNFYLPQTIDELEEDLRRAVFEEVGHN 411

Query: 387 IQE 389
           I +
Sbjct: 412 ILK 414


>gi|330502932|ref|YP_004379801.1| von Willebrand factor, type A [Pseudomonas mendocina NK-01]
 gi|328917218|gb|AEB58049.1| von Willebrand factor, type A [Pseudomonas mendocina NK-01]
          Length = 566

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/362 (10%), Positives = 100/362 (27%), Gaps = 32/362 (8%)

Query: 38  LSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK 97
           L+  A+                        I   L             A          +
Sbjct: 51  LAAPAAAEMHVEASQKRMA---PMAYAPAPIADILPPSYRDESREQYQAYADNPVFAVAE 107

Query: 98  NNPLQYIAES-KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDV 156
                +  +     Y      L    L P     L                     V   
Sbjct: 108 TPVSTFSIDVDTGSYANVRRFLNDGQLPPKDAVRLEELVNYFPYAYPLPQGDVPFGVSTE 167

Query: 157 SRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
                     +        S++ +   PP    +  + + S +     P      ++  +
Sbjct: 168 LAVTPWNPQTRLLRIAIKASDRSVEELPPANLVFLVDVSGSMHRREGLP------MVQGT 221

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
              LV+ ++           R+  + Y         +   ++  ++++ +++L    +T 
Sbjct: 222 LKLLVDQLRPQD--------RVSLVTYAGDSQVLLDSAPGSDKAKIRAAIDQLTAGGSTA 273

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
               +  AY++                    ++  TDG+ +   +  ++L   Q+    R
Sbjct: 274 GESGIQLAYQQASKHLIDGGINR--------ILLATDGDFNVGISDFDSL--KQLAADKR 323

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +G+ + ++        + L+ +  D+  G +  +++   L E+   + D++      +A
Sbjct: 324 KSGVSLTTLGFGVDNYNERLMEQLADAGNGNYAYIDN---LREARKVLVDQLSSTLATVA 380

Query: 396 PN 397
            +
Sbjct: 381 SD 382


>gi|225377140|ref|ZP_03754361.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
 gi|225211045|gb|EEG93399.1| hypothetical protein ROSEINA2194_02786 [Roseburia inulinivorans DSM
           16841]
          Length = 1406

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 55/315 (17%), Positives = 93/315 (29%), Gaps = 24/315 (7%)

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAI 148
            QI++        Q   E     +          +         L+  G   R    + I
Sbjct: 694 YQIDLDASSLATSQSTVEKIQTVDAMMVFDLSGSMNEIMSGQNQLKDIGEFSRVKNQMDI 753

Query: 149 SICMVLDVSRSMEDLYLQKHN-----DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAP 203
           +     +                         +     P       W K    S  + + 
Sbjct: 754 NKVYYWNKYEKSGWWPWTYDKSVGMGTAAVSGNVYAKYPVKYIDGQWKKYVDGSYQSISD 813

Query: 204 ----APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP--LSN 257
               A    KI  L ++A   V  I     +          I               LS 
Sbjct: 814 SDVMAVWTSKISALKDAASGFVTGISDTSPDSLVGIATFYGIGNGWNSSTEGKLNHGLSK 873

Query: 258 -NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            N NE+   +N L     T+    + HAY EL   ++ +         KK+VI  +DGE 
Sbjct: 874 VNKNEMLKSVNALFADGGTSPQKGLEHAYSELQKAEDGN---------KKYVILFSDGEP 924

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSREL 376
           S ++   + + T      ++ AG  + +V +    E    L +   S+G  F  + + EL
Sbjct: 925 SDSN---DKMETEASAVKLKEAGYTVITVGLGLNNETATWLGEKVASAGCAFTADTAEEL 981

Query: 377 LESFDKITDKIQEQS 391
            + F  I   I +  
Sbjct: 982 NKIFQNIQSTITQSR 996


>gi|227822378|ref|YP_002826350.1| hypothetical protein NGR_c18330 [Sinorhizobium fredii NGR234]
 gi|227341379|gb|ACP25597.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 602

 Score = 94.2 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/367 (9%), Positives = 95/367 (25%), Gaps = 28/367 (7%)

Query: 31  SALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQ 90
            ++D A  +          +      + +  TI        L   +  RE  G+      
Sbjct: 82  QSVDQAADAAAPMSTMGGAV--GLAARSRMETIPAPAPADMLPPPAENRERFGNADANPV 139

Query: 91  INITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISI 150
            ++  +  +      +  A Y     +L    +       +                 + 
Sbjct: 140 KSVAAEPVSTFSVDVD-TASYSFVRRSLMAGEMPNPDAVRVEEMVNYFPYDWPRPTTAAE 198

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
                V+ +           +  +   + +    P+ +                    K+
Sbjct: 199 PFKATVTVTPTPWNAGTRLMHVAIKGYEVVQKEAPRANLV-----FLIDVSGSMDEPDKL 253

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
            +L  +   LV+ ++            +  + Y              +  ++ S ++ L 
Sbjct: 254 PLLKNAFRLLVDRLRPDDT--------VSIVTYAGNAGTVLEPTAVKDKTKILSAIDTLQ 305

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
           P  +T     +  AY+                     ++  TDG+ +      +     +
Sbjct: 306 PGGSTAGAAGIDAAYQLAEKAFVRDGVNR--------ILLATDGDFNVG--PSSDEELKR 355

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + E  R +G+ +  +          L++    +            L E+   + ++    
Sbjct: 356 MVETKRRSGIFLSVLGFGRGNYNDALMQTIAQNGNGV--AAYIDTLAEAQKTLVEEAGSS 413

Query: 391 SVRIAPN 397
              IA +
Sbjct: 414 LFPIAKD 420


>gi|120403735|ref|YP_953564.1| hypothetical protein Mvan_2751 [Mycobacterium vanbaalenii PYR-1]
 gi|166988604|sp|A1T8Q8|Y2751_MYCVP RecName: Full=UPF0353 protein Mvan_2751
 gi|119956553|gb|ABM13558.1| von Willebrand factor, type A [Mycobacterium vanbaalenii PYR-1]
          Length = 335

 Score = 93.8 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 78/222 (35%), Gaps = 26/222 (11%)

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            ++        S+   A   A  ++    E+A    + +   I         +G IAY  
Sbjct: 95  NRAVVMLVIDVSQSMRATDVAPNRLVAAQEAAKQFADQLTPGIN--------LGLIAYAG 146

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                     + N    K+ ++KL   + T T   +  A + +      +    G     
Sbjct: 147 TATVLVSP--TTNREATKAAIDKLQLADRTATGEGIFTALQAVATV--GAVIGGGDEPPP 202

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PE 352
             ++ ++DG+ +  S   N           ++ G+ I +V+   P             P 
Sbjct: 203 ARIVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPISTVSFGTPYGYVEINDQRQPVPV 262

Query: 353 GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++L+K  D S G  F  +   +L + F  + ++I  ++++
Sbjct: 263 DDEMLKKIADLSGGDAFTASSLEQLKQVFTNLQEQIGYETIK 304


>gi|170751925|ref|YP_001758185.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658447|gb|ACB27502.1| hypothetical protein Mrad2831_5557 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 568

 Score = 93.8 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 58/421 (13%), Positives = 108/421 (25%), Gaps = 69/421 (16%)

Query: 38  LSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK 97
           ++                 K +           ++                    +  D 
Sbjct: 151 IALVLDNTGSMAASSGGQSKLRAVQTAATDFVNYVYTSPAFSSATKVAIVPFAAAVAVDP 210

Query: 98  NNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVS 157
           +        +    +    +     ++ S       R     +  + N        L+  
Sbjct: 211 SAYRY----ASWIDQNGLSSYHWTNIVQSNPAPFKNRFEVFAKLQAANRNWGWAGCLESL 266

Query: 158 RSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESA 217
               ++        ++          P   +    +             N  ID      
Sbjct: 267 PYPFNVQDGAPTTKDSFYVPLLAPDEPGDGTSGGASFPVGNQRSTAYSYNSYIDDETGPD 326

Query: 218 GNLVNSIQKA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
               N+   A          ++  + S        N G        L+NN N +K+ +N 
Sbjct: 327 CRNSNTYNTALGQACKYVNPKDPASGSPLGIPNGPNFGCTTQPLQRLTNNTNALKTLINN 386

Query: 269 LNPYENTNTYPAMHHAYRELYNEK--------ESSHNTIGSTRLKKFVIFITDG------ 314
           + P  +TN +      +R L             SS N+  +T + K +I +TDG      
Sbjct: 387 MAPSGSTNIHEGFMWGWRTLSPNSVFADGQPYASSANSSNATNINKIIILMTDGTNSWGT 446

Query: 315 -------------------------------ENSGASAYQNTLN------TLQICEYMRN 337
                                            +   A  NT        T + C   + 
Sbjct: 447 NSSAPTGSLYFAAGYFRNANGTTPNPRLTTAYQNTNIADGNTARKALDALTAEACANTKA 506

Query: 338 AGMKIYSVAVSA-----PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             + IY++  S         GQ LLR C  S  QF+  N S +L+++F  I   I    +
Sbjct: 507 VNISIYTIGFSVPTDPIDSAGQTLLRNCASSPDQFYLANSSDDLIKAFKSIQASIGALRL 566

Query: 393 R 393
            
Sbjct: 567 T 567



 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/217 (11%), Positives = 61/217 (28%), Gaps = 5/217 (2%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDA-AVLSGCASIVSDRTIKDPTTKKDQ 59
           + A +     +    AID      +  ++Q+A DA A+L     + +     +   +   
Sbjct: 30  LFAFLSVPMVMIGGAAIDYGFATRLETKLQTATDATALLLCQTPLTTSEAELNTLAQTTM 89

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLF 119
           T  +    +       +         A K             +    + +Q   P    F
Sbjct: 90  TGAMGAANLVVDRLAITSSPRKITLTAHKQSTTFFGGLTGTQRINPGAVSQCATPLPKTF 149

Query: 120 LKGLI----PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMT 175
              L+     S   +   +S     +++    ++         S   + +        + 
Sbjct: 150 EIALVLDNTGSMAASSGGQSKLRAVQTAATDFVNYVYTSPAFSSATKVAIVPFAAAVAVD 209

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDV 212
            + Y       ++  S     +     PAP   + +V
Sbjct: 210 PSAYRYASWIDQNGLSSYHWTNIVQSNPAPFKNRFEV 246


>gi|260856317|ref|YP_003230208.1| hypothetical protein ECO26_3261 [Escherichia coli O26:H11 str.
           11368]
 gi|260868996|ref|YP_003235398.1| hypothetical protein ECO111_3021 [Escherichia coli O111:H- str.
           11128]
 gi|300903656|ref|ZP_07121573.1| von Willebrand factor type A domain protein [Escherichia coli MS
           84-1]
 gi|301303269|ref|ZP_07209394.1| von Willebrand factor type A domain protein [Escherichia coli MS
           124-1]
 gi|257754966|dbj|BAI26468.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257765352|dbj|BAI36847.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|300404332|gb|EFJ87870.1| von Willebrand factor type A domain protein [Escherichia coli MS
           84-1]
 gi|300841443|gb|EFK69203.1| von Willebrand factor type A domain protein [Escherichia coli MS
           124-1]
 gi|315255206|gb|EFU35174.1| von Willebrand factor type A domain protein [Escherichia coli MS
           85-1]
 gi|323156423|gb|EFZ42578.1| von Willebrand factor type A domain protein [Escherichia coli
           EPECa14]
 gi|323176802|gb|EFZ62392.1| von Willebrand factor type A domain protein [Escherichia coli 1180]
          Length = 584

 Score = 93.8 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 38/381 (9%), Positives = 111/381 (29%), Gaps = 49/381 (12%)

Query: 20  AHIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
           A     +  +Q  L AA           + +     T +  Q      KQ+ ++      
Sbjct: 75  AQQYSDKQALQGRLQAAPKYQHAAREKAASQIANPGTARYKQFDDNPVKQVAQNPLATFS 134

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
           +  + G  A   +         P     E    Y       +   +        +     
Sbjct: 135 LDVDTGSYANVRRFLNHGLLPPPDAVRVEEIVNY-----FPYDWDIKDKQSIPATKPIPF 189

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
            +         +  + L     +   +  +    +N+                       
Sbjct: 190 AMRYELAPAPWNEQLTLLKIDILAKDHKSEELPASNLVFLI------------------- 230

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                   ++ ++ ++  S   LV  +++           I  + Y         +   +
Sbjct: 231 -DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGS 281

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           +  E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +
Sbjct: 282 HKAEINAAIDSLDAEGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFN 333

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSREL 376
                 +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L
Sbjct: 334 VG--IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---L 388

Query: 377 LESFDKITDKIQEQSVRIAPN 397
            E+   +  ++++  + +A +
Sbjct: 389 SEAQKVLNSEMRQTLITVAKD 409


>gi|187934443|ref|YP_001887479.1| von Willebrand factor type A domain protein [Clostridium botulinum
           B str. Eklund 17B]
 gi|187722596|gb|ACD23817.1| von Willebrand factor type A domain protein [Clostridium botulinum
           B str. Eklund 17B]
          Length = 1596

 Score = 93.4 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 71/232 (30%), Gaps = 37/232 (15%)

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRI---GTIAYNIGIV---- 248
                 A      KI  L ++A N ++S+     + +  +V+    G ++YN        
Sbjct: 181 YCNNHKAYESYTTKIHELKKAAKNFIDSLTSTKTDGQTPNVKNLKIGIVSYNNSGYINEG 240

Query: 249 ----GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK----------ES 294
                +     + N+NE+K  +  L     TNT   +  A   L  E           + 
Sbjct: 241 LVQVTDSDRKNNGNINELKDTIENLRADGGTNTGDGLRKAAYLLNEENEANKTVIFMGDG 300

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLN------TLQICEYMRNAGMKIYSVAVS 348
                 S R       + D          +  +         I E ++     ++SV   
Sbjct: 301 EPTYYSSDRWGNDYTNLDDTNQYVGGTGYSDADGKCLSYAKTIGEIIKGEQYNVFSVGYG 360

Query: 349 APPEG---QDLLRK-------CTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
              E     + +++        +      F  +D   + + F +I D I + 
Sbjct: 361 LGDENSASNNKMKQIHESMGGISSGENSTFFASDEGAIDKVFQQIADTIIKT 412


>gi|148976298|ref|ZP_01813022.1| hypothetical protein VSWAT3_18848 [Vibrionales bacterium SWAT-3]
 gi|145964392|gb|EDK29647.1| hypothetical protein VSWAT3_18848 [Vibrionales bacterium SWAT-3]
          Length = 401

 Score = 93.4 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 81/309 (26%), Gaps = 54/309 (17%)

Query: 92  NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
           N+T               + +                                     + 
Sbjct: 117 NVTATGGGFKGV-----VESKHSAIPT------------------------------ELV 141

Query: 152 MVLDVSRSMEDLYLQKH--NDNNNMTSNKYLLPPPPKKSFWSKNTTK-SKYAPAPAPANR 208
           +VLDVS SM            N   T            S         S  A    P   
Sbjct: 142 LVLDVSGSMSPNIQSLKSILSNALNTIQSQSNNANDLDSVSISIVPFDSGVATHRPPWLS 201

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI-----------AYNIGIVGNQCTPLSN 257
           +    I     L              ++                  +     +   PL+N
Sbjct: 202 EETAGIYCIDGLSYRNGDFSASLTVDNLATLHSERPVKFTPPSKWLSDCNQESPMLPLTN 261

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK--KFVIFITDGE 315
             + V++ +N L     T +Y  +    R+L    + +     S+  +  + ++  TDG 
Sbjct: 262 VFSRVQNSINSLTANGGTRSYQGLVWGVRQLIPSWQQAWGMKVSSVPETRRKLVLFTDGA 321

Query: 316 NSGASAYQNTLNTLQICEYM-RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
           + G +   N L     C    +  G+++  +     P        C  +  + F+  ++ 
Sbjct: 322 DEGDAF--NQLVNAGFCTTAIKQYGIEMNFIGYGVSPSRITQFENCAGNPLRVFSATNTT 379

Query: 375 ELLESFDKI 383
           +L E F  I
Sbjct: 380 QLNEYFSDI 388


>gi|304393172|ref|ZP_07375100.1| Flp pilus assembly protein TadG [Ahrensia sp. R2A130]
 gi|303294179|gb|EFL88551.1| Flp pilus assembly protein TadG [Ahrensia sp. R2A130]
          Length = 692

 Score = 93.4 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 44/309 (14%), Positives = 88/309 (28%), Gaps = 53/309 (17%)

Query: 135 STGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNT 194
           +        ++        L    + + ++      +     N YL            + 
Sbjct: 384 TNPSYRPHWDDRIEYNRGNLIRPTNTQQVWEDYQRIDEKDFQNNYLDDAHNFDDKNGADH 443

Query: 195 TKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTP 254
            KS+     A  N+      E                 N +        N        + 
Sbjct: 444 VKSEANTGYASGNQ--YKRQEWINKYFTDDGGNRPSVGNSNPLGMGAGPNSMCSSVSVSD 501

Query: 255 LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITD 313
           L++N N  +++L  +     TN    +   +R L   +  +      +   KK +I +TD
Sbjct: 502 LTDNKNTTQAKLTSMQASGATNVQMGVAWGWRTLSPGEPFTEGRPYDAEDNKKIMIIMTD 561

Query: 314 GENSGASAYQNTLNT--------------------------------------------L 329
           G N+                                                        
Sbjct: 562 GNNTYYPTNIYGNQYAQDNKSFYGGHGHSVKGRIFDGYDGEANPGHNSQTFTKAMDEHLT 621

Query: 330 QICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDS----SGQFFAVNDSRELLESFDKI 383
           + C   +NAG+ IYS+A   P     +  L  C  S       +F  N++  L+++F+KI
Sbjct: 622 ETCTNAKNAGITIYSIAFDVPNGSSVKATLEDCASSDVGGGKLYFDANNNAALIDTFEKI 681

Query: 384 TDKIQEQSV 392
            +++ +  +
Sbjct: 682 AERLADLRI 690



 Score = 45.3 bits (105), Expect = 0.018,   Method: Composition-based stats.
 Identities = 34/350 (9%), Positives = 88/350 (25%), Gaps = 24/350 (6%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TA+ + V  + I    D A +   R   QS           ++ +               
Sbjct: 38  TALSLPVMLMAIGAGADYAELYRARVNFQS-----------AVDAGAIAAAKNLAATGQV 86

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYE--IPTENLF 119
              K   ++  +              +   ++          I  +   ++       + 
Sbjct: 87  QTSKDIGEEVFRSNLSHLGEKAVREGQINFDMGDGDCAVQGVITTATLPHDRFFSLSFVD 146

Query: 120 LKGLIPSALTNL-----SLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
                      +         +        N  I I +VLD S SM            + 
Sbjct: 147 QSQQKGFGANKIVKGQEEFILSASSTVECGNDTIEIALVLDNSGSMRWNGKIGTLRQASN 206

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           +  + L       +   + +     A      N + +  +++ G      +         
Sbjct: 207 SLVETLHTTMGSANKAIQFSVVPFAATVNVGTNNRNEPWMDTQGRSSTHWEMIDPSTSTD 266

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNL--NEVKSRLNKLNPYENT-NTYPAMHHAYRELYNE 291
               G               L ++L     +  + +     +T +  P++ +    +   
Sbjct: 267 FSFSGGRYLQSNGQALSRFTLYDSLPNTSWQGCVEQRPHPYHTQDDTPSISNPDTLIVPS 326

Query: 292 K-ESSHNTIGSTRLKKF--VIFITDGENSGASAYQNTLNTLQICEYMRNA 338
               + +   +   K+   ++   D   +     +N   T++ C    + 
Sbjct: 327 FAPDTPDNWDNDYNKRLSNIVVGADPHCTRFQGSKNGRRTIRYCNRWSDN 376


>gi|301609920|ref|XP_002934508.1| PREDICTED: vitrin-like [Xenopus (Silurana) tropicalis]
          Length = 779

 Score = 93.4 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 53/384 (13%), Positives = 110/384 (28%), Gaps = 47/384 (12%)

Query: 27  NQMQSALD---AAVLSGCASIVSDRTIK-------DPTTKKDQTSTIFKKQIKKHLKQG- 75
           N+M  ALD   +  L G      D + +       +    K+    I +K    ++ +  
Sbjct: 418 NEMAEALDVGLSGPLMGVVQYGDDPSTEFGLGAHFNVGDLKNAIEKIPQKGGHSNVGKAL 477

Query: 76  -----SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                +Y  +++G+      + +      P   + E+         N+F   +  +    
Sbjct: 478 SYVNKNYFSDSSGNRGSAPNVAVVLVDGWPTDKVEEASRLARESGINIFFVTIEGADDNE 537

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
            S                +    ++V             +               K    
Sbjct: 538 RSSVVEPNF-VDKAVCRTNGHFSINVPSWFGLHK---VVNPLVNRMCDIDKLVCSKTCLN 593

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           + +        +         VL +   N+ N  + +  +      RIG + Y       
Sbjct: 594 AADIGFVIDGSSSVGTGNFRTVL-QFIANITNEFEISDTD-----TRIGAVQYTYEQRLE 647

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 +   +V + + ++      T+T  A+ +A  +L++              +K +I
Sbjct: 648 FGFDKYSTKQDVMNAIMRIGYWSGGTSTGAAITYASEQLFS--------KSKPNKRKILI 699

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG--QF 367
            ITDG +          +       +   G+  Y+V +      QD L            
Sbjct: 700 VITDGRSYD--------DVRAPAAAVHRNGVIAYAVGI--AWAAQDELESIATDPDKDHS 749

Query: 368 FAVNDSRELLESFDKITDKIQEQS 391
           F V D   L +   KI   I  + 
Sbjct: 750 FFVEDFDSLYKFVGKIFQNICTEY 773


>gi|260781661|ref|XP_002585922.1| hypothetical protein BRAFLDRAFT_90332 [Branchiostoma floridae]
 gi|229270990|gb|EEN41933.1| hypothetical protein BRAFLDRAFT_90332 [Branchiostoma floridae]
          Length = 4065

 Score = 93.4 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 43/404 (10%), Positives = 102/404 (25%), Gaps = 46/404 (11%)

Query: 13   ITYAIDLAHIMYIRNQMQSALDAA----VLSGCASIVSDRTIKDPTTKKDQTSTIF---- 64
               A+D      +   ++SA D      +L       S    + P        T+     
Sbjct: 1382 TGAALDFVRQTMM---VESAGDRTMSPNILVVATDGESSDDQRTPAEVLRNAGTLVYAVG 1438

Query: 65   --KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKG 122
                     L   +            A + +   +       A        P        
Sbjct: 1439 IGAGVSSTTLLDIAGYNSRVLQATDFASLEVIGRELQEFICNAAYCGDPGTPEFGSRSGD 1498

Query: 123  LIPSALTNLS---------LRSTGIIERSSENLAISICMVLD--VSRSMEDLYLQKHNDN 171
                ++               +T      + +  + IC+  D   +    +    +    
Sbjct: 1499 FFEGSVVTFQCDPTYTLLGSATTTCFGNGTWSDPVPICVSPDPCNNSPCLNGGTCQRVGL 1558

Query: 172  NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK---AI 228
                +             +    +                 +  +  +L+ +        
Sbjct: 1559 TTEFTCLCPEGYHGPICQFYAACSNRTLNLDVVFLLDGSGSVGSANFDLLKTFTTRIATN 1618

Query: 229  QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRE 287
             +      R+G + Y+            +   EV + +  ++     T+T  A+ +  + 
Sbjct: 1619 FDVSTNLTRVGVVQYSDQTNSEFVLNTFSTEAEVLAAIAAISYQNGGTSTGAALDYVRQN 1678

Query: 288  LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
            ++                  +I +TDG +S   ++             RNAG+ IYSV +
Sbjct: 1679 VFISASG-----DRPDAANILIVLTDGVSSDDVSFP--------AMAARNAGITIYSVGI 1725

Query: 348  SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                   + L++      +         L +    I  +++E  
Sbjct: 1726 G-DGVDYNTLQQIAGDPNKVLQATGFSSLDD----IGGQLEELV 1764



 Score = 81.9 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/338 (12%), Positives = 93/338 (27%), Gaps = 23/338 (6%)

Query: 54   TTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEI 113
                   S + +     +L   +   + +   A+      T           E       
Sbjct: 2274 EAIAQDQSRVLQANTFTNLSNTAQALQESLGDARYCGTPGTPQDGYTYGLFFEGSTVTYS 2333

Query: 114  PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
                  L G   +   N +  ++       +    + C   +    +             
Sbjct: 2334 CEVGFTLDGASSAQCINGTWDNSPPTCIPPDPCLANPCY--NGGTCVRTGLTTDFTCTCP 2391

Query: 174  MT-SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
               +          +              + +      +++ + A  LV++ + +  +  
Sbjct: 2392 SDYTGDTCQSYTACQGRSLDFDLALLLDGSGSVGADNFNLVKQFAKRLVDNFEISQTD-- 2449

Query: 233  NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYRELYNE 291
                ++G + Y+            +    V   +N +      TNT  A+ +  +E++  
Sbjct: 2450 ---TKVGVVQYSSSSNVEFYLNAFSTKQAVLDAINAVTYQQGGTNTGAAITYTMQEIFAS 2506

Query: 292  KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
               +            +I +TDGE+S   A              RNAG  IY+V V    
Sbjct: 2507 ANGARA-----NYPDVLIVVTDGESSDDVAVP--------ALSARNAGTLIYAVGVGNGV 2553

Query: 352  EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
                LL+    ++GQ     D   L      +   + +
Sbjct: 2554 NQATLLQ-IAGNAGQVLQAADFAGLTTVVQSLQQNLCD 2590



 Score = 75.7 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 43/383 (11%), Positives = 93/383 (24%), Gaps = 55/383 (14%)

Query: 32   ALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQI 91
            + +A VL+  A+I             D                 + I     D      +
Sbjct: 1647 STEAEVLAAIAAISYQNGGTSTGAALDYVRQNVFISASGDRPDAANILIVLTDGVSSDDV 1706

Query: 92   NITKDKNNPLQYI---------AESKAQYEIPTENLFLKGLIPSALT-----NLSLRSTG 137
            +                      +     +I  +   +      +        L      
Sbjct: 1707 SFPAMAARNAGITIYSVGIGDGVDYNTLQQIAGDPNKVLQATGFSSLDDIGGQLEELVCD 1766

Query: 138  IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
                      I+     +        +       N       L         WS+   + 
Sbjct: 1767 ATYCGDPGAPINGFRNGNFFEGGTVTWGCF----NGFNLVGALTAVCLGNGSWSEPVPEC 1822

Query: 198  KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS--------------------VR 237
                 P P     D L     +LV  +  +     N                       +
Sbjct: 1823 MAPTTPPP--PGCDELSFGGWDLVFLLDGSGSVGSNNFLNVKNFTKLITDLFPVGDNATK 1880

Query: 238  IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSH 296
            +G + ++  I         +   E+ S ++ ++     T T  A+ +  +  +N    + 
Sbjct: 1881 VGLVQFSDTIQKEFDLRDYDTKAEILSAIDNISYLGGGTYTGNAIDYVRQVSFNTINGNR 1940

Query: 297  NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
             +         +I +TDGE+     +          +  R+ G+ I+++ V         
Sbjct: 1941 GSHPD-----MLIVLTDGESFDPVTF--------ASQSARDQGITIFAIGVGTGV-DYAT 1986

Query: 357  LRKCTDSSGQFFAVNDSRELLES 379
            L +      +   V D  +L   
Sbjct: 1987 LEEIAGDPQKVQQVTDFADLTSV 2009



 Score = 73.4 bits (178), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/352 (10%), Positives = 92/352 (26%), Gaps = 29/352 (8%)

Query: 40   GCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
            G       +   +               + + L+Q        GD       N       
Sbjct: 2552 GVNQATLLQIAGNAGQVLQAADFAGLTTVVQSLQQNLCDAAYCGDPGAPVNGNRVGSYFV 2611

Query: 100  PLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS 159
                     A Y I               + +             +         + +  
Sbjct: 2612 GNTVTFSCSAGYIIQGSATATCQSSGQWTSAVPTCV--------ASDPCPANPCQNGATC 2663

Query: 160  MEDLYLQKHNDNNNMTSNKYLLPPPPKK-SFWSKNTTKSKYAPAPAPANRKIDVLIESAG 218
             +     ++        +                         + +  +   ++L     
Sbjct: 2664 TQVGSTTQYTCTCPQGYSGNNCEVFSACTDRALDVDLVVLLDGSGSVGSDNFNLLKAFTQ 2723

Query: 219  NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNT 277
            N+V +      +    + R+G + Y+                EV + +  ++     T T
Sbjct: 2724 NIVGNF-----DIAVNNTRVGVVQYSDFNNIEFNLNAYATEAEVLAAIGAISYQRGGTFT 2778

Query: 278  YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
              A+    ++++     +            ++ +TDGE+S + A           +   N
Sbjct: 2779 GAAIDFVRQDVFTTAGGNRADKPD-----ILLVLTDGESSDSVAGP--------AQNTLN 2825

Query: 338  AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            AG+ IY+V + +       L++     G+   V D + L    +++ + +  
Sbjct: 2826 AGITIYAVGIGSGVNADT-LQEIAGDPGRVLQVADFQGLAAITNQLQEALCS 2876



 Score = 67.6 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 35/360 (9%), Positives = 97/360 (26%), Gaps = 31/360 (8%)

Query: 35  AAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT 94
           AA   G          +   +  D    + +         G      A D  Q++  +  
Sbjct: 598 AATNVGAVQYSDTVRSEFFLSSFDTDFEVVRALDGISYLAGGTFTGFALDFVQQSAFSPV 657

Query: 95  KDKNNP---LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
               +    +  +       +              A+  + + S        +   I   
Sbjct: 658 AGARDGYPDILVVVTDGVSQDDVVAPAESARKEGIAVFAVGIGSAVDYATLLQIAGIDGR 717

Query: 152 MVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
           ++         +       + + T   Y+      +              + +  +   D
Sbjct: 718 IL--------QINNFVDLASASQTLPDYICNYASCQGRDVPLDIVFLLDGSGSVGSANFD 769

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
           ++ +    L  +      +      +IG + Y+  +         +N  +V + ++ ++ 
Sbjct: 770 LVKDFTRTLARNF-----DIAANMTQIGVVQYSDTVNREFGLGDFHNRQDVLNAISAVSY 824

Query: 272 Y-ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
               T T  A+    +  +   +          +   +I +TDG +  +           
Sbjct: 825 QQGGTLTGAAIDFVRQTSFTTGDG-----DRPDVPNMLIVVTDGVSGDSVQGP------- 872

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
             +  R  G+  + V +    +   LL      S +    +D   L     ++ + + + 
Sbjct: 873 -ADAARREGITTFGVGIGNGIDFGTLLE-IAGDSARVLQADDFGALATVAQRLQEVVCDL 930



 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 55/163 (33%), Gaps = 15/163 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYR 286
              +    + RIG   Y+            +  +EV + +N ++     T T  A+    +
Sbjct: 1332 NFDVSPNATRIGVAQYSDTNSLEFNLNRYSTKDEVLNAVNGISYQGGGTYTGAALDFVRQ 1391

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
             +  E          T     ++  TDGE        ++ +     E +RNAG  +Y+V 
Sbjct: 1392 TMMVESAG-----DRTMSPNILVVATDGE--------SSDDQRTPAEVLRNAGTLVYAVG 1438

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            + A      LL      + +     D   L     ++ + I  
Sbjct: 1439 IGAGVSSTTLL-DIAGYNSRVLQATDFASLEVIGRELQEFICN 1480



 Score = 61.5 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/267 (10%), Positives = 75/267 (28%), Gaps = 22/267 (8%)

Query: 131  LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                S            +  C+ +D       L   +        S +       + +  
Sbjct: 2057 AGSSSITCQPDGQWTDVVPTCLFIDNCDPNPCLNGAQCFQTA--DSYRCTCAEGYEGTNC 2114

Query: 191  SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ---KAIQEKKNLSVRIGTIAYNI-- 245
               T  +               +  S+ +L+ S         +    S R+G + Y+   
Sbjct: 2115 EIYTALNAQTFDLVFLLDGSGSVGASSFDLMKSFTNRITTNFDVSPTSTRVGVVQYSSQG 2174

Query: 246  GIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
             +         +N ++V + +N +     NT T  A+++  +  +              +
Sbjct: 2175 SVATEFRLDSYSNKDDVIAAVNGIVYQNGNTYTGEALNYVRQNSFAVANGGRA-----DV 2229

Query: 305  KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
               ++ ITDG++                + +   G+ +Y++ +         L       
Sbjct: 2230 ANILVVITDGQSVDDVTGP--------AQDLLREGVTVYALGIG-DGIQYSTLEAIAQDQ 2280

Query: 365  GQFFAVNDSRELLESFDKITDKIQEQS 391
             +    N    L  +   + + + +  
Sbjct: 2281 SRVLQANTFTNLSNTAQALQESLGDAR 2307



 Score = 59.2 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/196 (12%), Positives = 67/196 (34%), Gaps = 22/196 (11%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIG-------TIAYNIGIVGNQCTP 254
           + +  +   +++ + A  +      +     N+S R          + Y+  +       
Sbjct: 559 SASITSPNFELVKDFAERVARHFTISSSRNDNMSYRSFTAATNVGAVQYSDTVRSEFFLS 618

Query: 255 LSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
             +   EV   L+ ++     T T  A+    +  ++    +            ++ +TD
Sbjct: 619 SFDTDFEVVRALDGISYLAGGTFTGFALDFVQQSAFSPVAGAR-----DGYPDILVVVTD 673

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
           G +          + +   E  R  G+ +++V + +  +   LL+      G+   +N+ 
Sbjct: 674 GVSQD--------DVVAPAESARKEGIAVFAVGIGSAVDYATLLQ-IAGIDGRILQINNF 724

Query: 374 RELLESFDKITDKIQE 389
            +L  +   + D I  
Sbjct: 725 VDLASASQTLPDYICN 740



 Score = 59.2 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/191 (10%), Positives = 68/191 (35%), Gaps = 20/191 (10%)

Query: 202  APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
            + +      +++ +    +V +   +          +G + Y+  +         +    
Sbjct: 1029 SGSVGTTNFELVKDFTSEVVLNFNISADTTN-----VGVVQYSDTVRNEFFLSSYDTKLP 1083

Query: 262  VKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
            +   +N+++     T T  A+ +  +  ++    + NT         ++ +TDG++    
Sbjct: 1084 LIDAINQISYLTGGTLTGFAIDYVRQSSFSRPAGARNTFPD-----VLVVLTDGQSQDDV 1138

Query: 321  AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
                           R+ G+ I++V + +  +   LL+  +    +   + D   L+   
Sbjct: 1139 VSS--------AAAARSQGITIFAVGIGSEVDFTTLLQ-ISGYPSRILQIQDFATLVTEG 1189

Query: 381  DKITDKIQEQS 391
             ++ + I + +
Sbjct: 1190 RRLPEIICQST 1200



 Score = 57.2 bits (136), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 52/172 (30%), Gaps = 16/172 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHA 284
               +  +   RIG + Y+  +             EV   ++ +     +T     ++  
Sbjct: 381 TMKFDVSSDITRIGVVQYSTDVNTEFELKTYATEAEVIHAISNITRQRGSTFIGAGINFV 440

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
               +           +      ++ ITDG         +  +     +  R+ G+  YS
Sbjct: 441 RTNSFTVAAGDRPLAPN-----ILVTITDGI--------SADDVAGPAQAARDQGILTYS 487

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           + +    +   LL     +  + F V    EL      +T  + E  +   P
Sbjct: 488 IGIGEEIQWPTLL-SIAGARHRVFNVTSFSELPGIEASLTALLCE-VLPTTP 537



 Score = 54.5 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 51/166 (30%), Gaps = 15/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHA 284
            A  E  +   R+G + Y+ GI             EV + +  L+    +T T   +   
Sbjct: 163 TAGFEVSSSQTRVGVVQYSTGINTEFDLNSFATEAEVINAIRGLSHQRGSTFTGAGITFT 222

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
             E +                  +I ITDG ++ +             E  R   +  YS
Sbjct: 223 RLESFTGASG-----DRPDAPNVLIVITDGISADSVDAP--------AEAARADNITTYS 269

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + +        LL        +   V    +L +  + +   + E+
Sbjct: 270 IGIGDEINYLTLL-SIAGMRERVLNVTTFGDLNDLDEVLLQILCER 314


>gi|257062895|ref|YP_003142567.1| hypothetical protein Shel_01450 [Slackia heliotrinireducens DSM
           20476]
 gi|256790548|gb|ACV21218.1| uncharacterized protein [Slackia heliotrinireducens DSM 20476]
          Length = 744

 Score = 93.4 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 68/193 (35%), Gaps = 30/193 (15%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           ++    +     ++I K+  +          ++Y+           ++N   +K+ +  L
Sbjct: 397 LNETKTATREFASTIFKSDADV-------CLVSYDSSAR--NVIDSTDNEYALKAAVRDL 447

Query: 270 NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL 329
           +    TN   A+  +Y  L                K+ ++ ++DGE +      +    +
Sbjct: 448 SAGGGTNIEDALRVSYERLEGSGSD----------KRIIVLMSDGEANEGLVGDDL---I 494

Query: 330 QICEYMRNAGMKIYSVAVSAPPEGQDL----LRKCTDSSGQFFAVNDSRELLESFDKITD 385
                +++ G+ IY++        +      +       G  + V+D+ +L   F  I D
Sbjct: 495 AYANEIKDDGVTIYTLGFFQSVSDKAECQRVMEGIAS-PGCHYEVDDASQLRYFFGDIGD 553

Query: 386 KIQEQS---VRIA 395
            I       VRIA
Sbjct: 554 DINGTRFIYVRIA 566


>gi|152994336|ref|YP_001339171.1| hypothetical protein Mmwyl1_0295 [Marinomonas sp. MWYL1]
 gi|150835260|gb|ABR69236.1| conserved hypothetical protein [Marinomonas sp. MWYL1]
          Length = 528

 Score = 93.0 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 61/488 (12%), Positives = 131/488 (26%), Gaps = 106/488 (21%)

Query: 2   TAIIISVC-FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
            A++I V   + +++A+D   ++    Q++ A D A L+     +++    D        
Sbjct: 37  FAVLIIVGGVIAVSFAVDTTRMVNSSAQLKRATDVAALAIGNIQLTNGNDDDV-----DL 91

Query: 61  STIFKKQIKKHLK-QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA---------- 109
             I    +  +L      I +   +     +  +       +     +++          
Sbjct: 92  QKIASGYVLSNLGMDSGLINQIEAEQVTVTKGEVDGSPTYKVSVSLIAQSDLLKAGGQEQ 151

Query: 110 ----QYEIPTENLFLKGLIPSALTNLSLRSTGIIERSS--------------ENLAISIC 151
                 E+ +    +  ++P++ T        + + S                       
Sbjct: 152 VIFSTVEVVSRPTEVALILPNSGTEDRGELAALRKVSKEFARNLLGDESAGVSPTQKVWL 211

Query: 152 MVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP------PKKSFWSKNTTKSKYAPAPAP 205
            ++  S+S+        +  N   +   L PP         K+    +            
Sbjct: 212 SLVPFSQSVNVYDESDPDRINRWAAFGELNPPELRSLFRTGKARSLADPRFPDRKANLLC 271

Query: 206 ANRKIDVLIESAGNL------------------------VNSIQKAIQEKKNLSVRIGTI 241
            +R +        +                         ++ +          +     I
Sbjct: 272 VHRGLSAGQNFFWDQPPSGQFEIYYRHDLPENGSPGAPPISWVGPNPDFPDTQAEDTRWI 331

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
             + G       PL++NL E+ +RL+K++   N N   AM  A   L            +
Sbjct: 332 VADKGCPDAALLPLTDNLAEIDARLDKMSTRFNVNYAIAMSWAGAALSPNMRGGAGWGNN 391

Query: 302 TRL------------------------KKFVIFITDGENSGASAYQNTLNTLQICEYMRN 337
                                              DGE +  S          +C    +
Sbjct: 392 ELPLDFSLDGNNVKVIVMLVNTIGDWFDTDAYNFNDGETTNDSMAFARQRFSDLCRDFNS 451

Query: 338 AGMKIYSVAV---SAPPEGQDL--------LRKCTDSSGQFFAV------NDSRELLESF 380
             +K + + V        G+ L        LR+C    G F             ++  S 
Sbjct: 452 KNIKFFFIGVRPGDPEDWGRTLFADVAGPGLRECASGDGNFHFADASNFSEGQSQISSSL 511

Query: 381 DKITDKIQ 388
           +KI D I+
Sbjct: 512 EKIADDIR 519


>gi|319784437|ref|YP_004143913.1| hypothetical protein Mesci_4754 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170325|gb|ADV13863.1| hypothetical protein Mesci_4754 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 553

 Score = 93.0 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 61/534 (11%), Positives = 135/534 (25%), Gaps = 143/534 (26%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDP--------- 53
            + + V    + +A D++ +M  ++ +Q+ALD+A L+       D T  D          
Sbjct: 19  GLGLPVILTAVAFATDVSTLMRAKSNLQNALDSANLASSHLGDLDITRNDAFNRYFQANI 78

Query: 54  ---------------------TTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQIN 92
                                   K   S               +I  +A  +    Q+ 
Sbjct: 79  VGHGELDNAQATLTVDKGVNFVKTKAVASADVHLNFAFLFGDSKHIVVDASAVESNNQLE 138

Query: 93  ITKDKNNPLQYIAESKAQYEIPTENLFLKG-LIPSALTNLSLRSTGIIERSSENLAISIC 151
           +    +N               T++L        S    +       +   + N      
Sbjct: 139 VVLVLDNTGSMAGARMTALRTATKSLLDTLEAAKSPTRKIRASPVPFVTAVNVNGDGFDP 198

Query: 152 MVLDV------------------------------SRSMEDLYLQKHN------------ 169
             +D+                              +   +  +                 
Sbjct: 199 SWIDMDGKSSTNGVNFPVIDGKRPNHMALFKQLKKTGWADAGWNGTGWKGCVEARPGAYN 258

Query: 170 ------DNNN--MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                 D          Y  P  P+ +     +  +            +      A + +
Sbjct: 259 ISDTPPDPAKPDTLFVPYFAPDDPEDAQKPSGSYGNSDKYYNNSYLNDVSDKTRLAQSGI 318

Query: 222 NSIQKAIQE----------KKNLSVRIGTIAY------------------NIGIVGNQCT 253
           N +   +              +   R     Y                            
Sbjct: 319 NILGIDLSNLLGNLIELLSPDDRDAREKIAKYVAPAKELITEIGSPVTVGPNRACPTPVV 378

Query: 254 PLSNNLNEVKSRLNKLN--PYENTNTYPAMHHAYRELYNEKESSHNTI-GSTRLKKFVIF 310
           PL+++ ++++   +++       TN    +    R L      +      +  + K V+ 
Sbjct: 379 PLTDDFDKLRKAASQMTEWNGSGTNVSEGLSWGMRVLSPAAPYTDGAPWKTPGISKIVLL 438

Query: 311 ITDGEN---------------------SGASAYQNTLNTLQ---------ICEYMRNAGM 340
           +TDGEN                     +G     +   T           +C  ++N G+
Sbjct: 439 LTDGENVVYGASEQEPTKSDYTSYGYLAGGRFGSDNQTTAARNVDGWTKNVCTQLKNEGV 498

Query: 341 KIYSVAVSAP-PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +IY++ + +     + L   C      ++AVND  +L   F +I +   +  + 
Sbjct: 499 QIYTMVLQSDTAANRALYSACASDPSNYYAVNDPTKLPNVFLQIANNFTKLQLT 552


>gi|126303712|ref|XP_001380869.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 628

 Score = 93.0 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 47/386 (12%), Positives = 98/386 (25%), Gaps = 47/386 (12%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
                + +  D +    ++                   + R +K    K  Q   +    
Sbjct: 280 PLLGIVQFGDDPSMEFNLKTH----------------ANSRDLKAAIEKIPQKGGLSNVG 323

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
                   ++     G+      + I      P   + E+         N+F   +  + 
Sbjct: 324 RALSFVTKNFFSNANGNRGGAPNVAIVMVDGWPTDKVEEASRLARESGINIFFITIEGAV 383

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
                                +    L+V        +                    K 
Sbjct: 384 ENEKQNVIEPNF-VDKAVCRRNGFYSLNVLSWFSLHKI---VQPLVKRVCDTNRLACSKT 439

Query: 188 SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
              S +        +         +L +   NL    + +  +      RIG + Y    
Sbjct: 440 CLNSADIGFVIDGSSSVGTGNFRTLL-QFVANLSKEFEISDTD-----TRIGAVQYTYEQ 493

Query: 248 VGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
                    +   ++ + + ++N     T+T  A+++A   L+               +K
Sbjct: 494 RLEFGFDKYSTKQDILNAIKRVNYWSGGTSTGAAINYALEHLF--------KKSKPNKRK 545

Query: 307 FVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-- 364
            +I ITDG +                      G+  YS+ +      QD L         
Sbjct: 546 LMILITDGRSYDDVRIP--------AMAAHQNGVITYSIGI--AWAAQDELEVIATHPTK 595

Query: 365 GQFFAVNDSRELLESFDKITDKIQEQ 390
              F V++  +L +S  KI   I  +
Sbjct: 596 DHSFFVDEFDDLYKSVPKIIQNICTE 621


>gi|260426558|ref|ZP_05780537.1| thrombospondin type 3 repeat family protein [Citreicella sp. SE45]
 gi|260421050|gb|EEX14301.1| thrombospondin type 3 repeat family protein [Citreicella sp. SE45]
          Length = 1088

 Score = 93.0 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 43/402 (10%), Positives = 106/402 (26%), Gaps = 51/402 (12%)

Query: 10  FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCA-----------SIVSDRTIKDPTTKKD 58
                 ++          Q+ +A+D A + G                +D ++   +    
Sbjct: 277 LPAAVISLFGTRTDMAEWQITAAVDGAAIGGSQGVISVVESWTLQFNADGSLASVSEASP 336

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQ-----------YIAES 107
             +          L          G       + IT   +                    
Sbjct: 337 SMNVTGLTTGAGDLTVALDFGTIGGTDGLTTGVGITSVSDTHDGTSQCNAADCAQRWNAG 396

Query: 108 KAQYEIPTENLFLKGLIPSALT----NLSLRSTGIIERSSENLAISICMVLDVSRSMEDL 163
             ++E   + L   GL            +       E        ++  V DV  S + +
Sbjct: 397 TGRFETTQQTLVNGGLSGWDTLVRNYPFTTAPALPAEAPPATCFRAVSFVDDVVGSDQIM 456

Query: 164 YLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
            +   +     + +        +      +            A+ +I+ +  +    V+ 
Sbjct: 457 MIVDRS----GSMSWSSNSGQAEVCLNGLDDDNDGTVDEGDCADSRIEFVRAAGRAFVDL 512

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN-NLNEVKSRLNKLNPYENTNTYPAMH 282
                 +                 +      L+  N  + K  ++ L+P  +T    A  
Sbjct: 513 QTSQGIDLG------LLEFNEGNTLLRPIDTLNAGNAQDYKDAIDALSPGGDTAIGDAFD 566

Query: 283 HAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKI 342
            +  E     E            +    +TDG N+         + +   E + + G++I
Sbjct: 567 ASTGEFTRVAEVGRV--------RTAYLLTDGFNTAGG------DPVAAAERLDDIGVRI 612

Query: 343 YSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           +++      + ++L    + + GQ +   +   L   F ++ 
Sbjct: 613 HAIPAGNDVDREELTDIASGTGGQVYEARNVNALTGIFAELA 654


>gi|12850399|dbj|BAB28702.1| unnamed protein product [Mus musculus]
          Length = 650

 Score = 92.7 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 45/352 (12%), Positives = 99/352 (28%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 320 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPT 379

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E          N+F   +  +A  ++          S      +     +V   + 
Sbjct: 380 DKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFA-SKAVCRTNGFYSFNVQSWLS 438

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 439 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSMGTSNFRTVL-QFVANLS 494

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      R+G + Y             N+  ++ S + ++      T+T  A
Sbjct: 495 KEFEISDTD-----TRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAA 549

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +            +  C+     G+
Sbjct: 550 IQYALEQLF--------KKSKPNKRKVMIIITDGRSYDDVRIP----AMAACQ----KGV 593

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V+D   L +   +I   I  +
Sbjct: 594 ITYAIGI--AWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTE 643


>gi|197250621|ref|YP_002147271.1| von Willebrand factor type A domain-containing protein [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197214324|gb|ACH51721.1| von Willebrand factor type A domain protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 598

 Score = 92.7 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/369 (10%), Positives = 99/369 (26%), Gaps = 31/369 (8%)

Query: 35  AAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINIT 94
           AA L+            +    + +T  +  K                    +     ++
Sbjct: 79  AASLA--DPKAGSLATAEAPQHEMRTRAVASKAFAAQ-GGNVMGTARYEHYDENPIKQVS 135

Query: 95  KDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM-- 152
           +          +    Y      L    L P     +                       
Sbjct: 136 QAPLATFSLDVD-TGSYANVRRFLNQGQLPPPEAVRVEEMLNYFPAPQPVADKQDNTKPI 194

Query: 153 --VLDVSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRK 209
              + +  +++        +                 +     N               +
Sbjct: 195 AACIPMPFAVKYELAPSPWNAQRTLLKVDVQARDMQTRDLPPANLVFLIDTSGSMQPAER 254

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
           + ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ L
Sbjct: 255 LPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDNL 306

Query: 270 NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTL 329
           + Y +T     +  AY +                    ++  TDG+ +      +  +  
Sbjct: 307 DAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDIE 356

Query: 330 QICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQ 388
            + +  R  G+ + ++ V      + ++ +  D  +G +  ++    L E+   + D++ 
Sbjct: 357 ALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVLKDEMH 413

Query: 389 EQSVRIAPN 397
           +  V +A +
Sbjct: 414 QTLVTVAKD 422


>gi|126173282|ref|YP_001049431.1| von Willebrand factor type A [Shewanella baltica OS155]
 gi|125996487|gb|ABN60562.1| von Willebrand factor, type A [Shewanella baltica OS155]
          Length = 642

 Score = 92.3 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/377 (11%), Positives = 102/377 (27%), Gaps = 36/377 (9%)

Query: 22  IMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIREN 81
               + +M+   DAA +         +   +        + + +      L Q  + ++ 
Sbjct: 82  ASQRQAEMR---DAAKVEMARVAAPMQMSSNGAVMGMSIAPMPRDYAAIPLAQNKFEQQV 138

Query: 82  AGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIER 141
              I    +I ++           +    Y      L    L       +          
Sbjct: 139 QNGIMVAGEIPVS-----TFFIDVD-TGSYATLRRMLREGRLPEKGTVRVEEMLNYFAYD 192

Query: 142 SSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
                  +      V+  +             +    Y L   PK    + N        
Sbjct: 193 YPLPAKNAAPFS--VTTELAPSPYNDDMMLLRIGLKGYDL---PKSQLGASNLVFLLDVS 247

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
               +  K+ +L  +   L   +            ++  + Y             N+   
Sbjct: 248 GSMASADKLPLLQTALKLLTAQLSAQD--------KVSIVVYAGAAGVVLDGVSGNDTQT 299

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
           +   L +L+   + N    +  AY+        +            VI  TDG+ +    
Sbjct: 300 LTYALEQLSAGGSINGGQGITQAYQLAKKHFIPNGINR--------VILATDGDFNVGVT 351

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESF 380
             +  + + + E  ++ G+ + ++          L+ +  D   G +  ++    L E+ 
Sbjct: 352 DFD--DLIALIEKEKDHGIGLTTLGFGLGNYNDQLMEQLADKGNGNYAYIDT---LNEAR 406

Query: 381 DKITDKIQEQSVRIAPN 397
             + D++      IA +
Sbjct: 407 KVLVDELSSTLFTIAKD 423


>gi|18042139|gb|AAL57848.1|AF454755_1 vitrin [Mus musculus]
          Length = 650

 Score = 92.3 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/352 (12%), Positives = 95/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 320 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPT 379

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E          N+F   +  +A          +   S      +     +V   + 
Sbjct: 380 DKVEEVSRVARESGINVFFITVEGAAEREKQHVVEPVFA-SKAVCRTNGFYSFNVQSWLS 438

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 439 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVL-QFVANLS 494

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      R+G + Y             N+  ++ S + ++      T+T  A
Sbjct: 495 KEFEISDTD-----TRVGAVQYTYEQRLQFGFDKYNSKADILSAIRRVGYWSGGTSTGAA 549

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 550 IQYALEQLF--------KKSKPNKRKVMIIITDGRSYDDVRIP--------AMAAYQKGV 593

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V+D   L +   +I   I  +
Sbjct: 594 ITYAIGI--AWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTE 643


>gi|77456411|ref|YP_345916.1| von Willebrand factor, type A [Pseudomonas fluorescens Pf0-1]
 gi|77380414|gb|ABA71927.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 563

 Score = 92.3 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/402 (10%), Positives = 116/402 (28%), Gaps = 42/402 (10%)

Query: 4   IIISVCFLFITYAIDLAHIMY-----IRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD 58
           +  SV  +     +  +          + +++S++    +   +++     +  P     
Sbjct: 11  LAASVLLVVAGCGVSSSPETTVAPPPAQTELKSSVQPEAVMADSAMAKRSALTAPIAS-- 68

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQI--NITKDKNNPLQYIAESKAQYEIPTE 116
                      +   QG    +             ++T+   +      +    Y     
Sbjct: 69  ----FAPMPAGESYPQGYRDEQREQYAKLADNPIHSVTETPVSTFSADVD-TGAYANVRR 123

Query: 117 NLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTS 176
            L    L P     L           +     S   V     +       +        S
Sbjct: 124 LLNQGRLPPEGAVRLEEMVNYFPYDYALPSDGSPFGVTTELAASPWNPHTRLLRIGIKAS 183

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
           ++ +    P    +  + + S       P      ++  +   LV+ +++          
Sbjct: 184 DRAVAELAPANLVFLVDVSGSMDRREGLP------LVKSTLKLLVDQLREQD-------- 229

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
           R+  + Y                 ++++ + +L    +T     +  AY+          
Sbjct: 230 RVSLVVYAGESSVVLEPTSGREKAKIRTAIERLTAGGSTAGASGIELAYQMAQQAFIPKG 289

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                      ++  TDG+ +  ++  ++L   Q+    R  G+ + ++        + L
Sbjct: 290 INR--------ILLATDGDFNVGTSDFDSL--KQMAVDKRKTGISLTTLGFGVDNYNEHL 339

Query: 357 LRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           + +  D+  G +  +++   L E+   + D++      +A N
Sbjct: 340 MEQLADAGDGNYAYIDN---LREARKVLVDQLGSTLAVVAKN 378


>gi|194433366|ref|ZP_03065646.1| von Willebrand factor type A domain protein [Shigella dysenteriae
           1012]
 gi|194418460|gb|EDX34549.1| von Willebrand factor type A domain protein [Shigella dysenteriae
           1012]
 gi|320178755|gb|EFW53718.1| hypothetical protein SGB_04028 [Shigella boydii ATCC 9905]
 gi|332090753|gb|EGI95846.1| von Willebrand factor type A domain protein [Shigella dysenteriae
           155-74]
          Length = 575

 Score = 91.9 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMVKKQRESGVTLSTFGVGDDNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQTLITVAKD 400


>gi|148706512|gb|EDL38459.1| vitrin, isoform CRA_a [Mus musculus]
          Length = 650

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/352 (12%), Positives = 94/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 320 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPT 379

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E          N+F   +  +A              S      +     +V   + 
Sbjct: 380 DKVEEVSRVARESGINVFFITVEGAAEREKQHVVEPGFA-SKAVCRTNGFYSFNVQSWLS 438

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 439 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVL-QFVANLS 494

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      R+G + Y             N+  ++ S + ++      T+T  A
Sbjct: 495 KEFEISDTD-----TRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAA 549

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 550 IQYALEQLF--------KKSKPNKRKVMIIITDGRSYDDVRIP--------AMAAYQKGV 593

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V+D   L +   +I   I  +
Sbjct: 594 ITYAIGI--AWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTE 643


>gi|58037355|ref|NP_083089.1| vitrin isoform 1 precursor [Mus musculus]
 gi|114154829|sp|Q8VHI5|VITRN_MOUSE RecName: Full=Vitrin; Flags: Precursor
 gi|21707639|gb|AAH34120.1| Vitrin [Mus musculus]
          Length = 650

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/352 (12%), Positives = 96/352 (27%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 320 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPT 379

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E          N+F   +  +A  ++          S      +     +V   + 
Sbjct: 380 DKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFA-SKAVCRTNGFYSFNVQSWLS 438

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 439 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSMGTSNFRTVL-QFVANLS 494

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      R+G + Y             N+  ++ S + ++      T+T  A
Sbjct: 495 KEFEISDTD-----TRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAA 549

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 550 IQYALEQLF--------KKSKPNKRKVMIIITDGRSYDDVRIP--------AMAAYQKGV 593

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V+D   L +   +I   I  +
Sbjct: 594 ITYAIGI--AWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTE 643


>gi|74196449|dbj|BAE34363.1| unnamed protein product [Mus musculus]
          Length = 650

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 41/323 (12%), Positives = 85/323 (26%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+      + +      P   + E          N+F   +  +A   
Sbjct: 349 SFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFITVEGAAERE 408

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                      S      +     +V   +                         K    
Sbjct: 409 KQHVVEPGFA-SKAVCRTNGFYSFNVQSWLSLHKT---VQPLVKRVCDTDRLACSKTCLN 464

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +    +    VL +   NL    + +  +      R+G + Y       
Sbjct: 465 SADIGFVIDGSSSVGTSNFRTVL-QFVANLSKEFEISDTD-----TRVGAVQYTYEQRLE 518

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 N+  ++ S + ++      T+T  A+ +A  +L+               +K +I
Sbjct: 519 FGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLF--------KKSKPNKRKVMI 570

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG +                      G+  Y++ +      QD L            
Sbjct: 571 IITDGRSYDDVRIP--------AMAAYQKGVITYAIGI--AWAAQDELEVMATHPAKDHS 620

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V+D   L +   +I   I  +
Sbjct: 621 FFVDDFDNLYKIAPRIIQNICTE 643


>gi|126730251|ref|ZP_01746062.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
 gi|126708984|gb|EBA08039.1| hypothetical protein SSE37_10864 [Sagittula stellata E-37]
          Length = 614

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/346 (13%), Positives = 91/346 (26%), Gaps = 67/346 (19%)

Query: 7   SVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKK 66
            V  +F    ID+ H    R+Q+Q+ LD AVL+      +               T+ + 
Sbjct: 43  LVMMVFGGIGIDMMHAELKRSQVQNTLDRAVLAAANLSNT-----------RDPQTVVED 91

Query: 67  QIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPS 126
             +               +  +  +   +  ++       ++    I   N    GLI  
Sbjct: 92  YFRA--------------MKLEDTLGDVQTGDSLGAKRVRAEGNGSI---NSHFLGLIGV 134

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
              ++   +T           + I +VLDVS SM+   ++   +      +  L      
Sbjct: 135 DQLDVYGAATAENAT----APLEISLVLDVSGSMQGQKIRDLKEAAKAFVDAVLGEGGDN 190

Query: 187 KSFWSKNTTKSKYAPAPA-----PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                     +                +       A    +       +      ++   
Sbjct: 191 SRVTVSLIPYNATVNLGDDLSERFNLDRWQNYSSCAIFESSDYNSLSIDPNAGLEQLAHF 250

Query: 242 AYNIGIVGNQ--------------CTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
                   +                 P S++ + +   ++      NT     M      
Sbjct: 251 DPYDYSGNSPDLTAPWCAEGNNLAIVPHSSDADYLSDVIDSFEAQGNTAIDLGMKWGLAL 310

Query: 288 LYNEKES----------------SHNTIGSTRLKKFVIFITDGENS 317
           L                         +   T+  KFV+ +TDGEN+
Sbjct: 311 LDPAARPVIGDMQADGLVPSSARYRPSDYGTQTMKFVVVMTDGENT 356



 Score = 66.1 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 83/311 (26%), Gaps = 47/311 (15%)

Query: 105 AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY 164
             S A+Y            +       + +   +        A+S   V D     +   
Sbjct: 328 VPSSARYRPSDYGTQTMKFVVVMTDGENTQEYNLKPWMLNPNALSDVWVDDHGTPGKGDD 387

Query: 165 LQK-HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                  +N   SN     P   ++ +                     V   +A  +   
Sbjct: 388 RYSIRVKDNYGDSNDVFYWPHASRNNYRNGPYSW--------------VTRTAAQMVNGV 433

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
              A+ +  + + +    +Y                  +   +  ++          +  
Sbjct: 434 ---AVVDGDSETTKAKCSSYKGAGHNA-------GQETLIENVLGMDYGTLDLDGDGIAG 483

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFIT--------DGENSGASA-------------Y 322
           A  +  N               K   +          DG  S                  
Sbjct: 484 ANDDCSNYPPVRLTWQELFGNVKTTYYANAWYWQAYMDGRASYNDYYNAYYSWETTVDAS 543

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           Q   N   IC   +   + I+++ V AP  G + +R C  S+  ++ V+   +L+++F  
Sbjct: 544 QANTNLATICAKAKQQDVTIFTIGVEAPQAGLNAMRNCASSASHYYNVSS-NQLVDTFRS 602

Query: 383 ITDKIQEQSVR 393
           I+D + E  + 
Sbjct: 603 ISDVVVELRLT 613


>gi|167946540|ref|ZP_02533614.1| BatB protein, putative [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 345

 Score = 91.9 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 66/177 (37%), Gaps = 43/177 (24%)

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKESSHNTIGST 302
           G      +PL+ + N +   L+ + P      T     +    ++L    E S       
Sbjct: 148 GDTSYVLSPLTFDRNAIHQLLDGIVPTLAGGGTAIGDGIGLGIKKLRERPEGS------- 200

Query: 303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---------- 352
              + +I +TDG+N   +        L+  +  +  G++IY++ V +             
Sbjct: 201 ---RVLILVTDGKNETGTIP-----PLKAAQLAKQEGIRIYTIGVGSTKNRVRLLSPDLR 252

Query: 353 ----------GQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD----KIQEQSVRI 394
                      ++ L++    + G +F  ND+  L + + +I +    + + +++ I
Sbjct: 253 TYEIATGLAIDEETLQQIAETTGGAYFRANDTAGLEKVYQRIDELEKSEAESRTIFI 309


>gi|293415564|ref|ZP_06658207.1| yfbK protein [Escherichia coli B185]
 gi|291433212|gb|EFF06191.1| yfbK protein [Escherichia coli B185]
          Length = 575

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMIKKQRESGVTLSTFGVGDDNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQTLITVAKD 400


>gi|108799422|ref|YP_639619.1| hypothetical protein Mmcs_2455 [Mycobacterium sp. MCS]
 gi|119868535|ref|YP_938487.1| hypothetical protein Mkms_2500 [Mycobacterium sp. KMS]
 gi|126435076|ref|YP_001070767.1| hypothetical protein Mjls_2492 [Mycobacterium sp. JLS]
 gi|122976988|sp|Q1B971|Y2455_MYCSS RecName: Full=UPF0353 protein Mmcs_2455
 gi|166987492|sp|A3PZE9|Y2492_MYCSJ RecName: Full=UPF0353 protein Mjls_2492
 gi|166987495|sp|A1UFT9|Y2500_MYCSK RecName: Full=UPF0353 protein Mkms_2500
 gi|108769841|gb|ABG08563.1| von Willebrand factor, type A [Mycobacterium sp. MCS]
 gi|119694624|gb|ABL91697.1| von Willebrand factor, type A [Mycobacterium sp. KMS]
 gi|126234876|gb|ABN98276.1| von Willebrand factor, type A [Mycobacterium sp. JLS]
          Length = 335

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 57/152 (37%), Gaps = 16/152 (10%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + N    K+ ++KL   + T T   +  A + +      +    G       ++  +DG+
Sbjct: 155 TTNREATKTAIDKLQLADRTATGEGIFTALQAIATV--GAVIGGGDEPPPARIVLFSDGK 212

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PEGQDLLRKCTD 362
            +  S   N           ++ G+ I +++   P             P    +L+K  D
Sbjct: 213 ETVPSNPDNPKGAFTAARTAKDQGVPISTISFGTPYGYVEINEQRQPVPVDDQMLKKIAD 272

Query: 363 -SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            S G+ F  +   +L E +  +  +I  ++++
Sbjct: 273 LSEGEAFTASSLEQLREVYANLQQQIGYETIK 304


>gi|227820127|ref|YP_002824098.1| transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227339126|gb|ACP23345.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 451

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 58/443 (13%), Positives = 130/443 (29%), Gaps = 89/443 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            AI I    L +   +D      ++++MQS LDAA+++    I      +     KD   
Sbjct: 31  VAICIIPMILAVGAGLDYTRAYNVQSRMQSDLDAALVAAIKEIDEYDEDEIAEKIKDWFD 90

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
              +KQ   +                    ++T+   +   +   + A   +PT  + L 
Sbjct: 91  AQSEKQSATY--------------------DLTEITVDKSGHTITASASGTVPTTLMTLA 130

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                                     + + +V+D S SM      +        +N    
Sbjct: 131 ------DIKTVPVGVISAIEGPATSYLEVYIVIDKSPSMLLAATSEDQAMLRADANITCE 184

Query: 182 PPPPKK----SFWSKNTTKSKYAPA-PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                              + Y          + DV +++   +++ +  A ++      
Sbjct: 185 FACHDTKDPVKKNGTVIASTYYNYIKSLGVKLRTDVALDAVEEVLDMVDAADEDH----A 240

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN----TYPAMHHAYRELYNEK 292
           RI    Y++G   ++    + + +  + +L+  +    T+    +      A + L  + 
Sbjct: 241 RIKVGLYSLGETISEVLEPTYSTSTARKKLSD-DSSGLTSATSMSATYFQTALKALKKKV 299

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGA---------SAYQNTLNTLQICEYMRNAGMKIY 343
            ++ +   +    K V+ +TDG  S              + T      C+Y+++    + 
Sbjct: 300 GTAGDGTSAASPLKLVLLLTDGVQSNRDWVIKWSGKYWGRVTPLNPDWCDYLKDNDATMA 359

Query: 344 SV------------------------------------AVSAPPEGQDL----LRKCTDS 363
            +                                     VS+     D     L+ C  S
Sbjct: 360 VLYTEYLAIPADWGYNATLAKSMGNSDWTSTWGGTLHSGVSSSTTRHDYIPIALQDCASS 419

Query: 364 SGQFFAVNDSRELLESFDKITDK 386
           S  F +     E+      + ++
Sbjct: 420 SDLFISAASEDEITAGLSTLFNQ 442


>gi|328545070|ref|YP_004305179.1| von Willebrand factor type A [polymorphum gilvum SL003B-26A1]
 gi|326414812|gb|ADZ71875.1| von Willebrand factor type A [Polymorphum gilvum SL003B-26A1]
          Length = 552

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 48/417 (11%), Positives = 108/417 (25%), Gaps = 58/417 (13%)

Query: 19  LAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
            + +  ++   Q+A D   L      +++ + +D               I        ++
Sbjct: 149 GSRMTTLK---QAASD---LIRTLMSINEISTEDDRVMVGLVPFTAFVNIGADKATQPWM 202

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
                            D        + S      P+     + L  +            
Sbjct: 203 DREGRSPVHWTNFQTGSDGTPVPSLFSSSALVNGRPSRFSLYQQLGGTDWLGCVEARPMP 262

Query: 139 IERSS--ENLAISICMVLDVSRSMEDLYLQKHND----NNNMTSNKYLLPPPPKKSFWSK 192
            + +    +  +   + +      E      + D    +NN  ++         K     
Sbjct: 263 YDVTDDAADPDVPASLYVPAFAPDEPDSSPDNRDGYRYSNNWLADNAGACSLTAKQAAQV 322

Query: 193 NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQC 252
           N      +P       +      + G L     +      + S     +           
Sbjct: 323 NIYDQGDSPIHGSLATREV----AQGRLCKYRNQPKSYGTSSSQGPNFL-----CKTQPI 373

Query: 253 TPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE----SSHNTIGSTRLKKFV 308
           T L+N+   +   +  +     TN +  +   +R L  ++      S +       ++ +
Sbjct: 374 TDLTNDKQALLDAVAAMRADGYTNIHQGVVWGWRVLTPQEPFSRGRSPDQKREKDHRRIM 433

Query: 309 IFITDGENSGASAYQN-------------------------------TLNTLQICEYMRN 337
           I +TDG N+      +                                  T   C     
Sbjct: 434 IVMTDGANTYQDKSSSHNRTEYNAYGYGTEQRLGSGIDTAGEIAAKMDERTALACRNAAT 493

Query: 338 AGMK-IYSVAVSAPPEG-QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                +Y++A        + LLR C  S    F    + EL+ +F++I  +I    +
Sbjct: 494 YEATQVYTIAFQVGDYATRKLLRDCASSPEMAFDAGSNSELVTAFERIGKEISRLRL 550



 Score = 43.7 bits (101), Expect = 0.056,   Method: Composition-based stats.
 Identities = 33/354 (9%), Positives = 81/354 (22%), Gaps = 58/354 (16%)

Query: 3   AIIISVCFLFI--TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           A       L       ID++ ++  ++++QS           +       K  T   +Q 
Sbjct: 17  AFGSFAFLLTAGSGVGIDMSRVVTEKSRLQS--------AADATALAANYKSGTYTAEQI 68

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
               +               +         I++                     T   F 
Sbjct: 69  RQHAEAYFDGLYTAPERGSVSRNVTVGDGTISVEAG-----------------VTMPTFF 111

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+     + ++ +   +       +  + +VLD S SM    +       +      +
Sbjct: 112 APLLGVEEISFAVMAESKVGT----ASFDVVLVLDNSGSMAGSRMTTLKQAASDLIRTLM 167

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                             +         K                      +     +  
Sbjct: 168 SINEISTEDDRVMVGLVPFTAFVNIGADKA---------------TQPWMDREGRSPVHW 212

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMH---HAYRELYNEKE- 293
             +  G  G     L ++   V  R ++ + Y     T+    +      Y    +  + 
Sbjct: 213 TNFQTGSDGTPVPSLFSSSALVNGRPSRFSLYQQLGGTDWLGCVEARPMPYDVTDDAADP 272

Query: 294 --SSHNTIGSTRLKKFVIFIT--DGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
              +   + +    +        DG     +   +      +    + A + IY
Sbjct: 273 DVPASLYVPAFAPDEPDSSPDNRDGYRYSNNWLADNAGACSL-TAKQAAQVNIY 325


>gi|90420284|ref|ZP_01228192.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335618|gb|EAS49368.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 593

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 90/336 (26%), Gaps = 68/336 (20%)

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
              L   S       E SS+       +  +     E        ++           P 
Sbjct: 256 GVKLAERSPTGDYWQEISSKTPLTRFFVYENAHHKNELGPWLGCVESRPNGLAITDAEPN 315

Query: 185 PKK---SFWSKNTTKSKYAPAPAPANRKIDVLIE--SAGNLVNSIQKAIQEKKNLSVRIG 239
                  F                   + +      +   +    + A     +   R  
Sbjct: 316 YANPDTLFVPSFGPDEYDGSKGDNDYLEDEGRRSMPAETAMSVQAKVAKYFDGSDLQRGN 375

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
               N G +    TPL++N   + + +N ++    TN    +   +R L   +  +    
Sbjct: 376 HPGPNRGCLSTPVTPLTDNQATINAAINAMDADGETNIPEGIAWGWRLLSAREPFTQGRA 435

Query: 300 GS-TRLKKFVIFITDGENSGASAYQN---------------------------------- 324
                  K ++ +TDG+N+  S   +                                  
Sbjct: 436 NDAKDNLKVLVLMTDGDNNYGSDENDYNESGYGTFGYASTYDAYGNHSWGRIFDDTSTTS 495

Query: 325 ------------TLNTLQICEYMRN--------AGMKIYSVAVSAPPEG--QDLLRKCTD 362
                             IC+ +++         G+ I+++A         + L+ +C  
Sbjct: 496 KRANRSSFVSAMNEKVAAICQNIKDDGRKATGEDGIVIFTIAFDLNDGSSVKKLMEQCAS 555

Query: 363 ------SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                 +   ++    S +L+ +FD IT+++    +
Sbjct: 556 YGITDPTKKLYYDAKSSSDLMAAFDSITEQVSSLRI 591



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 51/161 (31%), Gaps = 17/161 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             + + +    +  A+D++ I   +  +Q ++D A L+      +++     +   +   
Sbjct: 27  FGLTLPILACCMGAAVDISGIYASKRNLQHSVDIAALAAGREYSNNQQDSHLSKVAE--- 83

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
                        G +      D       +     N     + +  A    PT    L 
Sbjct: 84  -------------GYFFENAGADARANTDFSYDGIFNEDGSTVLQVSAARRHPTIFGDLL 130

Query: 122 GLIPSALTNLSLRS-TGIIERSSENLAISICMVLDVSRSME 161
             + +   +          +   +N +I + MVLD S SM 
Sbjct: 131 SFVTAGELDWRAFPLAARSQIVVQNQSIELVMVLDNSGSMT 171


>gi|326335930|ref|ZP_08202107.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691894|gb|EGD33856.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 332

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 73/211 (34%), Gaps = 53/211 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +I+ L   A   +   +           RIG + Y+         P + + + V   L 
Sbjct: 111 NRIEALKRVASQFIEERKS---------DRIGIVVYSGESYTK--VPATTDKSIVLQSLK 159

Query: 268 KLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
            +      + T     +  A   L            S    K +I +TDG N+       
Sbjct: 160 DIKQGEIEDGTAIGMGLGTAINRL----------KDSKTKSKVIILMTDGVNNTGV---- 205

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAPPE----------------------GQDLLRKCT- 361
            ++ L   E  +  G+++Y++ +    +                       + LL +   
Sbjct: 206 -IDPLSAAELAKEYGIRVYTIGIGTNGKALSPVAYNPDGSLQYDMVPVEIDEKLLGEIAQ 264

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + G++F   D+++L + + +I DK+++  +
Sbjct: 265 STGGKYFRATDNKKLAQIYTEI-DKLEKSKI 294


>gi|308081588|ref|NP_001183957.1| vitrin isoform 2 [Mus musculus]
 gi|26342052|dbj|BAC34688.1| unnamed protein product [Mus musculus]
          Length = 628

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/352 (12%), Positives = 96/352 (27%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 298 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPT 357

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E          N+F   +  +A  ++          S      +     +V   + 
Sbjct: 358 DKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFA-SKAVCRTNGFYSFNVQSWLS 416

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 417 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSMGTSNFRTVL-QFVANLS 472

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      R+G + Y             N+  ++ S + ++      T+T  A
Sbjct: 473 KEFEISDTD-----TRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAA 527

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 528 IQYALEQLF--------KKSKPNKRKVMIIITDGRSYDDVRIP--------AMAAYQKGV 571

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V+D   L +   +I   I  +
Sbjct: 572 ITYAIGI--AWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTE 621


>gi|323135950|ref|ZP_08071033.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
 gi|322399041|gb|EFY01560.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
          Length = 432

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 54/442 (12%), Positives = 117/442 (26%), Gaps = 77/442 (17%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             + +    L    A+D + I   ++ +  A DA VL+           +     K    
Sbjct: 17  FGLALMPLALMAGGAVDFSQISRQKSALNQAADAGVLTALKEA-----REQLKQGKPDWQ 71

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
           +I +KQ  K     +              ++++         +      Y          
Sbjct: 72  SIAEKQGGKAFTNNASKIGGVSGTGATINLSLS-------GGVLSGSLNYAANA-PTHFL 123

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            +      NL   ++      S      I  V+DVS SM     +        +    + 
Sbjct: 124 RIAGLNTINLKGSASA---TMSAAQYRDIHFVIDVSASMGIGATKADQQAMQNSVGCAVA 180

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
               + +      T +  A     A  +IDV+ ++  + +  I        + S R+   
Sbjct: 181 CHHAEAA---DPATDNLAAVRAIGATLRIDVVRKAVMDALAKI------PNDGSTRVAIH 231

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-----ENTNTYPAMHHAYRELYNEKESSH 296
           +++         PLS N+    S    ++         TN + +++     L +      
Sbjct: 232 SFSNS--LKTVFPLSTNIAGAISATQSIDLTNENGQGGTNFHYSLNQLNNLLASAGNGLT 289

Query: 297 NTIGSTRL--------KKFVIFITDGENS-------------------GASAYQNTLNTL 329
            +     +           + F  DG                          +       
Sbjct: 290 ASQPRGFVLLATDAVEDSSLFFYADGVAPPFARQWVEPNFVVGNPSYFAWGLHYVQAPDA 349

Query: 330 QICEYMRNAGMKIYSV--------AVSAPPEGQ----------DLLRKCTDSSGQFFAVN 371
             C  ++  G  + ++         V  P                +  C  +   +F   
Sbjct: 350 ANCSAIKAKGYTMMTLETEYLIPDGVYNPTFDAVRGDMGPAMTKSMTDCASAPDYYFHAE 409

Query: 372 DSRELLESFDKITDKIQEQSVR 393
             +E+  +   +  K    S+ 
Sbjct: 410 SPQEIDRAVQTMVSKTVNLSLT 431


>gi|149050644|gb|EDM02817.1| similar to vitrin (predicted) [Rattus norvegicus]
          Length = 427

 Score = 91.5 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/352 (13%), Positives = 94/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 97  KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRGGAPNVAVVLVDGWPT 156

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             I E          N+F   +  +A              S      +     +V   + 
Sbjct: 157 DKIEEVSRVARESGINVFFVTVEGAAEREKQHVVEPNFA-SKAVCRTNGFYSFNVQSWLS 215

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 216 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVL-QFVANLS 271

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      RIG + Y             N+  +V S + ++      T+T  A
Sbjct: 272 KEFEISDTD-----TRIGAVQYTYEQRLEFGFDKYNSKADVLSAIRRVGYWSGGTSTGAA 326

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 327 IQYALEQLF--------KKSKPNKRKVMILITDGRSYDDVRIP--------AMAAYQKGV 370

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V++   L +   +I   I  +
Sbjct: 371 ITYAIGI--AWAAQDELEVIATHPARDHSFFVDEFDNLYKFVPRIIRNICTE 420


>gi|332291974|ref|YP_004430583.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170060|gb|AEE19315.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
          Length = 334

 Score = 91.1 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 64/194 (32%), Gaps = 42/194 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----EN 274
           N + +++K      N                   TP++++ + V S L  +         
Sbjct: 112 NRLEALKKVAASFINGRPNDRIGLIEYAGESFTKTPITSDKSIVLSALKSIQYNNIIEGG 171

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T     +      L            S  L K +I +TDGEN+        ++     E 
Sbjct: 172 TAIGMGLATGVNRL----------KDSKALSKVIILMTDGENNAGQ-----IDPRIAAEL 216

Query: 335 MRNAGMKIYSVAVSAPP----------------------EGQDLLRKCT-DSSGQFFAVN 371
            +  G+K+Y++ +                            ++LL +    + GQ+F   
Sbjct: 217 AQEFGIKVYTIGMGTNGMALSPYARNANGTFVYENIQVTIDEELLEEIAATTGGQYFRAT 276

Query: 372 DSRELLESFDKITD 385
           ++ +L E +D+I  
Sbjct: 277 NNEKLQEIYDEIDK 290


>gi|149412375|ref|XP_001507696.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 691

 Score = 91.1 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/352 (13%), Positives = 90/352 (25%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            +  + R +K    K  Q   +            ++  +  G+    A + +      P 
Sbjct: 361 KTHTNSRDLKAAIEKITQKGGLSNVGRALSFVNKNFFSDANGNRGGAANVAVVMVDGWPT 420

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + ES         N+F   +  +A +                   +    L+V     
Sbjct: 421 DRVEESSRLARESGINIFFITIEGAAESEKQNVVEPNF-VDKAVCRRNGFYSLNVPSWFG 479

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
              +                    K    S +        +         VL   A    
Sbjct: 480 LQKVA---RPLAKRVCDTHRLACSKTCLNSADVGFVIDGSSSVGTGNFRTVLQFVAN--- 533

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
                   E  +   R+G + Y                +++ S + ++N     T+T  A
Sbjct: 534 ---ISKEFEVSDTDTRVGAVQYTYEQRLEFGFDQHRTKSDLLSAIKRVNYWSGGTSTGAA 590

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A   L+               +K +I ITDG +                      G+
Sbjct: 591 IRYALERLFE--------KSKPNKRKLMIVITDGRSYDDVRIP--------ALAAHRKGV 634

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V++   L     +I   I  +
Sbjct: 635 ITYAIGI--TWAAQDELEVMASDPDKDHAFFVDEFDNLYTFVPQIIQNICTE 684



 Score = 43.4 bits (100), Expect = 0.060,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 37/118 (31%), Gaps = 14/118 (11%)

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSHNT 298
            + Y              N  ++K+ + K+      +N   A+    +  +++   +   
Sbjct: 347 IVQYGDDPTTEFNLKTHTNSRDLKAAIEKITQKGGLSNVGRALSFVNKNFFSDANGNRGG 406

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
             +       + + DG  +      + L         R +G+ I+ + +    E +  
Sbjct: 407 AAN-----VAVVMVDGWPTDRVEESSRL--------ARESGINIFFITIEGAAESEKQ 451


>gi|327400025|ref|YP_004340864.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
 gi|327315533|gb|AEA46149.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
          Length = 790

 Score = 91.1 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/327 (11%), Positives = 95/327 (29%), Gaps = 5/327 (1%)

Query: 69  KKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSAL 128
            ++      +      +     I +  D       +     +    T  L          
Sbjct: 361 AQYAIPNGEMYYVTNPVEGNWSIAVVADYPTGYDTVHVDIYKKSGGTWYLVDSHNFTLYA 420

Query: 129 TNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKS 188
              +         + +  A  +    ++   +ED  L     ++N  + +         +
Sbjct: 421 APQTFTINVPSVENLKIEATPVNGTKELHLWVEDGGLYGPYSSSNGEAYETTNAGGTYTA 480

Query: 189 FWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV 248
           +   +    +          KID    +A      ++ + Q             Y     
Sbjct: 481 YVVADFPYGEQEFYLNVYIAKIDAAKIAAKTFNGFLKSSDQVGVAYFGGDVPGGY--TPR 538

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
            +    L+N+     + ++ L  Y  T     +  A +EL       +  +         
Sbjct: 539 YDVSQTLTNDTLSANNSIDDLWAYGGTPMGGGIKVARQELVANTAPGNIPVMIVLSDGNP 598

Query: 309 IFITDGENSGASAYQNTLNTLQICE--YMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ 366
              +DG  S   A Q  +   +  +   +    + IY++        + LL++   S   
Sbjct: 599 TLTSDGTASETLAIQEAIEEAETTKQTTIGGEQILIYTIGFGNDAN-ETLLKQIATSPDY 657

Query: 367 FFAVNDSRELLESFDKITDKIQEQSVR 393
           ++    S EL   + +I  +++E++ +
Sbjct: 658 YYFAATSEELSSIYRQIAKELKEKAAK 684


>gi|331658353|ref|ZP_08359315.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli TA206]
 gi|331056601|gb|EGI28610.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli TA206]
          Length = 574

 Score = 91.1 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 109/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSAL-DAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L +A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 67  QQYSDKQTLQGRLKEAPTFARAAKANATHIANPGTARYQQFDDNPVKQVAQNPLVTFSLD 126

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 127 VDTGSYANVRRFLNQGLLPPPDAVRVEEVVNYFPSDW-----DIKDKQSIPASKPIPFAM 181

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 182 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 221

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 222 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 273

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 274 AEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNVG 325

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L E
Sbjct: 326 --IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LSE 380

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 381 AQKVLNSEMRQTLITVAKD 399


>gi|152990340|ref|YP_001356062.1| von Willebrand factor type A domain-containing protein
           [Nitratiruptor sp. SB155-2]
 gi|151422201|dbj|BAF69705.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 289

 Score = 91.1 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 52/136 (38%), Gaps = 21/136 (15%)

Query: 254 PLSNNLNEVKSRLNKLNP---YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           PL+ +   +   +N L P     NT     +    + L             T  +K +I 
Sbjct: 133 PLTYDTKALDFLINYLEPSIAGNNTAIGEGLWQGIKALQA----------DTAKQKVLIL 182

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT-DSSGQFFA 369
           ITDG ++  S         Q  E  +  G+KIY++ +      + LL +   +S G+FF 
Sbjct: 183 ITDGHHNSGSIS-----PRQAVEKAKKLGIKIYTIGLG--DADKHLLEQIAKESGGKFFY 235

Query: 370 VNDSRELLESFDKITD 385
                +L   F ++  
Sbjct: 236 AKSEEDLQSIFSELNK 251


>gi|332088403|gb|EGI93521.1| von Willebrand factor type A domain protein [Shigella boydii
           5216-82]
          Length = 575

 Score = 90.7 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANLGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQAAKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMVKKQRESGVTLSTFGVGDDNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQTLITVAKD 400


>gi|306814616|ref|ZP_07448778.1| hypothetical protein ECNC101_21282 [Escherichia coli NC101]
 gi|305852010|gb|EFM52462.1| hypothetical protein ECNC101_21282 [Escherichia coli NC101]
          Length = 581

 Score = 90.7 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 109/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSAL-DAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L +A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 74  QQYSDKQTLQGRLKEAPTFARAAKANATHIANPGTARYQQFDDNPVKQVAQNPLVTFSLD 133

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 134 VDTGSYANVRRFLNQGLLPPPDAVRVEEVVNYFPSDW-----DIKDKQSIPASKPIPFAM 188

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 189 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 228

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 229 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 280

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 281 AEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNVG 332

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L E
Sbjct: 333 --IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LSE 387

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 388 AQKVLNSEMRQTLITVAKD 406


>gi|254820233|ref|ZP_05225234.1| hypothetical protein MintA_09911 [Mycobacterium intracellulare ATCC
           13950]
          Length = 339

 Score = 90.7 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/222 (13%), Positives = 65/222 (29%), Gaps = 26/222 (11%)

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            ++        S+   +      ++    E+     + +  AI                 
Sbjct: 99  NRAVVMLVIDVSESMASNDVPPNRLAAAKEAGKQFADQLTPAINLGLVEF---------- 148

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                   P + N   VKS ++ L P   T T   +  A + +      S    G     
Sbjct: 149 AANATLLVPPTTNRGAVKSGIDSLQPAPKTATGEGIFTALQAIATV--GSVMGGGEGPPP 206

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP--------------P 351
             ++  +DG  +                  +  G++I +++   P               
Sbjct: 207 ARIVLESDGAENVPLDPNAPQGAFTAARAAKGQGVQISTISFGTPYGTVDYEGATIPVPV 266

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           + Q L + C  + G+ F  +    L   +  +  +I  ++V+
Sbjct: 267 DDQTLQKICEITDGEAFHADSLDSLKNVYTTLQRQIGYETVK 308


>gi|116249091|ref|YP_764932.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253741|emb|CAK12134.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 465

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/327 (13%), Positives = 99/327 (30%), Gaps = 33/327 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LD A+++    I       D    K++ +
Sbjct: 43  VALTLVPMIVAVGASFDYIRTYNVRQRMQSDLDTALIAAVKEI----DTDDTDALKEKVA 98

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q++     G                       +   +   + A   +PT      
Sbjct: 99  DWFHAQVENSYTLGD-------------------IDIDTSNHKITATASGTVPTT----- 134

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            L+  A  +    S     +      +++ +V+D S SM                     
Sbjct: 135 -LMKIANIDTVDVSVASAVKGPATSYLNVYIVIDTSPSMLLAATTAGQSAMYSGIGCQFA 193

Query: 182 PPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                     K    + Y  + A     + DV  ++  ++++ I  +  +  +  +++G 
Sbjct: 194 CHTGDAHTVGKTKYANNYEYSAAKTIKLRADVAGDAVRDVLDMIDDS--DSNHQRIKVGL 251

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPAMHHAYRELYNEKESSHNTI 299
            +    +       LS +    +           T+        +   L  +  +  +  
Sbjct: 252 YSLGDTLTEVLTPTLSTDTARNRLADASYGLTSATSKAATYFDVSLATLKQKVGTGGDGT 311

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTL 326
            S    K V+ +TDG  S      + +
Sbjct: 312 SSGSPLKLVLLLTDGVQSQREWVTDKV 338


>gi|149914292|ref|ZP_01902823.1| hypothetical protein RAZWK3B_19866 [Roseobacter sp. AzwK-3b]
 gi|149811811|gb|EDM71644.1| hypothetical protein RAZWK3B_19866 [Roseobacter sp. AzwK-3b]
          Length = 597

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/320 (13%), Positives = 83/320 (25%), Gaps = 51/320 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           ++  +  V        ID       R  +Q+ LD+AVL+G  +             +D  
Sbjct: 21  LSLFLFVVMLAVAGLGIDTMRHEMARTHLQATLDSAVLAGAGAPADATAADVKLIVEDYF 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                 Q    +   + I  +    +  A + +                       + FL
Sbjct: 81  DAADLSQYLNTIDPETDIVASLNAKSVSASVELE---------------------MDTFL 119

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L         L + G    +     + I + LDVS SM    L K            +
Sbjct: 120 MRLSGVDT----LTTAGGATAAIAAPRMEIVLALDVSGSMAGERLTKMKSAAKQFVTDVM 175

Query: 181 LPPPPKKSFWSKNTTKSKYAPAP----APANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
                  +  S         P+     A +             L +  +K   +      
Sbjct: 176 SASDQGTTTISIVPYSWSVTPSDEMFEALSVDVRHNYSTCIDFLESDFEKTAIDPARSYG 235

Query: 237 RIGTIAY----------------------NIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
           +    +                              +  P SN++  + ++++ L    +
Sbjct: 236 QTIYTSLTGSFGNIGIGDPTVTNTAYDRTCYTDEYFRILPYSNSVTALHNKIDSLKAAGS 295

Query: 275 TNTYPAMHHAYRELYNEKES 294
           T+T+  M  A   L      
Sbjct: 296 TSTHLGMKWAAGLLDPAFAP 315



 Score = 56.8 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 33/326 (10%), Positives = 83/326 (25%), Gaps = 30/326 (9%)

Query: 92  NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
           + +    +      ++           +  GL+  A   +         ++  +  +   
Sbjct: 277 SNSVTALHNKIDSLKAAGSTSTHLGMKWAAGLLDPAFAPVVSSLQQTRTKTDSSGNLVTY 336

Query: 152 MVLDVS--RSMEDLYLQKHNDNNN----MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAP 205
            ++D S   +       +            ++       P                   P
Sbjct: 337 SIVDPSINNTPALYSTGQVLKVAIVMGDGANDWTYGLDDPNGLMNPDIVENHTQPDYRGP 396

Query: 206 ----ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS--NNL 259
                  +    +      V +       + N +       Y    + N     +  N+ 
Sbjct: 397 DSNLYRVQYTDDVFKYRYFVFNPSFIAYSEMNCNTGYWVCVYESEDITNYYLYSTYWNDY 456

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            ++ + +  L P      + A+        +++  S           F    T       
Sbjct: 457 TDITNGV-YLTP----AQFDALPTTLPNFESQERLSWEEAWGLMTPDFYSRTTFDYAPDN 511

Query: 320 SAYQNTLNTLQ----------ICEYMRNAGMKIYSVAVSAP--PEGQDLLRKCTDSSGQF 367
              +N   ++           IC   ++ G+ +Y++A          D L  C  S  Q 
Sbjct: 512 MFSKNGTGSIAPETKDDRMADICGATKSKGIVVYTIAFEMGEFDSAADRLENCASSPSQH 571

Query: 368 FAVNDSRELLESFDKITDKIQEQSVR 393
           F       + ++F  I   +Q+  + 
Sbjct: 572 FNATTLN-ISQAFGSIAANVQKLRLT 596


>gi|313159758|gb|EFR59115.1| von Willebrand factor type A domain protein [Alistipes sp. HGB5]
          Length = 330

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 66/206 (32%), Gaps = 43/206 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + + ++                          +PL+ +   +++ L ++      + T
Sbjct: 108 DRITAAKEVAGSFIADRYGDRIGLVAFAGEAFTQSPLTTDQGTLQTLLARIRSGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L            S    K +I +TDG N+        +      E  
Sbjct: 168 AIGNGLATAINRL----------RESEAKSKVIILLTDGVNNRG-----EIAPQTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP-----------------------EGQDLLRKCTD-SSGQFFAVN 371
           +  G+++Y++ V                             +  LR   + + GQ+F   
Sbjct: 213 KAQGIRVYTIGVGTEGMAPYPAVDIYGTPTGGTVMAKVEIDEKTLRSIAEQTGGQYFRAT 272

Query: 372 DSRELLESFDKITDKIQEQSVRIAPN 397
           D  +L   +D+I +++++  V +  +
Sbjct: 273 DKAKLKAIYDQI-NQLEKSKVEVTEH 297


>gi|296446920|ref|ZP_06888856.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296255595|gb|EFH02686.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 486

 Score = 90.7 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 63/478 (13%), Positives = 136/478 (28%), Gaps = 99/478 (20%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+      +    A+D A    ++ Q+ +  D+A L+     +  +T     T     
Sbjct: 24  IFALAAIPLLIAAGGAVDFAIASRVQTQLYAICDSATLAATTPAMMQQTTATAKTVA--- 80

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                      + Q + +  N+ ++      + +              AQ          
Sbjct: 81  ----TSMFAAQVAQINRLTYNSANLTVTVNDDTSASPVKTRTVTVSYLAQVGNA------ 130

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
                      S+ +      +S    I   +VLD S SME         +    +    
Sbjct: 131 --FGSFYHVPTSIFTVKASSTASTARNIDFYLVLDNSPSMELPATTAGLASMTAATGCVF 188

Query: 181 LP-------PPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI-QEKK 232
                    P     +    T  S      A    +ID + E+A  L ++ Q  +     
Sbjct: 189 ACHENTYSDPENTVQYPGYGTIDSYTYAKNAGIALRIDNVREAAKRLASTSQAMMSANGA 248

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN----------PYENTNTYPAMH 282
              +      Y+   +    +  S N++ + + +N +           P   + TYP   
Sbjct: 249 TYRLAAYAFNYDTTQLQALTSTTSANVSAISTSINAMTPPLMEKNNYLPTGASYTYPTSA 308

Query: 283 HAYRELYNEKESSHNTIG-----------------------------STRLKKFVIFITD 313
             +  +    + +                                    + ++ V+ +TD
Sbjct: 309 STWTTVTLGSDPTKTNYNVRDAMTDIEMTLTKVNAAMPNPGNGTTASGDKPQEVVMLVTD 368

Query: 314 GE-----------NSGASAYQNTLNT---------LQICEYMRNAGMKIYS---VAVSAP 350
           G             + AS+Y N+  T           +C  ++N G++I     +    P
Sbjct: 369 GMVDGSFYTNTSCTNYASSYSNSYGTFYRCLRPLDTTLCTTIKNRGIRIAVLNLIYYPTP 428

Query: 351 PEG-------------QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
             G                L+ C  +   +F V+   ++ E+   +  K+   +  + 
Sbjct: 429 GYGFYDGAVAPFISTVSPALKSCASTD-LYFEVDTGSDISEAMTYLFQKVVTTASYLT 485


>gi|293359740|ref|XP_233802.5| PREDICTED: vitrin [Rattus norvegicus]
          Length = 648

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 46/352 (13%), Positives = 94/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 318 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRGGAPNVAVVLVDGGPT 377

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             I E          N+F   +  +A              S      +     +V   + 
Sbjct: 378 DKIEEVSRVARESGINVFFVTVEGAAEREKQHVVEPNFA-SKAVCRTNGFYSFNVQSWLS 436

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 437 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVL-QFVANLS 492

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      RIG + Y             N+  +V S + ++      T+T  A
Sbjct: 493 KEFEISDTD-----TRIGAVQYTYEQRLEFGFDKYNSKADVLSAIRRVGYWSGGTSTGAA 547

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 548 IQYALEQLF--------KKSKPNKRKVMILITDGRSYDDVRIP--------AMAAYQKGV 591

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V++   L +   +I   I  +
Sbjct: 592 ITYAIGI--AWAAQDELEVIATHPARDHSFFVDEFDNLYKFVPRIIRNICTE 641


>gi|301026928|ref|ZP_07190323.1| von Willebrand factor type A domain protein [Escherichia coli MS
           196-1]
 gi|299879508|gb|EFI87719.1| von Willebrand factor type A domain protein [Escherichia coli MS
           196-1]
          Length = 575

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQMLITVAKD 400


>gi|86131264|ref|ZP_01049863.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
 gi|85818675|gb|EAQ39835.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
          Length = 334

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 65/194 (33%), Gaps = 42/194 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----EN 274
           N + +++K      N                   TP++++ + V S L  +         
Sbjct: 112 NRLEALKKVASSFINGRPNDRIGLVEYAGESFTKTPITSDKSIVLSALKGIQYNSIIEGG 171

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T     +      +            S  L K +I +TDGEN+        ++     E 
Sbjct: 172 TAIGMGLATGVNRI----------KDSKALSKVIILMTDGENNAGQ-----IDPRIAAEL 216

Query: 335 MRNAGMKIYSVAVSAPPE----------------------GQDLLRKCT-DSSGQFFAVN 371
            +  G+K+Y++ +                            ++LL +    + GQ+F   
Sbjct: 217 AQEFGIKVYTIGMGTNGTALSPYARNPNGTFVYENIQVTIDEELLEEIAETTGGQYFRAT 276

Query: 372 DSRELLESFDKITD 385
           ++++L E +D+I  
Sbjct: 277 NNKKLQEIYDEIDK 290


>gi|253584083|ref|ZP_04861281.1| BatA protein [Fusobacterium varium ATCC 27725]
 gi|251834655|gb|EES63218.1| BatA protein [Fusobacterium varium ATCC 27725]
          Length = 319

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 62/161 (38%), Gaps = 38/161 (23%)

Query: 254 PLSNNLNEVKS-----RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           PL+ + N +K       ++ +     T     +  A   L            S    K +
Sbjct: 137 PLTFDHNVIKEMTRKLTVDDITSNTRTAIGMGIGVALNRL----------KDSEAKSKVI 186

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---------------- 352
           I +TDGEN+      +        +  +  G+KIY++ + A                   
Sbjct: 187 ILLTDGENNSGEMSPS-----AAADIAKELGIKIYTIGIGAKEIKVPSFFGYKTVKNTEL 241

Query: 353 GQDLLRKCT-DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            +++L+     + G++F  +DS+E  E F+KI D +++  +
Sbjct: 242 DENMLKSIAETTGGEYFRASDSKEFKEIFNKI-DALEKTKI 281


>gi|197105075|ref|YP_002130452.1| hypothetical protein PHZ_c1612 [Phenylobacterium zucineum HLK1]
 gi|196478495|gb|ACG78023.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 521

 Score = 90.4 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 57/493 (11%), Positives = 130/493 (26%), Gaps = 102/493 (20%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQ------------------SALDAAV------ 37
            A  +    +    AIDLA     + Q+Q                    L AA       
Sbjct: 27  VAFAMVPLAIGTLGAIDLARGASAKVQLQDALDAAALGAARSSANSPDTLQAAGERLLRQ 86

Query: 38  -LS-------GCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENA---GDIA 86
            L+         +S       K     + +           +    +   E       + 
Sbjct: 87  NLALGGDFELVSSSFTFGPDNKVLARAQVRVEPYVAGLAGVNNMDIAAATEVVRAGMQLE 146

Query: 87  QKAQINITKDKN-NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSEN 145
               ++ T   N N   Y  ++ A+  +       +G        +SL       R   +
Sbjct: 147 IALVLDNTGSMNQNNKLYHLKTAAKAFVTAMETAAEGNTVPNSIKISLVPFSHTVRVDSD 206

Query: 146 LAISICMVLDVSRSMEDL-----YLQKHNDN-----NNMTSNKYLLPPPPKKSFWSKNTT 195
              +   +     S  +             N     + + ++        +  +  ++T 
Sbjct: 207 AYRNAAWIDQNGSSPINNEIFPTATGTQWANRFTLFSQLGTSWRGCVESRQAPYDIQDTP 266

Query: 196 KSKYAPAPAPANR--------KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIA----- 242
            +  A    P           +      +   + +         +  ++           
Sbjct: 267 PTTGATLFTPYFAPDEPDYPAEWYGTKFANSYVDDRTSSTNWRVRQGNLTKYVNTKGLGT 326

Query: 243 ---YNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE-SSHNT 298
               N G        L+ + + ++  ++ L    +TN    +   +  L           
Sbjct: 327 SKGPNAGCGLRPIIRLTTDFDGLRDAVDDLVADGSTNIPMGLVWGWHTLAPMAPFPDGVP 386

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNT--------------------------------- 325
             + + KK V+ +TDGEN+                                         
Sbjct: 387 YLTEKHKKIVVLMTDGENTILYKDTPNGSDYSGVGHARQGRVLDPAGRPITESSSQRERT 446

Query: 326 ----LNTLQICEYMRN--AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLES 379
                  L++C  M+     ++IY++ V        +L+ C  S+  ++ V ++ ++  +
Sbjct: 447 AALDDRLLKLCANMKAPAKDIEIYAIRVEVSSGSSSVLQTCASSADHYYDVQNAADMTMA 506

Query: 380 FDKITDKIQEQSV 392
           F  I  +I    +
Sbjct: 507 FQSIAGQIAALHL 519


>gi|78776847|ref|YP_393162.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497387|gb|ABB43927.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 307

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 63/154 (40%), Gaps = 21/154 (13%)

Query: 245 IGIVGNQCTPLSNNLNEV---KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
            G      +P++   N +    S LN+    +NT    A+  + R              S
Sbjct: 138 YGDFAFIASPITYEKNIIIEMLSYLNQGMAGQNTAIGEAIAMSLRAF----------KHS 187

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA-PPEGQDLLRKC 360
               K V+ +TDGE++                  +   +KIY++ +       + LL+K 
Sbjct: 188 KAKSKIVVLLTDGEHNSGDIS-----PKDALVLAKEENIKIYTIGMGNRGEADEALLKKI 242

Query: 361 TD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            D S G+FF   +++EL E ++ I D+++   ++
Sbjct: 243 ADESGGEFFYATNAKELKEIYEHI-DELESSKIK 275


>gi|16130205|ref|NP_416773.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|89109088|ref|AP_002868.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|157161758|ref|YP_001459076.1| von Willebrand factor type A domain-containing protein [Escherichia
           coli HS]
 gi|238901445|ref|YP_002927241.1| hypothetical protein BWG_2044 [Escherichia coli BW2952]
 gi|256022046|ref|ZP_05435911.1| hypothetical protein E4_01620 [Escherichia sp. 4_1_40B]
 gi|300948978|ref|ZP_07163036.1| von Willebrand factor type A domain protein [Escherichia coli MS
           116-1]
 gi|300956471|ref|ZP_07168759.1| von Willebrand factor type A domain protein [Escherichia coli MS
           175-1]
 gi|301647634|ref|ZP_07247429.1| von Willebrand factor type A domain protein [Escherichia coli MS
           146-1]
 gi|307138934|ref|ZP_07498290.1| hypothetical protein EcolH7_12533 [Escherichia coli H736]
 gi|331642908|ref|ZP_08344043.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli H736]
 gi|2495629|sp|P76481|YFBK_ECOLI RecName: Full=Uncharacterized protein yfbK
 gi|1788606|gb|AAC75330.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|85675335|dbj|BAE76678.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|157067438|gb|ABV06693.1| von Willebrand factor type A domain protein [Escherichia coli HS]
 gi|238860346|gb|ACR62344.1| conserved protein [Escherichia coli BW2952]
 gi|260448637|gb|ACX39059.1| von Willebrand factor type A [Escherichia coli DH1]
 gi|300316719|gb|EFJ66503.1| von Willebrand factor type A domain protein [Escherichia coli MS
           175-1]
 gi|300451549|gb|EFK15169.1| von Willebrand factor type A domain protein [Escherichia coli MS
           116-1]
 gi|301074238|gb|EFK89044.1| von Willebrand factor type A domain protein [Escherichia coli MS
           146-1]
 gi|309702582|emb|CBJ01910.1| putative lipoprotein [Escherichia coli ETEC H10407]
 gi|315136904|dbj|BAJ44063.1| hypothetical protein ECDH1ME8569_2207 [Escherichia coli DH1]
 gi|331039706|gb|EGI11926.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli H736]
          Length = 575

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQMLITVAKD 400


>gi|323941033|gb|EGB37220.1| von Willebrand protein type A [Escherichia coli E482]
          Length = 565

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 58  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 117

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 118 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 172

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 173 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 212

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 213 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 264

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 265 AEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINR--------ILLATDGDFNVG 316

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 317 --IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---LSE 371

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 372 AQKVLNSEMRQMLITVAKD 390


>gi|147921050|ref|YP_685140.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
 gi|110620536|emb|CAJ35814.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
          Length = 1310

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 51/134 (38%), Gaps = 16/134 (11%)

Query: 254  PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
                N   VK+ +N L+    T+    +  A  EL   K S+         K+++I +TD
Sbjct: 945  NSGTNKTTVKNAINSLSASGGTDISSGIKKAIAELDAHKRSTA--------KQYIIVLTD 996

Query: 314  GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS 373
            G +            L   +  +  G  I+++ +      +D L+K       ++ V   
Sbjct: 997  GYSQYPEFD------LIEADKAKAKGYTIFTIGMGM--ADEDTLKKIASKPEYYYRVLSP 1048

Query: 374  RELLESFDKITDKI 387
             +L  ++  I  +I
Sbjct: 1049 EQLEAAYYDIGQEI 1062


>gi|148256121|ref|YP_001240706.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
 gi|146408294|gb|ABQ36800.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
          Length = 602

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/435 (13%), Positives = 115/435 (26%), Gaps = 56/435 (12%)

Query: 13  ITYAID--LAHIMYIR-NQMQSAL-------DA-AVLSGCASIVSDRTIKDPTTKKDQTS 61
           +  A+D   +     +   +Q+A+       D  + L+     V    I          S
Sbjct: 167 VALALDNTGSMAYSGKMTALQNAVAGSGGLIDQLSALAKSPGDVYISLIPFAKVVNVGAS 226

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
              +  I     Q     +      Q A  N +  ++        S   +       +  
Sbjct: 227 NYAQSWIDWTDWQNPPTIQPNNGSYQAAIPNASFTQSQWDMVGPGSSCPFTSGNGFPYFS 286

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                  T  S  S      S              S         +++   N  +  Y  
Sbjct: 287 CTSG-PATASSSASKVPSSGSYSGYICPGYDSASHSYYNGCWNSVQNSTRVNWCTGSYCS 345

Query: 182 PPPPKKSFWSKNTTKSKYAPAPA---------PANRKIDVLIESAGNLVNSIQKAIQEKK 232
            P    +  +   + +    +                         +             
Sbjct: 346 CPTTGSNVPNNTCSCTGSGSSTVCKVNTFTHTWIANATSTWTGCVADRTQPNDANAVSPA 405

Query: 233 NLSVRI---------GTIAYNIGIVGN---QCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
           +  V             + Y          Q  PLS N   +KS +N + P   TN    
Sbjct: 406 SSDVATLFPANQHMENNVQYCSSSASTKLGQIVPLSYNWTSLKSAVNAMEPTGGTNQAIG 465

Query: 281 MHHAYRELYNEKE-SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI-------- 331
           M  A + L       +     +T   + +I ++DG N+          + Q         
Sbjct: 466 MAWAVQSLIPNGVLGAPAEDANTTYNRVIILLSDGLNTEDRWPDYGNGSTQASGNPIDAR 525

Query: 332 ----CEYMRNAG-------MKIYSVAVSAPPEGQ---DLLRKCTDSSGQFFAVNDSRELL 377
               C  ++N           IY++ V+          +L+ C  S  +F+ +  S +++
Sbjct: 526 QALLCSNLKNTKDSKGNAMYTIYTIQVNTSSPADPTSTVLQNCASSPDKFYMLTSSSQIV 585

Query: 378 ESFDKITDKIQEQSV 392
            +F+ I   + +  V
Sbjct: 586 TTFNSIGTALSKLRV 600



 Score = 70.3 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 52/214 (24%), Gaps = 25/214 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI +     FI  AID +     R+ MQ ALD+  L           +   T      
Sbjct: 39  LFAIALLPILAFIGAAIDYSRANAARSAMQGALDSTALMLSR------DLSQGTITAADV 92

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +       K                     + +T          A +             
Sbjct: 93  AAKASTYFKALYTSTD-----------AQSVAVTASYTASTSSSASNIQLNASGQIVTQF 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM----TS 176
             L+       + ++      +  ++ + + + LD + SM          N         
Sbjct: 142 MKLVGFPTMTFNTKA----TTTWGDVKMRVALALDNTGSMAYSGKMTALQNAVAGSGGLI 197

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
           ++           +      +K     A    + 
Sbjct: 198 DQLSALAKSPGDVYISLIPFAKVVNVGASNYAQS 231


>gi|260461186|ref|ZP_05809435.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033220|gb|EEW34482.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 523

 Score = 90.4 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 61/494 (12%), Positives = 129/494 (26%), Gaps = 115/494 (23%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLS--------GCASIVSDRTIKDPTT--------- 55
           + +A D++ +M  +  +Q++LDAA LS            +  D   +             
Sbjct: 29  VGFAADVSSVMRAKVNLQNSLDAATLSSSHLSDDEAARRLAFDGYFQANVANHPELTNAK 88

Query: 56  -------------KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQ 102
                         K   S               +I  +AG +     + +    +N   
Sbjct: 89  LTLSVDKGFNYVKTKAIASADVNLYFAFLFGDNQHIEVDAGGVEATNNLEVVLVLDNTGS 148

Query: 103 YIA-ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDV----- 156
               + KA  +     L       S    ++      +   + N        +D+     
Sbjct: 149 MAGAKIKALRDATKVLLDNLDGAKSPDRKVTAAIVPFVTAVNINGDKFDPSWIDMAGKSP 208

Query: 157 ---------------------------SRSMEDLYLQK---------------HNDNNNM 174
                                      +      +                     + N 
Sbjct: 209 NNGANFPLLPDGKRVNHMDLFRDLAQGTGWQGTGWKGCVEARPGSAAISDVAPDQADANT 268

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR---KIDVLIESAGNLVNSIQKAIQEK 231
               Y  P  P  +     +  +              +     +     +   +    +K
Sbjct: 269 LFVPYFAPDDPGDATGPSASYGNDAKVYNNSYLSDDVQDGTDTKGKDKKIAKYENPKAKK 328

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN--PYENTNTYPAMHHAYRELY 289
            N      T+            PL+ +L+++++   ++       TN    +    R L 
Sbjct: 329 INDKYAPLTVGP-NRACPTPVVPLTADLDKLRTAAAQMQEWNGSGTNVSEGLSWGMRVLS 387

Query: 290 NEKESSHNTI-GSTRLKKFVIFITDGEN--------------------SGASAYQNTLN- 327
                +      +    K V+ +TDGEN                    S      +    
Sbjct: 388 PAPPYTDGAPWKTPNTSKIVVLLTDGENVVYGASAEPEKSDYTSYGYLSSGRFGTSNQTD 447

Query: 328 --------TLQICEYMRNAGMKIYSVAVSAP-PEGQDLLRKCTDSSGQFFAVNDSRELLE 378
                   TL +C+ ++   ++IY++ + +     + L  KC  +   ++AVND  +L  
Sbjct: 448 AARSVDRWTLDVCDKLKAQQVQIYTITLQSDTAANRTLYGKCATNPADYYAVNDPSKLPN 507

Query: 379 SFDKITDKIQEQSV 392
            F  I  K     +
Sbjct: 508 VFQTIAGKFTTLQL 521


>gi|330806846|ref|YP_004351308.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327374954|gb|AEA66304.1| Putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 557

 Score = 90.0 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/307 (11%), Positives = 93/307 (30%), Gaps = 29/307 (9%)

Query: 92  NITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
           ++ +   +      +    Y      L    L P     L           +     S  
Sbjct: 102 SVAETPVSTFSVDVD-TGSYANVRRLLNQGSLPPEGAVRLEEMVNYFPYSYALPTDGSPF 160

Query: 152 MVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
            V             +        S++ +    P    +  + + S       P      
Sbjct: 161 GVTTEVAPSPWNPHTRLLRIGIKASDRAVADLAPANLVFLVDVSGSMDRREGLP------ 214

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
           ++  +   LV+ ++           R+  + Y              +   +++ +++L+ 
Sbjct: 215 LVKSTLKLLVDQLRDQD--------RVSLVVYAGESRVVLKPTSGRDKVTIRNAIDQLDA 266

Query: 272 YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI 331
             +T     +  AY+                     ++  TDG+ +   +  ++L   Q+
Sbjct: 267 GGSTAGASGIELAYQMARESFIDKGINR--------ILLATDGDFNVGVSDFDSL--KQM 316

Query: 332 CEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQ 390
               R +G+ + ++        + L+ +  D+  G +  +++   LLE+   + D++   
Sbjct: 317 AVDQRKSGVSLTTLGFGVDNYNEHLMEQLADAGDGNYAYIDN---LLEARKVLVDQLSST 373

Query: 391 SVRIAPN 397
              +A +
Sbjct: 374 LAVVARD 380


>gi|291386938|ref|XP_002709809.1| PREDICTED: vitrin [Oryctolagus cuniculus]
          Length = 869

 Score = 90.0 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 49/383 (12%), Positives = 97/383 (25%), Gaps = 47/383 (12%)

Query: 27  NQMQSALD---AAVLSGCASIVSDR-------------TIKDPTTKKDQTSTIFKKQIKK 70
             +  ALD   A  L G      +               +K    K  Q   +       
Sbjct: 508 TDVAQALDIGPAGPLMGVVQYGDNPATQFSLKTHMNSRDLKAAIEKITQRGGLSNAGRAI 567

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+      + +      P   + E+         N+F   +  +    
Sbjct: 568 SFVTKNFFSKVNGNRGGAPNVAVVLVDGWPTDKVEEASRLARESGINIFFITIEGAVENE 627

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +     +V                             K  F 
Sbjct: 628 KQYVVEPNFANK-AVCRTNGFYSFNVQSWFGLHKT---VQPLVKRVCDTDRLACSKTCFN 683

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +         VL +   NL    + +  +      RIG + Y       
Sbjct: 684 SADLGFVIDGSSSVGTGNFRTVL-QFVANLSKEFEISETD-----TRIGAVQYTYEQRLE 737

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 N   ++ + + ++      T+T  A+++A  +L+               +K +I
Sbjct: 738 FGFDKYNTKPDILNAIKRVGYWSGGTSTGAAINYALEQLF--------KKSKPNKRKLMI 789

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG +                    + G+  Y++ V      QD L            
Sbjct: 790 LITDGRSYDDVRIP--------AMAAHHKGVITYAIGV--AWAAQDELEVIATYPAKDHS 839

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +   +I   I  +
Sbjct: 840 FFVDEFDNLYKFVPRIIQNICTE 862


>gi|241113143|ref|YP_002972978.1| hypothetical protein Rleg_4788 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861351|gb|ACS59017.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 461

 Score = 90.0 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 45/327 (13%), Positives = 97/327 (29%), Gaps = 33/327 (10%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
            A+ +    + +  + D      +R +MQS LD A+++    I       D    K + S
Sbjct: 39  VALTLVPMIVAVGASFDYIRTYNVRQRMQSDLDTALIAAVKEI----DTDDAVALKQKVS 94

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
             F  Q++     G                       +   +   + A   +PT      
Sbjct: 95  DWFHAQVENSYTLGD-------------------INIDTSNHKITATASGTVPTT----- 130

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
            L+  A  +    S     +      +++ +V+D S SM                     
Sbjct: 131 -LMRIANIDTVDVSVASAVKGPATSYLNVYIVIDTSPSMLLAATTAGQATMYSGIGCQFA 189

Query: 182 PPPPKKSFWSKNTTKSKYAPAPA-PANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                       T  + Y  + A     + DV  ++  +++  I  +  +  +  +++G 
Sbjct: 190 CHTGDAHKIGNKTYNNNYEYSTAKNIKLRADVAGDAVKDVLALIDTS--DSNHQRIKVGL 247

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPAMHHAYRELYNEKESSHNTI 299
            +    +       LS +    +           T+        +   L  +  +  +  
Sbjct: 248 YSLGDTLTEVLAPTLSTDTARNRLTDASYGLTSATSKAATYFDVSLTTLKQKVGTGGDGT 307

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTL 326
            S    K V+ +TDG  S      + +
Sbjct: 308 ASNSPLKLVLLLTDGVQSQREWVTDKV 334


>gi|323936560|gb|EGB32847.1| von Willebrand type A protein [Escherichia coli E1520]
          Length = 565

 Score = 90.0 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 58  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 117

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 118 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 172

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 173 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 212

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 213 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 264

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 265 AEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINR--------ILLATDGDFNVG 316

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 317 --IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---LSE 371

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 372 AQKVLNSEMRQMLITVAKD 390


>gi|291514853|emb|CBK64063.1| Mg-chelatase subunit ChlD [Alistipes shahii WAL 8301]
          Length = 328

 Score = 90.0 bits (221), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 70/204 (34%), Gaps = 41/204 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + + ++                          +PL+ + + +++ L ++      + T
Sbjct: 108 DRITAAKEVAGSFIADRYGDRIGLVAFAGEAFTQSPLTTDQSTLQTLLARIRSGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L            S    K +I +TDG N+        +  +   E  
Sbjct: 168 AIGNGLATAINRL----------RESDAKSKVIILLTDGVNNQGQ-----IAPMTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTD-SSGQFFAVNDS 373
           +  G+++Y++ V                           + +L+  +D + G++F   D 
Sbjct: 213 KAQGIRVYTIGVGTEGMAPYPAIDMFGNLTFVNQKVEIDEKVLKAISDMTGGRYFRATDK 272

Query: 374 RELLESFDKITDKIQEQSVRIAPN 397
            +L   +D+I +++++  + +  +
Sbjct: 273 EKLKAVYDEI-NQLEKSKIEVMEH 295


>gi|320158179|ref|YP_004190557.1| BatA [Vibrio vulnificus MO6-24/O]
 gi|319933491|gb|ADV88354.1| BatA [Vibrio vulnificus MO6-24/O]
          Length = 323

 Score = 90.0 bits (221), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 67/203 (33%), Gaps = 47/203 (23%)

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                ++  +       +               R+G + +         TPL+ +   V 
Sbjct: 107 GDYIDRLSAVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVA 155

Query: 264 SRLNK--LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++LN+  +      T     +  A +   +          S   ++ VI ++DG N+   
Sbjct: 156 NQLNQTIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG- 204

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAP-----------------PEGQDLLRKCTD- 362
               TL+ ++     +  G+KIY++ + A                     +  L K    
Sbjct: 205 ----TLDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKIATM 260

Query: 363 SSGQFFAVNDSRELLESFDKITD 385
           + GQ+F   D++EL   +  I  
Sbjct: 261 TGGQYFRARDAQELQAIYQAINQ 283


>gi|315615538|gb|EFU96170.1| von Willebrand factor type A domain protein [Escherichia coli 3431]
          Length = 575

 Score = 89.6 bits (220), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 107/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 68  QQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLD 127

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 128 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 182

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 183 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 222

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 223 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 274

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 275 AEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINR--------ILLATDGDFNVG 326

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + +  V      + ++ +  D  +G +  ++    L E
Sbjct: 327 --IDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDT---LSE 381

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 382 AQKVLNSEMRQMLITVAKD 400


>gi|218559186|ref|YP_002392099.1| hypothetical protein ECS88_2420 [Escherichia coli S88]
 gi|218365955|emb|CAR03699.1| conserved hypothetical protein [Escherichia coli S88]
          Length = 580

 Score = 89.6 bits (220), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPVKQVAQNPLATFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|332227196|ref|XP_003262777.1| PREDICTED: vitrin isoform 1 [Nomascus leucogenys]
          Length = 694

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 36/323 (11%), Positives = 88/323 (27%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+ +    + +      P   + E+         N+F   +  +A   
Sbjct: 393 SFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENE 452

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +      V          +                  K    
Sbjct: 453 KQYVVEPNFANK-AVCRTNGFYSFHVQSWFGLHKTLQPL---VKRVCDTDRLACSKTCLN 508

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +         VL +   NL    + +  +      RIG + Y       
Sbjct: 509 SADIGFVIDGSSSVGTGNFRTVL-QFVTNLTKEFEISDTD-----TRIGAVQYTYEQRLE 562

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 ++  ++ + + ++      T+T  A++ A  +L+               +K +I
Sbjct: 563 FGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLF--------KKSKPNKRKLMI 614

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG         + +    +  +++     +++ A+      Q+ L            
Sbjct: 615 LITDGR------SYDDVRIPAMAAHLKG----VFTYAIGVAWAAQEELEVIATHPARDHS 664

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +   +I   I  +
Sbjct: 665 FFVDEFDNLYQYVPRIIQNICTE 687



 Score = 45.3 bits (105), Expect = 0.018,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 53/163 (32%), Gaps = 23/163 (14%)

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSH 296
           +G + Y      +       N  ++K+ + K+      +N   A+    +  +++     
Sbjct: 348 MGVVQYGDNPATHFNLKTHMNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANG-- 405

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                +     V+ + DG  +            +     R +G+ I+ + +    E +  
Sbjct: 406 ---NRSGAPNVVVVMVDGWPTD--------KVEEASRLARESGINIFFITIEGAAENEKQ 454

Query: 357 L--------RKCTDSSGQF-FAVNDSRELLESFDKITDKIQEQ 390
                    +    ++G + F V     L ++   +  ++ + 
Sbjct: 455 YVVEPNFANKAVCRTNGFYSFHVQSWFGLHKTLQPLVKRVCDT 497


>gi|26248659|ref|NP_754699.1| hypothetical protein c2813 [Escherichia coli CFT073]
 gi|91211565|ref|YP_541551.1| hypothetical protein UTI89_C2553 [Escherichia coli UTI89]
 gi|117624462|ref|YP_853375.1| hypothetical protein APECO1_4292 [Escherichia coli APEC O1]
 gi|227887329|ref|ZP_04005134.1| von Willebrand factor type A domain protein [Escherichia coli
           83972]
 gi|300983332|ref|ZP_07176546.1| von Willebrand factor type A domain protein [Escherichia coli MS
           45-1]
 gi|301049025|ref|ZP_07196011.1| von Willebrand factor type A domain protein [Escherichia coli MS
           185-1]
 gi|26109064|gb|AAN81267.1|AE016763_226 Hypothetical protein yfbK [Escherichia coli CFT073]
 gi|91073139|gb|ABE08020.1| hypothetical protein YfbK [Escherichia coli UTI89]
 gi|115513586|gb|ABJ01661.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|227835679|gb|EEJ46145.1| von Willebrand factor type A domain protein [Escherichia coli
           83972]
 gi|294491429|gb|ADE90185.1| von Willebrand factor type A domain protein [Escherichia coli
           IHE3034]
 gi|300299173|gb|EFJ55558.1| von Willebrand factor type A domain protein [Escherichia coli MS
           185-1]
 gi|300408590|gb|EFJ92128.1| von Willebrand factor type A domain protein [Escherichia coli MS
           45-1]
 gi|307554335|gb|ADN47110.1| von Willebrand factor type A domain protein [Escherichia coli ABU
           83972]
 gi|307626191|gb|ADN70495.1| hypothetical protein UM146_05450 [Escherichia coli UM146]
 gi|315285863|gb|EFU45301.1| von Willebrand factor type A domain protein [Escherichia coli MS
           110-3]
 gi|315292192|gb|EFU51544.1| von Willebrand factor type A domain protein [Escherichia coli MS
           153-1]
 gi|323952065|gb|EGB47939.1| von Willebrand protein type A [Escherichia coli H252]
 gi|323956039|gb|EGB51792.1| von Willebrand protein type A [Escherichia coli H263]
          Length = 580

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPVKQVAQNPLATFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|293347920|ref|XP_001064219.2| PREDICTED: vitrin-like [Rattus norvegicus]
          Length = 648

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 46/352 (13%), Positives = 94/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ + +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 318 KTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRGGAPNVAVVLVDGWPT 377

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             I E          N+F   +  +A              S      +     +V   + 
Sbjct: 378 DKIEEVSRVARESGINVFFVTVEGAAEREKQHVVEPNFA-SKAVCRTNGFYSFNVQSWLS 436

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    S +        +    +    VL +   NL 
Sbjct: 437 LHKT---VQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVL-QFVANLS 492

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
              + +  +      RIG + Y             N+  +V S + ++      T+T  A
Sbjct: 493 KEFEISDTD-----TRIGAVQYTYEQRLEFGFDKYNSKADVLSAIRRVGYWSGGTSTGAA 547

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L+               +K +I ITDG +                      G+
Sbjct: 548 IQYALEQLF--------KKSKPNKRKVMILITDGRSYDDVRIP--------AMAAYQKGV 591

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ +      QD L            F V++   L +   +I   I  +
Sbjct: 592 ITYAIGI--AWAAQDELEVIATHPARDHSFFVDEFDNLYKFVPRIIRNICTE 641


>gi|218672731|ref|ZP_03522400.1| hypothetical protein RetlG_14377 [Rhizobium etli GR56]
          Length = 323

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 42/318 (13%), Positives = 91/318 (28%), Gaps = 29/318 (9%)

Query: 105 AESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY 164
             S    E     +           + +       + S    +  +   L  +  ++   
Sbjct: 7   VSSSMIEENRFTPMQTAVAGFLQAFSSNTSLVDKTKISIVPFSSRVNFGLANTAWLKSYN 66

Query: 165 LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPAN----RKIDVLIESAGNL 220
                                K S+W    T                 + DV +   G +
Sbjct: 67  GTAAVPKRWTDPKSVYTSSSYKLSYWIDGVTPVMSTSKNYYWMGCIEPRADVEVRDTGAI 126

Query: 221 VNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPA 280
            + +  A                         TPL+ +   +KS +  L    +T     
Sbjct: 127 GDGMGDAPPGTAAFVAMDANPKSGTSFCPPPVTPLTGDFAYLKSVVKNLTSEGSTRLDAG 186

Query: 281 MHHAYRELYNEKESSHNTIG-----STRLKKFVIFITDGENSGASAYQN----------- 324
           +   +  L  + +            S  + K ++F+TDGE +      +           
Sbjct: 187 VVAGWYTLSPKWQGVWGDETSPAEVSDSVHKVMVFMTDGEMNTKYDPNDKFDWICSQTQS 246

Query: 325 -------TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL 377
                  T      C  M+ +G++IY+++ SA  +  ++ R C  ++  FF       + 
Sbjct: 247 SACNAFATAAMQTACTAMKKSGIEIYTLSYSADADVVNI-RNCATNTAHFFTA-SPATIK 304

Query: 378 ESFDKITDKIQEQSVRIA 395
             ++ I   I+  ++R+ 
Sbjct: 305 TVYETIAAAIRGDTLRLT 322


>gi|149371021|ref|ZP_01890616.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
 gi|149355807|gb|EDM44365.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
          Length = 334

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 62/178 (34%), Gaps = 44/178 (24%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYN 290
           + RIG + Y         TPL+++   V S LN +         T     +  A   L  
Sbjct: 130 NDRIGLVEYAGESYTK--TPLTSDKTVVLSSLNSIEYNSIIEGGTAIGMGLATAVNRL-- 185

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     ST   K +I +TDGEN+        ++     E     G+K+Y++ +   
Sbjct: 186 --------KESTAKSKVIILLTDGENNSG-----FIDPKIASELAVEFGIKVYTIGLGTN 232

Query: 351 P----------------------EGQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD 385
                                    + LL++    + GQ+F    + +L E +++I  
Sbjct: 233 GMASSPIGILPNGRFQYGNQPVKIDETLLKEIAKTTGGQYFRATSNTKLNEIYEEINK 290


>gi|37676036|ref|NP_936432.1| hypothetical protein VVA0376 [Vibrio vulnificus YJ016]
 gi|37200576|dbj|BAC96402.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 323

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 67/203 (33%), Gaps = 47/203 (23%)

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                ++  +       +               R+G + +         TPL+ +   V 
Sbjct: 107 GDYIDRLSSVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVA 155

Query: 264 SRLNK--LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++LN+  +      T     +  A +   +          S   ++ VI ++DG N+   
Sbjct: 156 NQLNQTIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG- 204

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAP-----------------PEGQDLLRKCTD- 362
               TL+ ++     +  G+KIY++ + A                     +  L K    
Sbjct: 205 ----TLDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKIATM 260

Query: 363 SSGQFFAVNDSRELLESFDKITD 385
           + GQ+F   D++EL   +  I  
Sbjct: 261 TGGQYFRARDAQELQTIYQAINQ 283


>gi|116623631|ref|YP_825787.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226793|gb|ABJ85502.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 589

 Score = 89.6 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 33/324 (10%), Positives = 74/324 (22%), Gaps = 43/324 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           T ++ SV    +  AID      +R ++ SA+D   L+    + S        +      
Sbjct: 20  TLLVSSVLIPMVGLAIDGGRGYLVRLKLSSAVDGGALAAARLLGSGSNAAQQLSM---AK 76

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK-------NNPLQYIAESKAQYEIP 114
               + +  +     +    +G                     +    Y   + A     
Sbjct: 77  ATAAQFVNANFPAKFFGASLSGAANVCVDPGTDSSDPCGVGNGSGISTYKVRTVAVKATA 136

Query: 115 TENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
           T       +I      +S   T         L +     +  +            ++  +
Sbjct: 137 TMPTLFMRIIGMPTVTVSGSGTASRRDVRVILVMDRSSSMG-TYYSGINQTPPSINDMAL 195

Query: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
                                      + A      D +          +    ++    
Sbjct: 196 KFVNSF---------------------SGAGEFGGRDEVGLVVYGGSGIVAYPPRDITKD 234

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKES 294
                                      +   +  +    NT T  A++ AY  L  +  +
Sbjct: 235 YTDYTKFTPPDNNFKAS--------GNIPKYIADITSGSNTGTAEALYLAYMTLRADAAT 286

Query: 295 SHNTIGSTRLKKFVIFITDGENSG 318
           +            ++  TDG  +G
Sbjct: 287 NP---DLATKLNVIVLFTDGIPNG 307



 Score = 38.3 bits (87), Expect = 2.2,   Method: Composition-based stats.
 Identities = 31/362 (8%), Positives = 86/362 (23%), Gaps = 34/362 (9%)

Query: 59  QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENL 118
             +  +    K      ++              + +        Y+A    + +  T   
Sbjct: 230 DITKDYTDYTKFTPPDNNFKASGNIPKYIADITSGSNTGTAEALYLAYMTLRADAATNPD 289

Query: 119 FLKGL----IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174
               L    + +      + +    +  +    + I    ++               N  
Sbjct: 290 LATKLNVIVLFTDGIPNGVTAMANDKTIANQHYLMIPNCTNLGLGDTSRTPMLSGSPNPN 349

Query: 175 TSNKYLLPPPPKKSFWSKNTTK--SKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
            +  +        +  S          A A      K D +     N  +   K  Q   
Sbjct: 350 IAGWFAQWGGNSYTDNSGPHGFHKPMMAYADTGYTGKGDDIDSYMKNPGHDGGKIDQMTG 409

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
                   +     +  +       NL+     ++ L P     +  A++          
Sbjct: 410 TGCTADPMVGELNKLPDHDIYGNYLNLSAA-PAVSGLTPPVG--SAGALYKLGTLYSTST 466

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMK----------I 342
           + ++++   +        +  G    A+     +    I +      +           I
Sbjct: 467 QCNNSSYNPSAPDNACQ-MGLGSWQAAAHQAWKIWNQIIWDKATQTNIPDPATNKASPVI 525

Query: 343 YSVAVSAPPEG---QDLLRKCTDSS-----------GQFFAVNDSRELLESFDKITDKIQ 388
           +++   +         LL+   +             G+ +   D   +  +F +I  +I 
Sbjct: 526 FTIGFESTASDLPDMKLLQLIANDPSSPAPFSTRVQGKAYNAKDPNAVDAAFQQIRSEIL 585

Query: 389 EQ 390
             
Sbjct: 586 RL 587


>gi|86143679|ref|ZP_01062055.1| batA protein [Leeuwenhoekiella blandensis MED217]
 gi|85829722|gb|EAQ48184.1| batA protein [Leeuwenhoekiella blandensis MED217]
          Length = 334

 Score = 89.6 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 60/178 (33%), Gaps = 44/178 (24%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYN 290
           S RIG + Y         TP++++ + V S LN +         T     +  +   L  
Sbjct: 130 SDRIGLVEYAGESYTR--TPITSDKSIVLSSLNDIQYNSIIEGGTAIGMGLATSVNRL-- 185

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     S    K +I +TDG N+        +      E  +  G+K+Y++ +   
Sbjct: 186 --------KDSRAKSKVIILMTDGVNNAG-----FIEPSTASELAQEFGIKVYTIGLGTN 232

Query: 351 PE----------------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                                    + LL++  D + G +F   D+  L E + +I  
Sbjct: 233 GTALSPVALRPDGSFQYGSIPVEIDEALLQEIADKTGGLYFRATDNESLEEIYAEINK 290


>gi|148974876|ref|ZP_01811856.1| Flp pilus assembly protein TadG [Vibrionales bacterium SWAT-3]
 gi|145965385|gb|EDK30634.1| Flp pilus assembly protein TadG [Vibrionales bacterium SWAT-3]
          Length = 418

 Score = 89.6 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 46/440 (10%), Positives = 119/440 (27%), Gaps = 77/440 (17%)

Query: 8   VCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQ 67
           +  +F+ +++ ++  M    ++  A + A L+  AS       +D          +  + 
Sbjct: 1   MMVIFMAFSMQMSQQMLAHTRLLEAAEVASLALIASP-----REDEENNVKYARYLVDRY 55

Query: 68  IKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSA 127
           +  +          +    +   +  + +      ++  + A+Y                
Sbjct: 56  VVDNTDDVDVAVYTSICEYKDGCVQASGELAPFSDFVVRATAKYTSWIAY------EDVN 109

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND------NNNMTSNKYLL 181
           L      S   + R      + +  + D S SM + +                  +    
Sbjct: 110 LKPEFSVSGRAVTRKYLPQPVDVYFIGDFSGSMGNPWKNGKMKLDVVKETIKRVVDDIEE 169

Query: 182 PPPPKKSFWSKNTT-------KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI------ 228
               +KS  +            ++     A   R       +     NS    +      
Sbjct: 170 FNSEEKSRVALLGYNPLHVKQSNEIVRLNAYGYRASWRKKHAYDYARNSPATTVRRMFDE 229

Query: 229 -------QEKKNLSVRIGTIAYN------IGIVGNQCTPLSNNLNEVKSRLNK--LNPYE 273
                   E  +   R                      PL+ + +  +++L    L    
Sbjct: 230 PTLYNEIIEPSHGMSRYEVERLYKRNNDFDDYFKFYDIPLTEDYDNFRAQLMSAQLKAGG 289

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
            T+++  +  A +E             S   ++  I ++DG +     Y   L    +C+
Sbjct: 290 GTSSWNGIIAAAQEANKA--------TSLNPEQVFIVLSDG-SDSDKTYLQKLVDQGLCK 340

Query: 334 YMR-------------------NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSR 374
            +R                      + +  + ++   +  D    C       +   D  
Sbjct: 341 KLRSTISAKRNRFQSNAPTEAEKTKVTMGVIGINYRVQASDGFGDC-FGKKNIYHAKDGE 399

Query: 375 ELLESFDKITDKIQEQSVRI 394
              + +  I + I E++ ++
Sbjct: 400 ---DVYKYILNLINEETGKL 416


>gi|257469959|ref|ZP_05634051.1| hypothetical protein FulcA4_11506 [Fusobacterium ulcerans ATCC
           49185]
 gi|317064188|ref|ZP_07928673.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689864|gb|EFS26699.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
          Length = 319

 Score = 89.6 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 57/152 (37%), Gaps = 37/152 (24%)

Query: 254 PLSNNLNEVKS-----RLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
           PL+ + N +K       ++ +     T     +  A   L            S    K +
Sbjct: 137 PLTFDHNVIKEMTGKLTVDDITSNTRTAIGMGIGVALNRL----------KDSEAKSKVI 186

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE---------------- 352
           I +TDGEN+      +        +  +  G+KIY++ + A                   
Sbjct: 187 ILLTDGENNSGEMSPS-----AAADIAKELGIKIYTIGIGAKEIKVPSFFGYTTVKNTEL 241

Query: 353 GQDLLRKCT-DSSGQFFAVNDSRELLESFDKI 383
            +++L+     + G++F  +DS+E  E F+KI
Sbjct: 242 DENMLKSIAETTGGEYFRASDSKEFKEIFNKI 273


>gi|324006620|gb|EGB75839.1| von Willebrand factor type A domain protein [Escherichia coli MS
           57-2]
          Length = 580

 Score = 89.6 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPVKQVAQNPLATFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|281179360|dbj|BAI55690.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 580

 Score = 89.2 bits (219), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAASQIANPATARYQQFDDNPVKQVAQNPLATFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|297565073|ref|YP_003684045.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
 gi|296849522|gb|ADH62537.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
          Length = 308

 Score = 89.2 bits (219), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 78/220 (35%), Gaps = 32/220 (14%)

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
            +++        S    A      ++D    +A + V  +           V++G +++ 
Sbjct: 83  DEQAGVVLAIDVSGSMMADDLKPSRLDAAKAAARSFVERMPAG--------VKVGLVSFA 134

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
            G V    + L+ +   V  R++ L    NT     +  + +                 +
Sbjct: 135 AGAVLE--SGLTADHQGVIERIDLLERRANTAIGEGLLESLKAFPTGAN------HQVAV 186

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP---------EGQD 355
              VI ++DG N         +   +  +  +  G+++Y++ V +             + 
Sbjct: 187 PATVILLSDGRNRIG------IAPQEAAQEAKRRGVRVYTIGVGSDDPNASVDWAGFDEA 240

Query: 356 LLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
            LR   + + G++FA + +  L E + ++  +I  +  R 
Sbjct: 241 ELRGIAEVTGGRYFAADSADRLQEIYRELGSQIGWKLERT 280


>gi|16126967|ref|NP_421531.1| hypothetical protein CC_2734 [Caulobacter crescentus CB15]
 gi|221235756|ref|YP_002518193.1| hypothetical protein CCNA_02820 [Caulobacter crescentus NA1000]
 gi|13424325|gb|AAK24699.1| hypothetical protein CC_2734 [Caulobacter crescentus CB15]
 gi|220964929|gb|ACL96285.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 629

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/365 (10%), Positives = 84/365 (23%), Gaps = 41/365 (11%)

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
               +         +     ++     I+     N+P           +           
Sbjct: 268 VLTSMASLNGAIYTVTRLDSNVVYLNGIDTRLKSNSPSGGTIRKCLTSDCNLVVTTSAAH 327

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                  +S  + G +   +        +  +   +               TS       
Sbjct: 328 GFDTGDQISFANLGGLTTLNGQTYSITDLTSNTFDTGVPG-----LGTAAFTSGGTATCE 382

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
                   +    S +      A          A    ++         N          
Sbjct: 383 QSTTPGCRRLAYVSNWGTNEVRALSTCVSERTGADAYTDAAPSTAFVGTNYPSTSADSYS 442

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY-------NEKESSH 296
                  + TPLS++   +K+++N  +   +T     +   +  +               
Sbjct: 443 PNPCPSAKITPLSSDKTALKAQINNYSVGGSTAGQIGLAWGWYMVAPNFGYIWPSASQRP 502

Query: 297 NTIGSTRLKKFVIFITDGENSGA-------------------------SAYQNTLNTLQI 331
               S  L K VI +TDG  +                           +          +
Sbjct: 503 AAYKSKDLMKVVIMMTDGAFNTPYCNGVIAANAGIGSGSDEDHINCNATNGDPFAQARAL 562

Query: 332 CEYMRN--AGMKIYSVAV--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
           C  ++N    + +Y+V     +    +  L  C   S + F      EL  SF  I  +I
Sbjct: 563 CTVIKNSANDITLYTVGFAVGSDYTAKTFLTDCASDSSKAFFPATGSELKASFTAIAREI 622

Query: 388 QEQSV 392
               +
Sbjct: 623 SSLRI 627



 Score = 41.0 bits (94), Expect = 0.31,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 54/185 (29%), Gaps = 27/185 (14%)

Query: 17  IDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           +D++ +   R QMQ ALDAA L    S  +     D T                     +
Sbjct: 49  LDVSRLSLQRRQMQDALDAATLMAARSAATASADLDTT------------------GDAA 90

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST 136
           ++ E AG        + T       + I  + A  +    NL+  G             T
Sbjct: 91  FLAEIAGMNLGLTASSSTFSVGTGNRVIGTATATLKPIIANLWQAG---------DFTVT 141

Query: 137 GIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTK 196
              E    +  + + +VLD++ SM    +       +   +  +                
Sbjct: 142 ATSEVVRSSKNLEVALVLDITGSMSGTRIADLKVAASDLVDIVIRDTQTPFYSKVALVPY 201

Query: 197 SKYAP 201
           +    
Sbjct: 202 AAGVN 206


>gi|218690433|ref|YP_002398645.1| hypothetical protein ECED1_2737 [Escherichia coli ED1a]
 gi|218427997|emb|CAR08918.2| conserved hypothetical protein [Escherichia coli ED1a]
          Length = 580

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAASQIANPGTARYQQFDDNPIKQVAQNPLVTFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEVVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|315298071|gb|EFU57340.1| von Willebrand factor type A domain protein [Escherichia coli MS
           16-3]
          Length = 581

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/379 (10%), Positives = 108/379 (28%), Gaps = 48/379 (12%)

Query: 21  HIMYIRNQMQSALDAA-VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIR 79
                +  +Q  L  A   +  A   +       T +  Q      KQ+ ++      + 
Sbjct: 74  QQYSDKQTLQGRLQEAPTFARAAKANATHIANPGTARYQQFDDNPVKQVAQNPLVTFSLD 133

Query: 80  ENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGII 139
            + G  A   +         P     E    Y           +        S      +
Sbjct: 134 VDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFAM 188

Query: 140 ERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKY 199
                    +    L     +      +    +N+                         
Sbjct: 189 RYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI--------------------D 228

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 ++ ++ ++  S   LV  +++           I  + Y         +   ++ 
Sbjct: 229 TSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSHK 280

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            E+ + ++ L+   +TN    +  AY++                    ++  TDG+ +  
Sbjct: 281 AEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFIKGGINR--------ILLATDGDFNVG 332

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLE 378
               +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L E
Sbjct: 333 --IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LSE 387

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   +  ++++  + +A +
Sbjct: 388 AQKVLNSEMRQTLITVAKD 406


>gi|332227198|ref|XP_003262778.1| PREDICTED: vitrin isoform 2 [Nomascus leucogenys]
          Length = 679

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/323 (11%), Positives = 88/323 (27%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+ +    + +      P   + E+         N+F   +  +A   
Sbjct: 378 SFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENE 437

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +      V          +                  K    
Sbjct: 438 KQYVVEPNFANK-AVCRTNGFYSFHVQSWFGLHKTLQPL---VKRVCDTDRLACSKTCLN 493

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +         VL +   NL    + +  +      RIG + Y       
Sbjct: 494 SADIGFVIDGSSSVGTGNFRTVL-QFVTNLTKEFEISDTD-----TRIGAVQYTYEQRLE 547

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 ++  ++ + + ++      T+T  A++ A  +L+               +K +I
Sbjct: 548 FGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLF--------KKSKPNKRKLMI 599

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG         + +    +  +++     +++ A+      Q+ L            
Sbjct: 600 LITDGR------SYDDVRIPAMAAHLKG----VFTYAIGVAWAAQEELEVIATHPARDHS 649

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +   +I   I  +
Sbjct: 650 FFVDEFDNLYQYVPRIIQNICTE 672



 Score = 44.9 bits (104), Expect = 0.021,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 53/163 (32%), Gaps = 23/163 (14%)

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSH 296
           +G + Y      +       N  ++K+ + K+      +N   A+    +  +++     
Sbjct: 333 MGVVQYGDNPATHFNLKTHMNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANG-- 390

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                +     V+ + DG  +            +     R +G+ I+ + +    E +  
Sbjct: 391 ---NRSGAPNVVVVMVDGWPTD--------KVEEASRLARESGINIFFITIEGAAENEKQ 439

Query: 357 L--------RKCTDSSGQF-FAVNDSRELLESFDKITDKIQEQ 390
                    +    ++G + F V     L ++   +  ++ + 
Sbjct: 440 YVVEPNFANKAVCRTNGFYSFHVQSWFGLHKTLQPLVKRVCDT 482


>gi|332227202|ref|XP_003262780.1| PREDICTED: vitrin isoform 4 [Nomascus leucogenys]
          Length = 657

 Score = 89.2 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/323 (11%), Positives = 88/323 (27%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+ +    + +      P   + E+         N+F   +  +A   
Sbjct: 356 SFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENE 415

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +      V          +                  K    
Sbjct: 416 KQYVVEPNFANK-AVCRTNGFYSFHVQSWFGLHKTLQPL---VKRVCDTDRLACSKTCLN 471

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +         VL +   NL    + +  +      RIG + Y       
Sbjct: 472 SADIGFVIDGSSSVGTGNFRTVL-QFVTNLTKEFEISDTD-----TRIGAVQYTYEQRLE 525

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 ++  ++ + + ++      T+T  A++ A  +L+               +K +I
Sbjct: 526 FGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLF--------KKSKPNKRKLMI 577

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG         + +    +  +++     +++ A+      Q+ L            
Sbjct: 578 LITDGR------SYDDVRIPAMAAHLKG----VFTYAIGVAWAAQEELEVIATHPARDHS 627

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +   +I   I  +
Sbjct: 628 FFVDEFDNLYQYVPRIIQNICTE 650



 Score = 44.9 bits (104), Expect = 0.023,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 53/163 (32%), Gaps = 23/163 (14%)

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSH 296
           +G + Y      +       N  ++K+ + K+      +N   A+    +  +++     
Sbjct: 311 MGVVQYGDNPATHFNLKTHMNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANG-- 368

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                +     V+ + DG  +            +     R +G+ I+ + +    E +  
Sbjct: 369 ---NRSGAPNVVVVMVDGWPTD--------KVEEASRLARESGINIFFITIEGAAENEKQ 417

Query: 357 L--------RKCTDSSGQF-FAVNDSRELLESFDKITDKIQEQ 390
                    +    ++G + F V     L ++   +  ++ + 
Sbjct: 418 YVVEPNFANKAVCRTNGFYSFHVQSWFGLHKTLQPLVKRVCDT 460


>gi|126727880|ref|ZP_01743708.1| hypothetical protein RB2150_00467 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702821|gb|EBA01926.1| hypothetical protein RB2150_00467 [Rhodobacterales bacterium
           HTCC2150]
          Length = 576

 Score = 88.8 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 46/373 (12%), Positives = 92/373 (24%), Gaps = 77/373 (20%)

Query: 1   MTAIIISV---CFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKK 57
           MTA  I +          +ID       R QMQ  LD AVLS  + + +           
Sbjct: 39  MTAFGIFIVAIMVTSAGLSIDFMRQERTRVQMQQNLDTAVLSAASLLQTLG--------- 89

Query: 58  DQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN 117
                  +  +  ++ + +   +    +     IN             ++ A   + T  
Sbjct: 90  ------AEAVVTDYMSKANIDVDYNLSVNVSEGINF---------RAVDATATATLETLF 134

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           L   GL+      +++ S            + I +VLDVS SM       +         
Sbjct: 135 L---GLLNIDSLGITVTSGAEERI----PNLEISLVLDVSGSMGSNSRLTNLKTAATQFV 187

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI------------- 224
             ++      +        S            I +      +                  
Sbjct: 188 STIISGGSGGTVAMSIIPFSSSVTPSQSVIDAITMEDNHDYSTCIEFADDDFSSSSLDLD 247

Query: 225 -------------QKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
                             +  +                 +    S++   + +++  L  
Sbjct: 248 STYKRAVFTSRYSDTGSGDFDDADDFNQDWRSCYMDEYFELLAYSDDETVLYNKIQGLLA 307

Query: 272 YENTNTYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDG 314
             +T  +  M      L  E +                         T   K ++F++DG
Sbjct: 308 QGSTAGHTGMKWGTSLLDPEFQAVTNSMIAAGVVDAAHAGMPVAYSDTNTMKIIVFMSDG 367

Query: 315 ENSGASAYQNTLN 327
            N     + +   
Sbjct: 368 NNHTQRRFGSDYR 380



 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/254 (11%), Positives = 67/254 (26%), Gaps = 10/254 (3%)

Query: 145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP-KKSFWSKNTTKSKYAPAP 203
               +  +   V  +        ++D N M    ++       +  +  +          
Sbjct: 329 QAVTNSMIAAGVVDAAHAGMPVAYSDTNTMKIIVFMSDGNNHTQRRFGSDYRGDNSVVWK 388

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
           A     + V      + +     +            + +               + +   
Sbjct: 389 AEGGTGVWVEGSF--DRIYHRYSSWSSSNTGYEYACSWSNYYCTYTE---GFYADPDPYY 443

Query: 264 SRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF--ITD-GENSGAS 320
              N       T T+              E +   +     +  +     TD G  S  +
Sbjct: 444 FEKNGNYYGVATETWYNSMTGMTFENLSWEEAWGLMSIEYYESVMGSGAATDWGSTSART 503

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
             Q+       C   ++ G+ I+++A  AP   +  L  C  S   ++    +  +   F
Sbjct: 504 GSQSDTLMSANCTAAKDRGITIFTIAFEAPSNAETQLNNCATSDNHYYDAQGTS-ITSVF 562

Query: 381 DKITDKIQEQSVRI 394
             I   IQ+  + +
Sbjct: 563 SSIATTIQKLKLTL 576


>gi|226951529|ref|ZP_03821993.1| von Willebrand factor type A domain-containing protein
           [Acinetobacter sp. ATCC 27244]
 gi|226837721|gb|EEH70104.1| von Willebrand factor type A domain-containing protein
           [Acinetobacter sp. ATCC 27244]
          Length = 536

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/362 (9%), Positives = 89/362 (24%), Gaps = 35/362 (9%)

Query: 41  CASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL--KQGSYIRENAGDIAQKAQINITKDKN 98
                          +           +   +   +     E            +T    
Sbjct: 28  SIQTSDVIMPAPIAARSHIAHKAAYNAVMPTMERPRLEQDTEKYQKNEVNPVHRVTDQAV 87

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD--V 156
           +      +    Y      L    L P     +         +  +   +    V    V
Sbjct: 88  STFSIDVD-TGSYTNTRRFLNDGRLPPVDAVRIEEMINYFDYQYPQPNGVHPFSVTTETV 146

Query: 157 SRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
               ++                  LPP                      A  K+ ++ ++
Sbjct: 147 DSPWKENAKLIRIGIQAKDLALQQLPPANLVFLVD--------VSGSMSAADKLPLVKQT 198

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
              L   ++           ++  I Y  G              ++ + +N L     T 
Sbjct: 199 LRILTEQLRAQD--------KVTIITYASGEKLVLEPTSGEQKEKILAVINGLRAGGATA 250

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
              A+  AY++       +            ++  TDG+ +      +TL    +    R
Sbjct: 251 GEQAIQLAYKQAEKAFVKNGINR--------ILLATDGDFNVGITDFSTL--KGMVAEKR 300

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +G+ + ++        + L+ +  D+  G +  +++  E  +       ++      +A
Sbjct: 301 KSGISLTTLGFGTGNYNEQLMEQLADAGDGNYSYIDNKNEAKKVVQ---RQLSSTLATVA 357

Query: 396 PN 397
            +
Sbjct: 358 QD 359


>gi|16765642|ref|NP_461257.1| hypothetical protein STM2315 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167992650|ref|ZP_02573747.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197262795|ref|ZP_03162869.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|16420855|gb|AAL21216.1| putative von Willebrand factor, vWF type A domain protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|197241050|gb|EDY23670.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205329241|gb|EDZ16005.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247522|emb|CBG25349.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994407|gb|ACY89292.1| hypothetical protein STM14_2853 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158873|emb|CBW18386.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312913305|dbj|BAJ37279.1| hypothetical protein STMDT12_C23360 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222984|gb|EFX48055.1| hypothetical protein SEE_04302 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130645|gb|ADX18075.1| Putative von Willebrand factor, vWF type A domain protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|332989248|gb|AEF08231.1| hypothetical protein STMUK_2345 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 593

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/329 (9%), Positives = 89/329 (27%), Gaps = 28/329 (8%)

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
                       +     +++          +    Y      L    L P     +   
Sbjct: 111 NVMGTARYEHYDENPIKQVSQAPLATFSLDVD-TGSYANVRRFLNQGQLPPPEAVRVEEM 169

Query: 135 STGIIERSSENLAISICM----VLDVSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSF 189
                                  + +  +++        +                 +  
Sbjct: 170 LNYFPAPQPVADKQDNTKPIAACIPMPFAVKYELAPSPWNAQRTLLKVDVQARDMQTRDL 229

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
              N               ++ ++  +   LVN ++            I  + Y  G   
Sbjct: 230 PPANLVFLIDTSGSMQPAERLPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHV 281

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
              +   NN   +K+ ++ L+ Y +T     +  AY +                    ++
Sbjct: 282 ALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------IL 333

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFF 368
             TDG+ +      +  +   + +  R  G+ + ++ V      + ++ +  D  +G + 
Sbjct: 334 LTTDGDFNLG--ITDPKDIEALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYS 391

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAPN 397
            ++    L E+   + D++ +  V +A +
Sbjct: 392 YIDS---LSEAQKVLKDEMHQTLVTVAKD 417


>gi|86134839|ref|ZP_01053421.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
 gi|85821702|gb|EAQ42849.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
          Length = 336

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 65/192 (33%), Gaps = 42/192 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + +++K   +  +                   TP++++   VK  +N+L        T
Sbjct: 114 NRLEALKKVAVDFVDRRPNDRIGIVVYAGESFTQTPITSDKTIVKRTINRLQWGQLEGGT 173

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +              +    S    K +I +TDG N+  +     ++     E  
Sbjct: 174 AIGMGL----------GSRVNRLKDSKAKSKVIILLTDGVNNAGN-----IDPTTATELA 218

Query: 336 RNAGMKIYSVAVSAPP-----------------------EGQDLLRKCT-DSSGQFFAVN 371
           +  G+K+Y++ +                             +DLL+    ++ G++F   
Sbjct: 219 KELGIKVYTIGIGTNGMADFPWSKDPRTGMLNFRKQQVQIDEDLLKNIAEETQGKYFRAT 278

Query: 372 DSRELLESFDKI 383
           D+  L E +D+I
Sbjct: 279 DNTSLKEIYDEI 290


>gi|296108502|ref|YP_003620203.1| hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650404|gb|ADG26251.1| Hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 352

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 67/185 (36%), Gaps = 40/185 (21%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKE 293
           RIG I +         TPL+ + + V  R++        + T+   A+  A + L +   
Sbjct: 143 RIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDVPS 200

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                       + +I +TDG N+        L  L+  E  +  G+KIY++ + +  + 
Sbjct: 201 KG----------RVIILLTDGANNSGV-----LAPLKAAELAKQDGIKIYTIGLGSEADP 245

Query: 353 ----------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
                            +  L K    + G++F   D   L   +  I     ++++   
Sbjct: 246 RALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVKQEQAT 305

Query: 394 IAPNR 398
           + P +
Sbjct: 306 VRPQK 310


>gi|148361167|ref|YP_001252374.1| Von Willebrand factor type A (vWA) domain-containing protein
           [Legionella pneumophila str. Corby]
 gi|148282940|gb|ABQ57028.1| conserved hypothetical protein [Legionella pneumophila str. Corby]
          Length = 344

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 67/185 (36%), Gaps = 40/185 (21%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKE 293
           RIG I +         TPL+ + + V  R++        + T+   A+  A + L +   
Sbjct: 135 RIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDVPS 192

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                       + +I +TDG N+        L  L+  E  +  G+KIY++ + +  + 
Sbjct: 193 KG----------RVIILLTDGANNSGV-----LAPLKAAELAKQDGIKIYTIGLGSEADP 237

Query: 353 ----------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
                            +  L K    + G++F   D   L   +  I     ++++   
Sbjct: 238 RALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVKQEQAT 297

Query: 394 IAPNR 398
           + P +
Sbjct: 298 VRPQK 302


>gi|52843052|ref|YP_096851.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630163|gb|AAU28904.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 352

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 67/185 (36%), Gaps = 40/185 (21%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKE 293
           RIG I +         TPL+ + + V  R++        + T+   A+  A + L +   
Sbjct: 143 RIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDVPS 200

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                       + +I +TDG N+        L  L+  E  +  G+KIY++ + +  + 
Sbjct: 201 KG----------RVIILLTDGANNSGV-----LAPLKAAELAKQDGIKIYTIGLGSEADP 245

Query: 353 ----------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
                            +  L K    + G++F   D   L   +  I     ++++   
Sbjct: 246 RALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVKQEQAT 305

Query: 394 IAPNR 398
           + P +
Sbjct: 306 VRPQK 310


>gi|54295680|ref|YP_128095.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|53755512|emb|CAH17011.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|307611729|emb|CBX01432.1| hypothetical protein LPW_31221 [Legionella pneumophila 130b]
          Length = 344

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 67/185 (36%), Gaps = 40/185 (21%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKE 293
           RIG I +         TPL+ + + V  R++        + T+   A+  A + L +   
Sbjct: 135 RIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDVPS 192

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                       + +I +TDG N+        L  L+  E  +  G+KIY++ + +  + 
Sbjct: 193 KG----------RVIILLTDGANNSGV-----LAPLKAAELAKQDGIKIYTIGLGSEADP 237

Query: 353 ----------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
                            +  L K    + G++F   D   L   +  I     ++++   
Sbjct: 238 RALTGDFFAPTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVKQEQAT 297

Query: 394 IAPNR 398
           + P +
Sbjct: 298 VRPQK 302


>gi|168229682|ref|ZP_02654740.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468558|ref|ZP_03074542.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194454922|gb|EDX43761.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205335570|gb|EDZ22334.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 596

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/355 (9%), Positives = 94/355 (26%), Gaps = 29/355 (8%)

Query: 49  TIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
              +    + +T     K                    +     +++          +  
Sbjct: 89  ATAEAPQHEMRTRASASKAFAAQ-GGNVMGTARYEHYDENPIKQVSQAPLATFSLDVD-T 146

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM----VLDVSRSMEDLY 164
             Y      L    L P     +                          + +  +++   
Sbjct: 147 GSYANVRRFLNQGQLPPPEAVRVEEMLNYFPAPQPVADKQDNTKPIAACIPMPFAVKYEL 206

Query: 165 LQKHNDNNNMTS-NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                +                 +     N               ++ ++  +   LVN 
Sbjct: 207 APSPWNAQRTLLKVDVQARDMQTRDLPPANLVFLIDTSGSMQPAERLPLIRSALKLLVND 266

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
           ++            I  + Y  G      +   NN   +K+ ++ L+ Y +T     +  
Sbjct: 267 LRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRL 318

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           AY +                    ++  TDG+ +      +  +   + +  R  G+ + 
Sbjct: 319 AYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDIEALVKKEREKGITLS 368

Query: 344 SVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           ++ V      + ++ +  D  +G +  ++    L E+   + D++ +  V +A +
Sbjct: 369 TLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVLKDEMHQTLVTVAKD 420


>gi|238913524|ref|ZP_04657361.1| von Willebrand factor type A domain protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 596

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/355 (9%), Positives = 94/355 (26%), Gaps = 29/355 (8%)

Query: 49  TIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK 108
              +    + +T     K                    +     +++          +  
Sbjct: 89  ATAEAPQHEMRTRASASKAFAAQ-GGNVMGTARYEHYDENPIKQVSQAPLATFSLDVD-T 146

Query: 109 AQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICM----VLDVSRSMEDLY 164
             Y      L    L P     +                          + +  +++   
Sbjct: 147 GSYANVRRFLNQGQLPPPEAVRVEEMLNYFPAPQPVADKQDNTKPIAACIPMPFAVKYEL 206

Query: 165 LQKHNDNNNMTS-NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                +                 +     N               ++ ++  +   LVN 
Sbjct: 207 APSPWNAQRTLLKVDVQARDMQTRDLPPANLVFLIDTSGSMQPAERLPLIRSALKLLVND 266

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
           ++            I  + Y  G      +   NN   +K+ ++ L+ Y +T     +  
Sbjct: 267 LRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRL 318

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           AY +                    ++  TDG+ +      +  +   + +  R  G+ + 
Sbjct: 319 AYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDIEALVKKEREKGITLS 368

Query: 344 SVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           ++ V      + ++ +  D  +G +  ++    L E+   + D++ +  V +A +
Sbjct: 369 TLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVLKDEMHQTLVTVAKD 420


>gi|331647928|ref|ZP_08349020.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli M605]
 gi|330912098|gb|EGH40608.1| hypothetical protein ECAA86_02478 [Escherichia coli AA86]
 gi|331043652|gb|EGI15790.1| putative von Willebrand factor, vWF type A domain protein
           [Escherichia coli M605]
          Length = 580

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/380 (9%), Positives = 107/380 (28%), Gaps = 49/380 (12%)

Query: 21  HIMYIRNQMQSALDAAVL--SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYI 78
                +  +   L AA           + +     T +  Q      KQ+ ++      +
Sbjct: 72  QQYSDKQALLGRLQAAPKYQHAAREKAAYQIANPGTARYQQFDDNPVKQVAQNPLATFSL 131

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
             + G  A   +         P     E    Y           +        S      
Sbjct: 132 DVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDW-----DIKDKQSIPASKPIPFA 186

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
           +         +    L     +      +    +N+                        
Sbjct: 187 MRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLI-------------------- 226

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                  ++ ++ ++  S   LV  +++           I  + Y         +   ++
Sbjct: 227 DTSGSMISDERLPLIQSSLKLLVKELREQDN--------IAIVTYAGDSRIALPSISGSH 278

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
             E+ + ++ L+   +TN    +  AY++                    ++  TDG+ + 
Sbjct: 279 KAEINAAIDSLDAEGSTNGGAGLEMAYQQAAKGFVKGGVNR--------ILLATDGDFNV 330

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELL 377
                +  +   + +  R +G+ + ++ V      + ++ +  D  +G +  ++    L 
Sbjct: 331 G--IDDPKSIESMVKKQRESGVTLSTLGVGDSNYNEAMMVRIADVGNGNYSYIDT---LS 385

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           E+   +  ++++  + +A +
Sbjct: 386 EAQKVLNSEMRQTLITVAKD 405


>gi|54298847|ref|YP_125216.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
 gi|53752632|emb|CAH14067.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
          Length = 344

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 67/185 (36%), Gaps = 40/185 (21%)

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKE 293
           RIG I +         TPL+ + + V  R++        + T+   A+  A + L +   
Sbjct: 135 RIGLILFGTRAYLQ--TPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDVPS 192

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE- 352
                       + +I +TDG N+        L  L+  E  +  G+KIY++ + +  + 
Sbjct: 193 KG----------RVIILLTDGANNSGV-----LAPLKAAELAKQDGIKIYTIGLGSEADP 237

Query: 353 ----------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD--KIQEQSVR 393
                            +  L +    + G++F   D   L   +  I     ++++   
Sbjct: 238 RALTGDFFAPTLSAELDEKTLEEMAKMTGGRYFRATDPESLQSIYQTINQLETVKQEQAT 297

Query: 394 IAPNR 398
           + P +
Sbjct: 298 VRPQK 302


>gi|307943468|ref|ZP_07658812.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773098|gb|EFO32315.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 479

 Score = 88.4 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 44/338 (13%), Positives = 97/338 (28%), Gaps = 50/338 (14%)

Query: 14  TYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
              IDL   +  R++M +ALDA+ L     +             D+     +K    +L 
Sbjct: 22  GSGIDLTSALNARSKMANALDASALKLAGKLSV------AKLSDDEIQAGLEKMFTANLS 75

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
           +         ++       +   K      I +  +   + T  + L GL      ++ +
Sbjct: 76  RFDLKASALSELE----FEVDWTKG-----ILDVWSDVSVKTHFIGLGGL-GPEKLDVGV 125

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN--MTSNKYLLPPPPKKSFWS 191
            S      S  + A+ + +VLDV+ SM+         +                ++   S
Sbjct: 126 TS----RVSFASQALELALVLDVTGSMDGDISSLKEASQLLFEALVPENAGRHDQRIRVS 181

Query: 192 KNTTKSKYAPAPAPA--NRKIDVLIESA------GNLVNSIQKAIQEKKNLSVRIGTIAY 243
                              +                  ++       + N  V  G + Y
Sbjct: 182 IVPYSQGVNLGAKAWKVTNRQSDSSNCVATRGGPNAFTDAYYNYRGARSNFFVAPGALDY 241

Query: 244 N--------------IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
                               ++  PL+N+   + + ++ L     T     +   ++ L 
Sbjct: 242 FVIRRGSNVSWYPPRNNCPESEILPLTNSRKTLLAAVDALEAQGGTAGQAGIAWGWKALS 301

Query: 290 NEKESSHNTIG------STRLKKFVIFITDGENSGASA 321
                   +        S+++ K  + +TDG+ +    
Sbjct: 302 WTWHPFWPSGSDPAKSFSSQVGKAAVIMTDGDFNVHYT 339


>gi|332227200|ref|XP_003262779.1| PREDICTED: vitrin isoform 3 [Nomascus leucogenys]
          Length = 658

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/323 (11%), Positives = 88/323 (27%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+ +    + +      P   + E+         N+F   +  +A   
Sbjct: 357 SFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENE 416

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +      V          +                  K    
Sbjct: 417 KQYVVEPNFANK-AVCRTNGFYSFHVQSWFGLHKTLQPL---VKRVCDTDRLACSKTCLN 472

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +         VL +   NL    + +  +      RIG + Y       
Sbjct: 473 SADIGFVIDGSSSVGTGNFRTVL-QFVTNLTKEFEISDTD-----TRIGAVQYTYEQRLE 526

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 ++  ++ + + ++      T+T  A++ A  +L+               +K +I
Sbjct: 527 FGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLF--------KKSKPNKRKLMI 578

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQF 367
            ITDG         + +    +  +++     +++ A+      Q+ L            
Sbjct: 579 LITDGR------SYDDVRIPAMAAHLKG----VFTYAIGVAWAAQEELEVIATHPARDHS 628

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +   +I   I  +
Sbjct: 629 FFVDEFDNLYQYVPRIIQNICTE 651



 Score = 44.5 bits (103), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 53/163 (32%), Gaps = 23/163 (14%)

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSH 296
           +G + Y      +       N  ++K+ + K+      +N   A+    +  +++     
Sbjct: 312 MGVVQYGDNPATHFNLKTHMNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANG-- 369

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                +     V+ + DG  +            +     R +G+ I+ + +    E +  
Sbjct: 370 ---NRSGAPNVVVVMVDGWPTD--------KVEEASRLARESGINIFFITIEGAAENEKQ 418

Query: 357 L--------RKCTDSSGQF-FAVNDSRELLESFDKITDKIQEQ 390
                    +    ++G + F V     L ++   +  ++ + 
Sbjct: 419 YVVEPNFANKAVCRTNGFYSFHVQSWFGLHKTLQPLVKRVCDT 461


>gi|62180885|ref|YP_217302.1| von Willebrand factor type A domain-containing protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|62128518|gb|AAX66221.1| putative von Willebrand factor, vWF type A domain [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322715363|gb|EFZ06934.1| von Willebrand factor type A domain-containing protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 593

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/329 (9%), Positives = 89/329 (27%), Gaps = 28/329 (8%)

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
                       +     +++          +    Y      L    L P     +   
Sbjct: 111 NVMGTARYEHYDENPIKQVSQAPLATFSLDVD-TGSYANVRRFLNQGQLPPPEAVRVEEM 169

Query: 135 STGIIERSSENLAISICM----VLDVSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSF 189
                                  + +  +++        +                 +  
Sbjct: 170 LNYFPAPQPVADKQDNTKPIAACIPMPFAVKYELAPSPWNAQRTLLKVDVQARDMQTRDL 229

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
              N               ++ ++  +   LVN ++            I  + Y  G   
Sbjct: 230 PPANLVFLIDTSGSMQPAERLPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHV 281

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
              +   NN   +K+ ++ L+ Y +T     +  AY +                    ++
Sbjct: 282 ALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRLAYEQAEKGFIKGGANR--------IL 333

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFF 368
             TDG+ +      +  +   + +  R  G+ + ++ V      + ++ +  D  +G + 
Sbjct: 334 LTTDGDFNLG--ITDPKDIEALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYS 391

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAPN 397
            ++    L E+   + D++ +  V +A +
Sbjct: 392 YIDS---LSEAQKVLKDEMHQTLVTVAKD 417


>gi|118468162|ref|YP_887464.1| hypothetical protein MSMEG_3149 [Mycobacterium smegmatis str. MC2
           155]
 gi|118169449|gb|ABK70345.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 327

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 55/152 (36%), Gaps = 16/152 (10%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + N    K+ L+KL   + T T   +  A + +      +    G       ++ ++DG+
Sbjct: 147 TTNREATKNGLDKLQLADRTATGEGIFTALQAIATV--GAVIGGGDEPPPARIVLMSDGK 204

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PEGQDLLRKCTD 362
            +  S   N           ++ G+ I +V+   P             P   ++L K   
Sbjct: 205 ETVPSNPDNPKGAFTAARTAKDQGVPISTVSFGTPYGYVEINDQRQPVPVDDEMLEKIAQ 264

Query: 363 -SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            S G  F  +   +L   F  +  +I  ++++
Sbjct: 265 LSGGDAFTASSLEQLKAVFTSLQQQIGYETIK 296


>gi|258654082|ref|YP_003203238.1| von Willebrand factor type A [Nakamurella multipartita DSM 44233]
 gi|258557307|gb|ACV80249.1| von Willebrand factor type A [Nakamurella multipartita DSM 44233]
          Length = 618

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/403 (10%), Positives = 111/403 (27%), Gaps = 30/403 (7%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQS---ALDAAVLSGCAS----IVSDRTIKDPTT 55
           A  I         + DL      R ++Q     ++ AV+    +    + + +   D   
Sbjct: 226 AATIGTLVAATGTSSDLTEAALQRPEVQQYLKDVETAVIHYGDTTLTYLTNLQHADDSGA 285

Query: 56  KKDQTSTIF--KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAES------ 107
                S +   +K +  +                  ++ +           ++S      
Sbjct: 286 ALGYVSAVAVEEKSVLDYNAGNPSGNPATLGDHAPPKVPLVAVYPKEGTLYSDSPFVILD 345

Query: 108 ----KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDL 163
                A  +   ++     L+P      +  +    +        S   ++    ++   
Sbjct: 346 APWSTADKQAGAQDFMEFLLLPEQQKVFTEANFRTADHQPGEPITSSPYLIADGVTIALN 405

Query: 164 YLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
                   +       +    P +     + + S  + +   +  K+D+  ++A + +  
Sbjct: 406 PPGPSVLRDVRALWTQVR--KPARVLVVMDVSGSMASESGYGSESKLDLAKKAATSALGQ 463

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
           +    Q               I        PL+     +   ++ L P   T  Y A   
Sbjct: 464 LTDTDQMGLWAFTTDLPTPDTITADLVGVGPLAQTRQPIIDAISSLTPLNGTPLYAATRE 523

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           A + +  +K+              V+ +TDG N       + L            G++++
Sbjct: 524 AAKAMNAQKDP--------NSINAVVVLTDGRNEYTDNDLDGLLRELNA-SAEEDGVRVF 574

Query: 344 SVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDK 386
           ++A     +   L      S    +   +   + + F  +   
Sbjct: 575 TIAYGPDADLATLQEISEASRAAAYDARNPTSIDKVFSDVLSN 617


>gi|163754426|ref|ZP_02161548.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
 gi|161325367|gb|EDP96694.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
          Length = 335

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 54/165 (32%), Gaps = 43/165 (26%)

Query: 249 GNQCTPLSNNLNEVKSRLNKLNP-----YENTNTYPAMHHAYRELYNEKESSHNTIGSTR 303
               TP++ + + +++ L  +          T     +  A   L            S  
Sbjct: 142 SFTKTPITTDKSIIQNALKDIKYKHGELIGGTAIGMGLATAVNRL----------KDSKA 191

Query: 304 LKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP------------ 351
             K +I +TDG N+        +      E     G+K Y++ +                
Sbjct: 192 KSKVIILLTDGVNNAG-----FIEPQIASELAVEYGIKTYTIGIGTNGMASTPVALNPDG 246

Query: 352 ----------EGQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD 385
                       + LL++    + G++F   ++++L E +D+I  
Sbjct: 247 TILFRNMQVEIDEKLLQQIAKTTGGKYFRATNTKKLAEIYDEINK 291


>gi|222082657|ref|YP_002542022.1| hypothetical protein Arad_9368 [Agrobacterium radiobacter K84]
 gi|221727336|gb|ACM30425.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 405

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 52/349 (14%), Positives = 104/349 (29%), Gaps = 42/349 (12%)

Query: 7   SVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKK 66
               L +  + D      +R  MQS LDAA+++       +    D    K + S  F  
Sbjct: 1   MPMLLAVGASFDYIRAYNVRQSMQSDLDAALIAAVK----NVDAGDTDALKQKVSDWFHA 56

Query: 67  QIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPS 126
           Q +     G                     + +   +   + A   +PT       L+  
Sbjct: 57  QTESSYSLGD-------------------IEIDTTNHRITATASGTVPTT------LMKL 91

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
           A  N    S     +   +  +++ +V+D S SM                          
Sbjct: 92  ANINTVPVSVASAVKGPASSYLNVYIVIDKSPSMLLAATTAGQQAMYNGIGCQFACHTGD 151

Query: 187 KSFWSKNTTKSKYAPAP-APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
                  T  + YA +       + DV +++   +++ I  +         RI    Y++
Sbjct: 152 SHTIGTATYSNNYAYSTEKKIKLRADVAVDAVHEVIDMISASDTNH----ERIKVGLYSL 207

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
           G    +    + +      R++       + TY     +   L N+  +  +   S    
Sbjct: 208 GDTITEVLAPTLDTTAAGKRVDSDLTSATSTTYTYFDVSLAALKNKVGTGGDGSSSATPL 267

Query: 306 KFVIFITDGENSGASAYQNTLNTL--------QICEYMRNAGMKIYSVA 346
           K V+ +TDG  S      +               C+Y++     +  + 
Sbjct: 268 KLVLLLTDGVQSQREWVTSGAKYQPKVAPLNPAWCDYIKKQSATMAVLY 316


>gi|319783082|ref|YP_004142558.1| von Willebrand factor type A [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168970|gb|ADV12508.1| von Willebrand factor type A [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 704

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/382 (12%), Positives = 96/382 (25%), Gaps = 40/382 (10%)

Query: 30  QSALDAAVLS--------------GCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQG 75
           Q+AL+  VL+              G  S  S    + P   K              ++  
Sbjct: 168 QNALERGVLAEPAPPAPTGEFALDGAVSAPSTSRARMPAESKLMAPQQPSTLPADQMQPQ 227

Query: 76  SYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
              R+   D          +D  +      +  A Y     +L    L       +    
Sbjct: 228 PENRDRIEDFKTNPVHAALEDPVSTFSIDVD-TASYSFVRSSLKQGTLPQVDTVRVEEMI 286

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
                      + S      VS             +  +          PK +       
Sbjct: 287 NYFPYDWKGPESASTPFNSTVSVMPTPWNTHTRLMHVAIKGFDVKPTEQPKANLV----- 341

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                        K+ +L  +   LV+ ++            I  + Y            
Sbjct: 342 FLIDVSGSMDEPDKLPLLKSAFRLLVSKLKADDT--------ISIVTYAGDAGTVLEPTK 393

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           ++  +++ S ++ L P  +T     +  AYR                     V+  TDG+
Sbjct: 394 ASQKDKILSAIDNLTPGGSTAGEAGIKEAYRLAQKSFVKDGVNR--------VMLATDGD 445

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRE 375
            +   +  +  +  ++ E  R  G+ +             +++    +            
Sbjct: 446 FNVGQSDDD--DLKRLIEKERKTGVFLSVFGFGRGNLNDQMMQTIAQNGNG--TAAYIDT 501

Query: 376 LLESFDKITDKIQEQSVRIAPN 397
           L E+   + +        IA +
Sbjct: 502 LAEAEKVLVEDASSTLFTIAKD 523


>gi|161612960|ref|YP_001586925.1| hypothetical protein SPAB_00666 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161362324|gb|ABX66092.1| hypothetical protein SPAB_00666 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 593

 Score = 88.0 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/329 (9%), Positives = 89/329 (27%), Gaps = 28/329 (8%)

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
                       +     +++          +    Y      L    L P     +   
Sbjct: 111 NVMGTARYEHYDENPIKQVSQAPLATFSLDVD-TGSYANVRRFLNQGQLPPPEAVRVEEM 169

Query: 135 STGIIERSSENLAISICM----VLDVSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSF 189
                                  + +  +++        +                 +  
Sbjct: 170 LNYFPAPQPVADKQDNTKPIAACIPMPFAVKYELAPSPWNAQRTLLKVDVQARDMQTRDL 229

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
              N               ++ ++  +   LVN ++            I  + Y  G   
Sbjct: 230 PPANLVFLIDTSGSMQPAERLPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHV 281

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
              +   NN   +K+ ++ L+ Y +T     +  AY +                    ++
Sbjct: 282 ALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------IL 333

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFF 368
             TDG+ +      +  +   + +  R  G+ + ++ V      + ++ +  D  +G + 
Sbjct: 334 LTTDGDFNLG--ITDPKDIEALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYS 391

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAPN 397
            ++    L E+   + D++ +  V +A +
Sbjct: 392 YIDS---LSEAQKVLKDEMHQTLVTVAKD 417


>gi|168465984|ref|ZP_02699854.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631159|gb|EDX49719.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 593

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 71/190 (37%), Gaps = 22/190 (11%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ 
Sbjct: 249 RLPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDN 300

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L+ Y +T     +  AY +                    ++  TDG+ +      +  + 
Sbjct: 301 LDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDI 350

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
             + +  R  G+ + ++ V      + ++ +  D  +G +  ++    L E+   + D++
Sbjct: 351 EALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVLKDEM 407

Query: 388 QEQSVRIAPN 397
            +  V +A +
Sbjct: 408 HQTLVTVAKD 417


>gi|170727657|ref|YP_001761683.1| von Willebrand factor type A [Shewanella woodyi ATCC 51908]
 gi|169813004|gb|ACA87588.1| von Willebrand factor type A [Shewanella woodyi ATCC 51908]
          Length = 640

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 65/199 (32%), Gaps = 22/199 (11%)

Query: 200 APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNL 259
                 +  K+ +L  +   L   + +          RI  + Y             N+ 
Sbjct: 260 VSGSMSSQDKLPLLKNALKMLSQQLDEGD--------RISIVVYAGASGVVLDGVKGNDT 311

Query: 260 NEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
             +   L+KL    +TN    +  AY+       +             VI  TDG+ +  
Sbjct: 312 LAISQALDKLKAGGSTNGGAGIELAYQLAQKHFIAGGVNR--------VILATDGDFNVG 363

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLE 378
            + Q  L    + E  R  G+ + ++          L+ +  D   G +  ++    L E
Sbjct: 364 VSDQQAL--EDMIEEKRKQGIALTTLGFGQGNYNDHLMEQLADKGNGHYAYIDT---LNE 418

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   + D+I    + IA +
Sbjct: 419 ARKVLVDEISATLLTIAKD 437


>gi|307943460|ref|ZP_07658804.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773090|gb|EFO32307.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 320

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/244 (11%), Positives = 62/244 (25%), Gaps = 62/244 (25%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLS-------NNLNE 261
           +                       N   ++  + Y            +       NNL  
Sbjct: 77  RFLGAKHCIEYKPEDFDLNDI-PLNSRAQLPHLYYWRKTNPWCPENFASRMYLNRNNLGG 135

Query: 262 VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-----------HNTIGSTRLKKFVIF 310
           +K+ +++L   + T     +    + L  +  ++                  + +K ++ 
Sbjct: 136 LKAAVDRLTLSDGTGMDIGLLWEAKALSPKLRTAAALDGGLLPGHPTDWSDKQTQKVIVL 195

Query: 311 ITDG----------------------------------------ENSGASAYQNTLNTLQ 330
           +TDG                                         +   S + +      
Sbjct: 196 MTDGGITAQYRPKDPWKGLNPKDMRRGIVNARRNVQYVTTRGNMNSPANSKHNSVAYMKT 255

Query: 331 ICEYMRNAGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
           +C+  +  G+ IY+V             L  C  S   ++ V    +L  +F  I   I+
Sbjct: 256 MCDQAKAKGIIIYTVGFQIRRNTLPDLSLSYCATSPSHYYFVES-SDLSAAFKAIASSIK 314

Query: 389 EQSV 392
              +
Sbjct: 315 SLRI 318


>gi|198245970|ref|YP_002216383.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197940486|gb|ACH77819.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624134|gb|EGE30479.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 593

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/329 (9%), Positives = 89/329 (27%), Gaps = 28/329 (8%)

Query: 75  GSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLR 134
                       +     +++          +    Y      L    L P     +   
Sbjct: 111 NVMGTARYEHYDENPIKQVSRAPLATFSLDVD-TGSYANVRRFLNQGQLPPPEAVRVEEM 169

Query: 135 STGIIERSSENLAISICM----VLDVSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSF 189
                                  + +  +++        +                 +  
Sbjct: 170 LNYFPAPQPVADKQDNTKPIAACIPMPFAVKYELAPSPWNAQRTLLKVDVQARDMQTRDL 229

Query: 190 WSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVG 249
              N               ++ ++  +   LVN ++            I  + Y  G   
Sbjct: 230 PPANLVFLIDTSGSMQPAERLPLIRSALKLLVNDLRAQDN--------ITIVTYAGGTHV 281

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
              +   NN   +K+ ++ L+ Y +T     +  AY +                    ++
Sbjct: 282 ALASTAGNNTTAIKAAIDNLDTYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------IL 333

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFF 368
             TDG+ +      +  +   + +  R  G+ + ++ V      + ++ +  D  +G + 
Sbjct: 334 LTTDGDFNLG--ITDPKDIEALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYS 391

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAPN 397
            ++    L E+   + D++ +  V +A +
Sbjct: 392 YIDS---LSEAQKVLKDEMHQTLVTVAKD 417


>gi|307720603|ref|YP_003891743.1| von Willebrand factor A [Sulfurimonas autotrophica DSM 16294]
 gi|306978696|gb|ADN08731.1| von Willebrand factor type A [Sulfurimonas autotrophica DSM 16294]
          Length = 310

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 74/189 (39%), Gaps = 20/189 (10%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL 269
            D +  +A    + ++  +++  +            G      +PL+ + + +   +++L
Sbjct: 101 FDPVNPAASRF-DVVKSIVKDFISQRTNDNMGLVVFGSYSFIASPLTYDKHILSRIVSQL 159

Query: 270 ---NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
                 + T  Y A+      L            S    K  I +TDG ++      + +
Sbjct: 160 EVGMAGKYTALYEALAQGVNLL----------KMSKAKSKVAILLTDGYSTAG---ADKI 206

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPP--EGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
               + +  +  G+K+Y + +  P       LL+   ++ G  F  +++ +L E + KI 
Sbjct: 207 PLDVVLDMAKKEGVKVYPIGIGGPDEYNRAVLLKIAKETGGVAFGASNASQLKEVYKKI- 265

Query: 385 DKIQEQSVR 393
           D++++  ++
Sbjct: 266 DELEKSEIK 274


>gi|88798929|ref|ZP_01114511.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
 gi|88778409|gb|EAR09602.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
          Length = 322

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 56/150 (37%), Gaps = 33/150 (22%)

Query: 254 PLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           PL+ +LN ++S L  L P      T     +  A R+L            ST   + V+ 
Sbjct: 144 PLTPDLNAIQSLLADLRPGMADSRTAIGDGLALAVRQL----------RESTTEDRVVVL 193

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG--------------QDL 356
           ++DGEN+      +    +   E      +++Y++   +                  +  
Sbjct: 194 LSDGENNSGEIRPDEATAVAAAE-----NIRVYTIGFGSAGRDSLLQSFGLRSSSLDEQT 248

Query: 357 LRKCTD-SSGQFFAVNDSRELLESFDKITD 385
           LR+  + + G+++    S EL E F  I  
Sbjct: 249 LREIAEQTQGRYYRATSSAELAEVFRDIER 278


>gi|300120207|emb|CBK19761.2| unnamed protein product [Blastocystis hominis]
          Length = 474

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 80/256 (31%), Gaps = 34/256 (13%)

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ 225
              N  +   +N     P     F         Y             +++    L++S  
Sbjct: 67  WNGNRFDWWGTNGSSYFPQEGGGFGEDGNYGCYYNYTHYNNTGICQGVMDVV-FLIDSSS 125

Query: 226 KAIQEKKN---LSVRIGTIAYNIGIVGNQCT------------PLSNNLNEVKSRLNKLN 270
               E        V+     Y +       +             L+ +  +V+  ++   
Sbjct: 126 SITDENYRKEIDFVKSILDYYYLHPNYTLVSILEFSTDVRVLQELTYDACDVRKAIDSDR 185

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS-------GASAYQ 323
               TN   A+  A+R L N +    +          ++ ITDG  +           + 
Sbjct: 186 MSGLTNIAKAIEEAHRILKNSRSDIPDQ---------IVLITDGFQTVHSSINCNDHPHD 236

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFA-VNDSRELLESFD 381
                ++     +   ++IY++ V A    +D LR+   S   Q+F+ V+D   +    +
Sbjct: 237 CNAYAIEKARAAKADDIQIYTIGVGAASYYEDDLRQIASSPSDQYFSLVDDYSSIQTVRE 296

Query: 382 KITDKIQEQSVRIAPN 397
           K+ +       +I P+
Sbjct: 297 KLQNSTCPLVTQILPD 312


>gi|88801581|ref|ZP_01117109.1| batA protein [Polaribacter irgensii 23-P]
 gi|88782239|gb|EAR13416.1| batA protein [Polaribacter irgensii 23-P]
          Length = 334

 Score = 87.7 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 71/201 (35%), Gaps = 43/201 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENT 275
           N + +++K   +  +                   TP++++ N VK  +++L        T
Sbjct: 112 NRLEALKKVAIDFVDRRPNDRIGIVVYAGESFTQTPITSDKNIVKRTISELQWGQLDGGT 171

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +      L            ST   K +I +TDG N+  +     ++     E  
Sbjct: 172 AIGMGLGSGVNRL----------KESTAKSKVIILLTDGVNNAGN-----IDPRTATELA 216

Query: 336 RNAGMKIYSVAVSAPP-----------------------EGQDLLRKCTD-SSGQFFAVN 371
           R   +K+Y++ +                             + LL++    + G++F   
Sbjct: 217 RELEIKVYTIGIGTNGMADFPWSKDPRTGKLNFRKQQVEIDEKLLQEIATATDGKYFRAT 276

Query: 372 DSRELLESFDKITDKIQEQSV 392
           D++ L E +D+I D +++  +
Sbjct: 277 DNQSLKEIYDEI-DALEKTKI 296


>gi|262193845|ref|YP_003265054.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
 gi|262077192|gb|ACY13161.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
          Length = 346

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/218 (14%), Positives = 68/218 (31%), Gaps = 52/218 (23%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++V+ +     V     A ++  +          +     +   PL+ N   + + L+
Sbjct: 116 TRLEVVKDVFRAFV-----AGEDGLDGRSNDTIGLVSFAGFADTRCPLTLNHGSLLTILD 170

Query: 268 KL-----NPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
            L        + T     +  A   L            S    + +I +TDG N+     
Sbjct: 171 DLEIVRERAEDGTAIGDGLGLAVERL----------RESEASSRVIILLTDGVNNAGI-- 218

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPE----------------------GQDLLRKC 360
                 L+  E     G+K+Y++                              +  L   
Sbjct: 219 ---ETPLEAAELASRLGIKVYTIGAGTDGVAPVRVTNPLTGAEELRPMPVEIDEATLEAI 275

Query: 361 TD-SSGQFFAVNDSRELLESFDKITD----KIQEQSVR 393
            + + G++F   D   L + +++I      +I E+ +R
Sbjct: 276 AEHTGGRYFRATDGDGLRQVYEQIDRLERTEISERRLR 313


>gi|218528924|ref|YP_002419740.1| hypothetical protein Mchl_0894 [Methylobacterium chloromethanicum
           CM4]
 gi|218521227|gb|ACK81812.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 477

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/461 (13%), Positives = 135/461 (29%), Gaps = 90/461 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +      +   +D    +  + ++ +A DAA L+G  +   +    +       T
Sbjct: 29  LFALAVLPTIGLVGLGVDYGMAISSKTRLDNAADAAALAGVVT-AKEFIAANAQQSDVMT 87

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + I   + +          +        +Q+ I +          ++   Y    ++   
Sbjct: 88  AGIKAGEYQALKAFNVNASKVPFATVSLSQLEIVRS-----GQTLDATVSYTATVQST-F 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L   ++T L+ R     + +     +   +++DVS SM         D++        
Sbjct: 142 GRLFGLSVTTLTNRVNASADIA---GYLDFYLMVDVSGSMGLPTT----DSDAALLASKS 194

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           +       F      +  +  A      + D +  +   L++   K I        RIG 
Sbjct: 195 VEDQGNCQFACHFPNRKGWNLAAGKIQLRSDAVNNAVCALLDRASKPIV---PNQYRIGI 251

Query: 241 IAYNIG-IVGNQCTPLSNNLNEVKSRLN----------KLNPYENT-------------N 276
             +          +  + +L  +K+  +           L    +T             +
Sbjct: 252 YPFINRLATLAPLSDTTTSLASLKTTADCGKAWPLAFTNLLDTGSTQLFTNNDPTTGTGS 311

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA--------------- 321
                  A  ++ +   +  N   S   K FV  ITDG  +  +                
Sbjct: 312 GGTHFETALPQMKSTIRTFGNGSSSANPKPFVFLITDGMQNSQTYSSWKDKKTYPGNPSK 371

Query: 322 -------YQNTLNTLQI----CEYMRNAGMKIYSVAV----------------------S 348
                    +     QI    C  ++ AG  I  + +                       
Sbjct: 372 FAGYRYADWDGSQPAQIDPAKCADLKKAGATISILYIPYNYVKSYTNEGTIVWENNRVNG 431

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
             P   D LR+C    G FF  N ++++  S   + D+  +
Sbjct: 432 FSPTLADPLRQCAS-PGLFFTANSAKDITASLGAMFDQALK 471


>gi|163786711|ref|ZP_02181159.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
 gi|159878571|gb|EDP72627.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
          Length = 335

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 67/201 (33%), Gaps = 42/201 (20%)

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
           +  +   N + +++K   +                      TP++++ + V   +  +  
Sbjct: 106 LAKDLLPNRLEALKKVAADFIEGRPNDRIGLVEYAGEAYTKTPITSDKSIVLRSMRDIKY 165

Query: 272 Y----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
                  T     +  +   L            S    K +I +TDG N+G       ++
Sbjct: 166 NTIIEGGTAIGMGLATSVNRL----------KDSRAKSKVIILLTDGVNNGG-----FID 210

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPE----------------------GQDLLRKCTD-SS 364
                E     G+K+Y++ +                            +DLL++  D + 
Sbjct: 211 PKIASELAVEYGIKVYTIGLGTNGTALSPVRINPNGSFQYGRQKVEIDEDLLKEIADVTG 270

Query: 365 GQFFAVNDSRELLESFDKITD 385
           G++F   ++++L + +D+I  
Sbjct: 271 GKYFRATNNKKLAQIYDEINK 291


>gi|260592520|ref|ZP_05857978.1| BatA protein [Prevotella veroralis F0319]
 gi|260535566|gb|EEX18183.1| BatA protein [Prevotella veroralis F0319]
          Length = 318

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 63/191 (32%), Gaps = 31/191 (16%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY------ 272
           N +   ++   +  +                    P++ +   + + L+ +         
Sbjct: 108 NRIEVAKEVASDFISGRPNDNIGLTIFAGEAFTQCPMTVDHAALLNLLHNVRTDLVVKGL 167

Query: 273 --ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
             + T     + ++   L            S    K +I +TDG N+  S        + 
Sbjct: 168 IQDGTAIGMGLANSVSRL----------KDSKAKSKVIILLTDGSNNVGSIS-----PMT 212

Query: 331 ICEYMRNAGMKIYSVAVS------APPEGQDLLRKCT-DSSGQFFAVNDSRELLESFDKI 383
                +  G++IY++ +               L+     ++G+F+      EL + +  I
Sbjct: 213 AASIAKKYGIRIYTIGLGKESEGDLGAIDYKTLQNIAVSTNGEFYRAQSQAELSKIYQDI 272

Query: 384 TDKIQEQSVRI 394
            DK+++  +R+
Sbjct: 273 -DKLEKTKLRV 282


>gi|312882153|ref|ZP_07741902.1| Flp pilus assembly protein TadG [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370199|gb|EFP97702.1| Flp pilus assembly protein TadG [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 498

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 46/468 (9%), Positives = 124/468 (26%), Gaps = 84/468 (17%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSG--------------------- 40
             +++        +A++ +  +   ++++ + +AA ++                      
Sbjct: 22  MGLLLVPIMGVTFWAVEGSRYVQESSRLRDSAEAAAIAVTIEDRKGRADSMAEEYVRSYV 81

Query: 41  ----CASIVSDRTIKDPTTKK---------DQTSTIFKKQIKKHLKQGSYIRENAGDIAQ 87
                 ++ + R  +     K             T  K     +       ++     + 
Sbjct: 82  RDIESTALTTSRDYRARDDAKGIREYIEYTVDARTTHKSWFVSNFIPSFDRKQELAGRSV 141

Query: 88  K---------AQINITKDKNNPLQYIAE--SKAQYEIPTENLFLKGLIPSALTNLSLRST 136
                       I+I    +             +  I   ++ +    P     +S    
Sbjct: 142 AGKEPIQPGEDTIDIVFVSDFSTSMYGSKLRVLKSSIDQISIKILCESPRYDQQISSYIC 201

Query: 137 GIIERSSENLAISICMVL------------------------DVSRSMEDLYLQKHNDNN 172
                +  N    +   +                         VS    +         +
Sbjct: 202 DDKRATGVNRIGFVPFNIRTREMIWSRDGRAVSQLVYLNGDASVSTYTYNDIDWDRWRMS 261

Query: 173 NMTSN-KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI--ESAGNLVNSIQKAIQ 229
           +  S  K             +N  ++K            D+    +    + +      +
Sbjct: 262 SKESVEKCAQNYFNCNVPQWQNHQRAKRIFDVVGDYSDPDMFDYIDFDATVSDMFNDKSR 321

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTP--LSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
            K N       +    G +  Q     L+N+L ++   +  +    NT  Y  +    + 
Sbjct: 322 SKSNFYRTTKGVRLYSGSLHAQFQNILLTNDLLDL-EAIQNMTAAGNTAAYQGILRGLQV 380

Query: 288 LYNEKE----SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNA--GMK 341
           L   +                 K ++ ++DG+ +        +    +C+  R    G+ 
Sbjct: 381 LKQGQPSIDADEEVQQAYQNKNKMLLILSDGQETDERIINELVKNK-MCDKAREEIPGLY 439

Query: 342 IYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           I  + +      Q+  ++C ++  +   + D   L E  +KI + I +
Sbjct: 440 IGVIGIKFSASDQNGFKECVENEDE--DIIDVSNLNELIEKIEELIMK 485


>gi|313207255|ref|YP_004046432.1| von willebrand factor type a [Riemerella anatipestifer DSM 15868]
 gi|312446571|gb|ADQ82926.1| von Willebrand factor type A [Riemerella anatipestifer DSM 15868]
 gi|315023479|gb|EFT36485.1| aerotolerance operon BatA [Riemerella anatipestifer RA-YM]
 gi|325335298|gb|ADZ11572.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Riemerella anatipestifer RA-GD]
          Length = 330

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 70/204 (34%), Gaps = 41/204 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + ++++  +                        PL+++   V+  L   NP      T
Sbjct: 108 DRLTALKEIARTFIKQRTTDRIGLVEYSGEALMRVPLTSDHRVVEEELMSFNPMDLEGGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +  A   L            S    K +I +TDG N+  +A       L   E  
Sbjct: 168 NIGDGLAVAVSHL----------RKSKAKSKIIILMTDGVNTIDNAMS----PLTAAELA 213

Query: 336 RNAGMKIYSVAVSAPP----------------------EGQDLLRKCTD-SSGQFFAVND 372
           RN  +K+Y++ + +                          + LLR     + G++F    
Sbjct: 214 RNNDIKVYTIGIGSNGLALMPTQQDIFGNLVFTEEQVKIDEYLLRDVAQITGGKYFRATS 273

Query: 373 SRELLESFDKITDKIQEQSVRIAP 396
           +  L + +++I D +++ +++ + 
Sbjct: 274 NESLKQIYEEI-DTLEKSNIKTSK 296


>gi|228472814|ref|ZP_04057572.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275865|gb|EEK14631.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 332

 Score = 87.3 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 74/211 (35%), Gaps = 53/211 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +I+ L   A   +             S RIG + Y+         P + + + V   L 
Sbjct: 111 NRIEALKRVAAQFIQQ---------RASDRIGIVVYSGESYTK--VPATTDKSIVLQALK 159

Query: 268 KLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
           ++      + T     +  A   L            S    K +I +TDG N+       
Sbjct: 160 EIRQGEIEDGTAIGMGLGTAINRL----------KDSKTKSKVIILMTDGVNNTGV---- 205

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAPPE----------------------GQDLLRKCTD 362
            ++ L   E  +  G+++Y++ +    +                       + LL + + 
Sbjct: 206 -IDPLSAAELAKEYGIRVYTIGIGTNGKALSPVAYNPDGSFQYDMVPVEIDEKLLAEISK 264

Query: 363 -SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
            + G++F   D+ +L + + +I DK+++  +
Sbjct: 265 ITGGKYFRATDNNKLAQIYTEI-DKLEKSKI 294


>gi|66793453|ref|NP_001019751.1| vitrin [Gallus gallus]
 gi|56744182|dbj|BAD81032.1| Akhirin [Gallus gallus]
          Length = 748

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 43/323 (13%), Positives = 81/323 (25%), Gaps = 31/323 (9%)

Query: 71  HLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTN 130
                ++  +  G+      + +      P   + E+         N+F   +  +A   
Sbjct: 447 SFVNKNFFSDANGNRGGAPNVVVVMVDGWPTDRVEEASRLARESGINIFFVTIEAAAQNE 506

Query: 131 LSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW 190
                             +    + V                             K    
Sbjct: 507 KQNVIEPNF-VDKAVCRTNGFYSITVPSWFSLHK---VVQPLVKRVCDIDRLVCSKTCLN 562

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
           S +        +    +    VL   A            E  +   RIG I Y       
Sbjct: 563 SADIGFVIDGSSSVGTSNFRTVLQFVAN------ISKEFEISDTDTRIGAIQYTYEQRLE 616

Query: 251 QCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
                 +   +V S + ++N     T+T  A+ +A  +L+               +K +I
Sbjct: 617 FSFDKYSTKQDVLSAIKRINYWSGGTSTGAAISYASEQLFT--------KSKPNKRKIMI 668

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG--QF 367
            ITDG +                      G+  YS+ V      QD L            
Sbjct: 669 LITDGRSYDDVRMP--------ALTAHQNGVIAYSIGV--AWAAQDELEAIATDPDKEHS 718

Query: 368 FAVNDSRELLESFDKITDKIQEQ 390
           F V++   L +  + +   I  +
Sbjct: 719 FFVDEFDNLYQFVNPLIQNICTE 741



 Score = 44.5 bits (103), Expect = 0.031,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 41/126 (32%), Gaps = 14/126 (11%)

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYN 290
            N    +G + Y              +  E+++ + K+      +N   A+    +  ++
Sbjct: 396 NNAGPLMGIVQYGDDPSTEFNLKTYASPKELRNAIEKIPQKGGLSNVGKALSFVNKNFFS 455

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
           +   +     +      V+ + DG  +            +     R +G+ I+ V + A 
Sbjct: 456 DANGNRGGAPN-----VVVVMVDGWPTD--------RVEEASRLARESGINIFFVTIEAA 502

Query: 351 PEGQDL 356
            + +  
Sbjct: 503 AQNEKQ 508


>gi|207857733|ref|YP_002244384.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|206709536|emb|CAR33881.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
          Length = 596

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 71/190 (37%), Gaps = 22/190 (11%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ 
Sbjct: 252 RLPLIQSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDN 303

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L+ Y +T     +  AY +                    ++  TDG+ +      +  + 
Sbjct: 304 LDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDI 353

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
             + +  R  G+ + ++ V      + ++ +  D  +G +  ++    L E+   + D++
Sbjct: 354 EALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVLKDEM 410

Query: 388 QEQSVRIAPN 397
            +  V +A +
Sbjct: 411 HQTLVTVAKD 420


>gi|295132198|ref|YP_003582874.1| von Willebrand factor(vWA) type A domain-containing protein
           [Zunongwangia profunda SM-A87]
 gi|294980213|gb|ADF50678.1| von Willebrand factor(vWA) type A domain-containing protein
           [Zunongwangia profunda SM-A87]
          Length = 334

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 57/168 (33%), Gaps = 42/168 (25%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIG 300
                   TP++++ + V   L  +         T     +  +   L            
Sbjct: 138 YSGESFTKTPITSDKSVVLRALEDVEFNNILESGTAIGSGLATSVNRL----------KD 187

Query: 301 STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP--------- 351
           S    K +I +TDG N+        ++     E  +  G+K+Y++ V             
Sbjct: 188 SKAESKVIILLTDGVNNSG-----FIDPKVASELAKEFGIKVYTIGVGTNGMALTPVGIA 242

Query: 352 -------------EGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                          +DLL++  D + G++F   ++ +L + +D+I  
Sbjct: 243 ANGRFQFGNRQVEIDEDLLKQIADETGGKYFRATNNEKLEDIYDEIDQ 290


>gi|293391324|ref|ZP_06635658.1| Flp pilus assembly protein TadG [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951858|gb|EFE01977.1| Flp pilus assembly protein TadG [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 525

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 59/466 (12%), Positives = 132/466 (28%), Gaps = 99/466 (21%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLS----------------GCASIVSDRTIKDPTTKKD 58
           + +D   I+  + ++  A D A L                      VS + I      K 
Sbjct: 43  FTVDGTGILLDKARLAQATDQAALLLIAEDNKYRKNKDHSDVSRQHVSQQDINREGNSKV 102

Query: 59  QT------STIFKKQIKKHLKQGS------YIRENAGDIAQKAQINITKDKNNPLQY--- 103
           Q         + +  +K +L+                D      +       N       
Sbjct: 103 QAQWKKRNQELVQGLVKLYLRSDDKNGQKNSSPAIIKDPFLAECLEEKTQPKNKNGTAKS 162

Query: 104 ---IAESKAQYEIPT---ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVS 157
              + +   Q +      + L     +      ++   T  ++     + I + MV D+S
Sbjct: 163 IACVVQGSVQRKFWLPWGQTLVSSSRLHDGRVGINSGKTYAVKDKQITIPIDLMMVTDLS 222

Query: 158 RSMEDLY------LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
            SM               D              PK S    +        A A   R+  
Sbjct: 223 GSMVSPIDKRIPSSSIRIDALRDVVKDIEGILLPKDSRDDTSPYNRMGFVAFAGGARQKT 282

Query: 212 VLIESA-------------------------GNLVNSIQKAIQEKKNLSVRIGT-IAYNI 245
              +                             L++      +    +    G+ I+Y+ 
Sbjct: 283 EKNDCVLPYYAQQSKKEEISNLYRNNKLDQASKLLDQYMDIERTINQIDQFNGSNISYDF 342

Query: 246 GIVGNQCTPLSNNLNE-----------VKSRLNKLNPYENTNTYPAMHHAYRELYNEK-- 292
                +C   S                V + LN+++P   T     M      + +    
Sbjct: 343 INTTKKCLGKSEGKETTRAWFDKKNLGVSNALNEIDPDGGTAVTSGMFIGTNLMTDTNKD 402

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMR--------------N 337
             +  +  +T  ++ ++ ++DGE++  +      L +  +C  ++               
Sbjct: 403 PEAAPSKLNTNTRRILLVLSDGEDNRPTEGTLVKLMSAGLCNKIKRKIDSLQDTKYPKVE 462

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           A +   ++  + P +  ++ ++C     Q++ V   + LL++F +I
Sbjct: 463 ARVAFVALGYNPPQDQVNVWKQCV--GKQYYTVFSKQGLLDAFRQI 506


>gi|32452632|gb|AAP43994.1| TadG [Aggregatibacter actinomycetemcomitans]
          Length = 525

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 59/466 (12%), Positives = 132/466 (28%), Gaps = 99/466 (21%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVLS----------------GCASIVSDRTIKDPTTKKD 58
           + +D   I+  + ++  A D A L                      VS + I      K 
Sbjct: 43  FTVDGTGILLDKARLAQATDQAALLLIAEDNKYRKNKDHSDVSRQHVSQQDINREGNSKV 102

Query: 59  QT------STIFKKQIKKHLKQGS------YIRENAGDIAQKAQINITKDKNNPLQY--- 103
           Q         + +  +K +L+                D      +       N       
Sbjct: 103 QAQWKKRNQELVQGLVKLYLRSDDKNGQKNSSPAIIKDPFLAECLEEKTQPKNKNGTAKS 162

Query: 104 ---IAESKAQYEIPT---ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVS 157
              + +   Q +      + L     +      ++   T  ++     + I + MV D+S
Sbjct: 163 IACVVQGSVQRKFWLPWGQTLVSSSRLHDGRVGINSGKTYAVKDKQITIPIDLMMVTDLS 222

Query: 158 RSMEDLY------LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKID 211
            SM               D              PK S    +        A A   R+  
Sbjct: 223 GSMVSPIDKRIPSSSIRIDALRDVVKDIEGILLPKDSRDDTSPYNRMGFVAFAGGARQKT 282

Query: 212 VLIESA-------------------------GNLVNSIQKAIQEKKNLSVRIGT-IAYNI 245
              +                             L++      +    +    G+ I+Y+ 
Sbjct: 283 EKNDCVLPYYAQQSKKEEISNLYRNNKLDQASKLLDQYMDIERTINQIDQFNGSNISYDF 342

Query: 246 GIVGNQCTPLSNNLNE-----------VKSRLNKLNPYENTNTYPAMHHAYRELYNEK-- 292
                +C   S                V + LN+++P   T     M      + +    
Sbjct: 343 INTTKKCLGKSEGKETTRAWFDKKNLGVSNALNEIDPDGGTAVTSGMFIGTNLMTDTNKD 402

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMR--------------N 337
             +  +  +T  ++ ++ ++DGE++  +      L +  +C  ++               
Sbjct: 403 PEAAPSKLNTNTRRILLVLSDGEDNRPTEGTLVKLMSAGLCNKIKRKIDSLQDTKYPKVE 462

Query: 338 AGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
           A +   ++  + P +  ++ ++C     Q++ V   + LL++F +I
Sbjct: 463 ARVAFVALGYNPPQDQVNVWKQCV--GKQYYTVFSKQGLLDAFRQI 506


>gi|323342275|ref|ZP_08082507.1| hypothetical protein HMPREF0357_10688 [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463387|gb|EFY08581.1| hypothetical protein HMPREF0357_10688 [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 1466

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 42/365 (11%), Positives = 103/365 (28%), Gaps = 44/365 (12%)

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
           +K++K  + +          +      +    + N            +I   N     + 
Sbjct: 6   RKKMKTRIIKSGLTVLLITMVLLSINTSFVSAEGNSSSSEKTITNSIQIDNMNEGEVRVF 65

Query: 125 ----PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
               P   +      +  +    +     I +VLD S SM+     +  D   ++  K  
Sbjct: 66  KTAKPIPNSINRWEISIDVFGRLKREPSDIVLVLDTSGSMDPQKNPQGID--RISKAKRE 123

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS----V 236
                 + F    + +          +       + +  L+N I+    E    +     
Sbjct: 124 AIHFVNEIFERDASARVALVSYGTKVSSNSFHTKQESNLLINEIKSLKAEGGTFTQGALY 183

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNE----VKSRLNK--LNPYEN---------------- 274
               +             LS+        +K+++N+  L    N                
Sbjct: 184 EAKMLLNQSSAPNKTIVLLSDGQPTYRYPLKAKVNQDLLRYDGNVIVQKRYNGQQRPFDI 243

Query: 275 --TNTYPAMHHAY-------RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
             T++       Y         +++     + T     L +     + G  +      + 
Sbjct: 244 GITSSSNQAIPGYRFKSRPNTNVFDYNAMVYGTGNEYYLDELGELRSQGNQNYFVYMSSA 303

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDS-RELLESFDKIT 384
              +     +    + +Y++       G D+L++   S+  ++  + S   L + F KI+
Sbjct: 304 DAAIIESNQIHQEQIHLYAIGFDTDARGTDILKRI--SNNNYYDASSSRDNLDDIFKKIS 361

Query: 385 DKIQE 389
           + I  
Sbjct: 362 NNIYS 366


>gi|294651171|ref|ZP_06728503.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822924|gb|EFF81795.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 446

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/362 (9%), Positives = 90/362 (24%), Gaps = 35/362 (9%)

Query: 41  CASIVSDRTIKDPTTKKDQTSTIFKKQIKKHL--KQGSYIRENAGDIAQKAQINITKDKN 98
                          +           +   +   +     E            +T    
Sbjct: 28  SIQTSDVIMPAPIAARSHIAHKAAYNAVMPTMERPRLEQDTEKYQKNEVNPVHRVTDQAV 87

Query: 99  NPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD--V 156
           +      +    Y      L    L P     +         +  +   +    V    V
Sbjct: 88  STFSIDVD-TGSYTNTRRFLNDGRLPPVDAVRIEEMINYFDYQYPQPNGVHPFSVTTETV 146

Query: 157 SRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIES 216
               ++                  LPP                      A  K+ ++ ++
Sbjct: 147 DSPWKENAKLIRIGIQAKDLALQQLPPANLVFLVD--------VSGSMSAADKLPLVKQT 198

Query: 217 AGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN 276
              L   ++           ++  I Y  G              ++ + +N L    +T 
Sbjct: 199 LRILTEQLRAQD--------KVTIITYASGEKLVLEPTSGEQKEKILAVINGLRARGSTA 250

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
              A+  AY++       +            ++  TDG+ +      NTL    +    R
Sbjct: 251 GEQAIQLAYKQAEKAFVKNGINR--------ILLATDGDFNVGITDFNTL--KGMVAEKR 300

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
            +G+ + ++        + L+ +  D+  G +  +++  E  +       ++      +A
Sbjct: 301 KSGISLTTLGFGTGNYNEQLMEQLADAGDGNYSYIDNKNEAKKVVQ---RQLSSTLATVA 357

Query: 396 PN 397
            +
Sbjct: 358 QD 359


>gi|294670381|ref|ZP_06735263.1| hypothetical protein NEIELOOT_02099 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307845|gb|EFE49088.1| hypothetical protein NEIELOOT_02099 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 553

 Score = 86.9 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/321 (10%), Positives = 86/321 (26%), Gaps = 29/321 (9%)

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
             E       +    + ++  +      +    Y      L    L P     +      
Sbjct: 84  DTERYQKQPDQPVKAVAQEPVSTFSIDVD-TGSYANVRRFLNNGRLPPKDTVRIEEIVNY 142

Query: 138 IIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKS 197
                          +                    +           KK     N    
Sbjct: 143 FPYNYPLPTGGHPFAI------HTQTIDSPWQHEAKLIKIGIQAQDLAKKELPPANLVFL 196

Query: 198 KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                   +  K+ ++ ++   L   ++           ++  I Y  G           
Sbjct: 197 VDISGSMNSPEKLPLVKKTLRILTEQLRPQD--------KVTLITYASGEELVLPPTSGR 248

Query: 258 NLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
           N +E+   +NKL    +T    A+  AY +       +            ++  TDG+ +
Sbjct: 249 NKDEILRAINKLQAGGSTAGESALKMAYEQAQKAYVKNGINR--------ILLATDGDFN 300

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSREL 376
              +  + L    +    R +G+ + ++        +D++ +  D+  G +  +++ +E 
Sbjct: 301 VGVSSTDAL--KSMVAEKRKSGISLTTLGFGTGNYNEDMMEQIADAGDGNYSYIDNEKEA 358

Query: 377 LESFDKITDKIQEQSVRIAPN 397
            +       ++      +A +
Sbjct: 359 KKVLQ---HQLTSTLATVAQD 376


>gi|325279872|ref|YP_004252414.1| von Willebrand factor type A [Odoribacter splanchnicus DSM 20712]
 gi|324311681|gb|ADY32234.1| von Willebrand factor type A [Odoribacter splanchnicus DSM 20712]
          Length = 330

 Score = 86.9 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/207 (12%), Positives = 73/207 (35%), Gaps = 40/207 (19%)

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
           +  +   + + + ++   +      +                PL+ +   + + L ++  
Sbjct: 104 LARDFTPDRLEAAKEVATKFILERPQDKIGLVVFAGESFTQCPLTTDQAVLVNLLREVKS 163

Query: 272 Y---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
               + T     + +A   L            S    K VI +TDG N+        +  
Sbjct: 164 GMIQDGTAIGLGLANAVNRL----------KDSPGKSKVVILLTDGINNQG-----AIAP 208

Query: 329 LQICEYMRNAGMKIYSVAVSAPPE--------------------GQDLLRKCTD-SSGQF 367
           +   E  +  G+++Y++ V    E                     + +L++  + + G++
Sbjct: 209 VTAAELAKAFGIRVYTIGVGTYGEAPYPVPTPFGVQLQNMPVEIDEGVLQQIANVTGGKY 268

Query: 368 FAVNDSRELLESFDKITDKIQEQSVRI 394
           F   D+ +L + + +I D++++  + +
Sbjct: 269 FRATDNDKLQQIYSEI-DQLEKSKIEV 294


>gi|21228580|ref|NP_634502.1| putative chloride channel [Methanosarcina mazei Go1]
 gi|20907073|gb|AAM32174.1| putative chloride channel [Methanosarcina mazei Go1]
          Length = 1004

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 39/307 (12%), Positives = 95/307 (30%), Gaps = 36/307 (11%)

Query: 90  QINITKDKNNPLQYIAESKAQYEIPT-------ENLFLKGLIPSALTNLSLRSTGIIERS 142
             ++  + NNP     +++ + E                G        +S    G  + S
Sbjct: 210 SFSLVGNYNNPNLLTVDAEVKSENVPITGLNKDNFTIEIGSKKVNDVTVSDVGEGKYKLS 269

Query: 143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPA 202
                       D++  ++   +   +   N    +Y        +       +S     
Sbjct: 270 FNPPKQDSNGNYDLNVYVKYKKVTLSDSELNA--VRYGEDNANANANVMLVIDRSGSMSG 327

Query: 203 PAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEV 262
                  I     SA   ++ ++                 Y++  +  +        N +
Sbjct: 328 SP-----ISSAKNSANLFIDYMEAEDMAGVVSFSSSARYDYHLATLTPEV------KNSI 376

Query: 263 KSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
           K ++N +     T     M +   +L N  + ++           ++ ++DG  +     
Sbjct: 377 KQKINSIYASGVTAIGSGMRYGLNDLLNYGDPNNPW--------AIVLLSDGYQNSGENP 428

Query: 323 QNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFD 381
            N      +   ++ + +++Y+V +  P   Q LL    D + G+++      +L E ++
Sbjct: 429 NN------VIPSIKASNIQVYTVGLG-PAVDQKLLGNIADQTGGKYYYSPTDSQLQEIYN 481

Query: 382 KITDKIQ 388
            I  KI 
Sbjct: 482 DIVGKII 488


>gi|332519334|ref|ZP_08395801.1| von Willebrand factor type A [Lacinutrix algicola 5H-3-7-4]
 gi|332045182|gb|EGI81375.1| von Willebrand factor type A [Lacinutrix algicola 5H-3-7-4]
          Length = 334

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 69/205 (33%), Gaps = 53/205 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++ L   A   +         K   + RIG + Y         TP++++ + V   L 
Sbjct: 112 NRLEALKNVASEFI---------KGRPNDRIGLVEYAGESYTK--TPITSDKSIVLRSLQ 160

Query: 268 KLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           ++         T     +  A   L            S    K +I +TDG N+  S   
Sbjct: 161 EIRYNNIIEGGTAIGMGLATAVNRL----------KDSKAKSKVIILLTDGVNNSGS--- 207

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPP----------------------EGQDLLRKCT 361
             +N     E     G+K Y++ +                            + LL++  
Sbjct: 208 --INPKIASELAVEFGIKTYTIGLGTNGMALSPIAIKQNGQFQYGRVKVEIDETLLKEIA 265

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + G++F   ++++L E +D+I  
Sbjct: 266 QVTGGKYFRATNNKKLAEIYDEINK 290


>gi|167752252|ref|ZP_02424379.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
 gi|167660493|gb|EDS04623.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
          Length = 328

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 71/202 (35%), Gaps = 41/202 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + + ++                          +PL+ +   +++ L +L      + T
Sbjct: 108 DRIQAAKQVAGNFITDRPGDRIGLVAFAGEAFTQSPLTTDQGTLQTLLGRLRSGVVEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L      S          K +I +TDGEN+        +  L   E  
Sbjct: 168 AIGNGLATAINRLRESNAKS----------KVIILLTDGENNRG-----EIAPLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPPE---------------------GQDLLRKCTD-SSGQFFAVNDS 373
           R+ G+++Y++ V                           + +L +  D + G++F   D+
Sbjct: 213 RDQGIRVYTIGVGTRGTAPYPTVDFFGNPTVVQAKVQIDEKILGEIADLTGGRYFRATDN 272

Query: 374 RELLESFDKITDKIQEQSVRIA 395
            +L   +D+I +++++  V I+
Sbjct: 273 AKLQSIYDEI-NQLEKSKVEIS 293


>gi|117618125|ref|YP_856000.1| hypothetical protein AHA_1462 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559532|gb|ABK36480.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 460

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 51/454 (11%), Positives = 117/454 (25%), Gaps = 71/454 (15%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDA--------------------AVLSGC 41
            A++++         I+L      ++ + +A DA                    A L+G 
Sbjct: 15  FALMLTGVLALTGVVIELVRGYSGQSLLSAAADAVLYSAADSDSAAEDAAALVRANLAGR 74

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
              V    +        +   I + ++   +   +        +A  A+ +  + +   +
Sbjct: 75  HLQVGPPALSQNE---QEAQVILQGEVPALMALSAIGTSGDLPVAAAARASSARTRI-EI 130

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD------ 155
             + +              +GL                   S   A  +  + D      
Sbjct: 131 ALVLDVSNSMSGAPMKAIKQGLAEFGEVLFGRERRNQDRVVSIIPATGLVNIGDHPELFH 190

Query: 156 ----------VSRSMEDLYLQKHNDNN----NMTSNKYLLPPPPKKSFWSKNTTKS---- 197
                      + + E  +                   L          ++ T       
Sbjct: 191 PESLTFPFGLQTLAHERGWSNLLTREVPGRQRKAFCARLPEHVDGIDRLAELTPGWIRKL 250

Query: 198 ----------KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGI 247
                     +   +  P   +                   +  +N   ++G        
Sbjct: 251 ELAPRGEAQPRLHYSTKPPAIQQYEDGTPLRAFAPRENPLERYLENRRDKLGIFDDPDCG 310

Query: 248 VGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH--------NTI 299
           V      LS      +  L+ L+   NTNT   +   +R L  + +              
Sbjct: 311 VSPIQAHLST-RAAYRQALDTLHAAFNTNTAEGVMWGWRLLSPQWQGRWQQGAAELPRPY 369

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
           G    +K ++  +DGE+ G  A       L +C  M+  G+++Y+VA          + +
Sbjct: 370 GQADNRKILVLFSDGEHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFEGDAR---FVAQ 426

Query: 360 CTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           C       +       +     ++   I +  + 
Sbjct: 427 CASERSLAYKATS-GNIRTVLTRLASAINDVVLT 459


>gi|126730249|ref|ZP_01746060.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
 gi|126708982|gb|EBA08037.1| hypothetical protein SSE37_10854 [Sagittula stellata E-37]
          Length = 666

 Score = 86.5 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/401 (9%), Positives = 100/401 (24%), Gaps = 74/401 (18%)

Query: 46  SDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA 105
           +D T    T      S   +      +   +   +      +         ++    Y  
Sbjct: 284 TDGTDTAATDTGGFFSPWPQPIANIVVYFDTNGDDIYNRAHKIINFPDGSTRDIDDIYQG 343

Query: 106 ESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL 165
                 +           +  ++     ++     +   N   S     D+  +  +  +
Sbjct: 344 AVAFLIDRDPLLFHPDQFLGISVKGGQEKNRYFQVKGDGNGPFS-----DIGPTKNNGKI 398

Query: 166 QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ 225
                +         +      +++       +      P                    
Sbjct: 399 PGDVIDFA------FIDYDAWAAYYVAPVAPVEAVNVNMP--------SSCVEIYDTEFT 444

Query: 226 KAIQEKKNLSVRIGTIAYN------IGIVGNQCTPL---SNNLNEVKSRLNKLNPYENTN 276
                + +  V               G    + T +   S++   + + ++ +  ++ T 
Sbjct: 445 NTDLPQSDDYVPHFMFWPYVREVMDWGWCPGEDTAIQYYSDDAATLSAFIDNMRMHDGTG 504

Query: 277 TYPAMHHAYRELYNEKE-----------------SSHNTIGSTRLKKFVIFITDG----- 314
               + +A   L                                 +KF++ ++DG     
Sbjct: 505 IQYGLKYALALLDPATGSAVTELISAGLVDSRFLGRPIAWEDEETEKFIVVMSDGAVTDQ 564

Query: 315 -----------------------ENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
                                    + ++   N  N    C+  R+ G+ +++VA     
Sbjct: 565 YRPVDPFAPLNGETELQTQGSGSYTTFSTRGNNLDNLHTQCQLARDLGVTVFAVAFETTD 624

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
              D LR C  S   FF V    E++++FD I  +I    +
Sbjct: 625 ADADELRLCASSDSHFFHVQ-GTEIIDAFDTIARQINNLRL 664



 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/261 (9%), Positives = 60/261 (22%), Gaps = 32/261 (12%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
            ++ +  +    ++D+ +   IR ++Q+ LD AVL+          +          +  
Sbjct: 66  FMLVLILVITGASVDIMYQEAIRARLQATLDRAVLAAA-------DLDQQQDPVAVVNDY 118

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
             K                 D    A   +T D                      +   +
Sbjct: 119 VTKAGLVEHLTDVIATPGLYDRTVAADAGLTLD---------------------TYFLRM 157

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
                  +   ST     ++  +++    V+D+S SM       +  N        +L  
Sbjct: 158 SGWQTLPVIAASTAEERIANVEISL----VMDISGSMRWNNRITNARNAAKDFVTKVLTE 213

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
                        +               +        N      Q+    S+       
Sbjct: 214 DSAGVTTLNLIPFAGQVNPGDVMFDYFRGVRPKIQQGNNGWGNGDQDAPGGSLCTNNAEN 273

Query: 244 NIGIVGNQCTPLSNNLNEVKS 264
                 +       +     +
Sbjct: 274 ADEGAIDPSCTDGTDTAATDT 294


>gi|196233777|ref|ZP_03132616.1| von Willebrand factor type A [Chthoniobacter flavus Ellin428]
 gi|196222139|gb|EDY16670.1| von Willebrand factor type A [Chthoniobacter flavus Ellin428]
          Length = 883

 Score = 86.1 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 47/383 (12%), Positives = 104/383 (27%), Gaps = 38/383 (9%)

Query: 29  MQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQK 88
           + SA      +   ++     + +    K      + +  +        I +N+  +  +
Sbjct: 246 LDSAEPQGGAALSKAVTPKDKLAEADASKAMPVAAWARVRRGFAATSGGIGDNSYGLDDR 305

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAI 148
             I       N         A   +P   L    +     +   +R            A+
Sbjct: 306 GGIADKASNANSFD-TLTENAFLNVPENPLSTFSIDVDTASYAIVRRYLNDNHLPPTGAV 364

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFW---------SKNTTKSKY 199
            I  +L+               +  M        P  +              +    +  
Sbjct: 365 RIEELLNYFPYDYPQPQGAAPFSATMEVATCPWAPEHRLVRVGLKGREIPKDERPPSNLV 424

Query: 200 ----APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                        K+ +L +    LV  +            R+  + Y  G         
Sbjct: 425 FLIDVSGSMNMPNKLPLLQKCFSLLVEQLGPKD--------RVSIVTYASGT--KLVLEP 474

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + +   +++ ++ L+    T+    +  AYR                     VI  TDG+
Sbjct: 475 TQDKEAMQTAIDGLHAGGGTHGSSGIDLAYRMAQQSFIPGGTNR--------VILATDGD 526

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSR 374
            +     Q+ L  L +      +G+ +  +          +L K  D   G +  ++  +
Sbjct: 527 WNIGITNQSEL--LSMITRKAKSGVFLTVLGFGLDNLKDSMLVKLADHGNGHYAYIDTEQ 584

Query: 375 ELLESFDKITDKIQEQSVRIAPN 397
           E  + F    D++    V IA +
Sbjct: 585 EARKVF---VDQLSSTLVTIAKD 604


>gi|167549689|ref|ZP_02343448.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205325282|gb|EDZ13121.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 593

 Score = 86.1 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 72/190 (37%), Gaps = 22/190 (11%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ 
Sbjct: 249 RLPLIQSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDN 300

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L+ Y +T     +  AY +                    ++F TDG+ +      +  + 
Sbjct: 301 LDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILFTTDGDFNLG--ITDPKDI 350

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
             + +  R  G+ + ++ V      + ++ +  D  +G +  ++    L E+   + D++
Sbjct: 351 EALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIDS---LSEAQKVVKDEM 407

Query: 388 QEQSVRIAPN 397
            +  V +A +
Sbjct: 408 HQTLVTVAKD 417


>gi|307942638|ref|ZP_07657986.1| hypothetical protein TRICHSKD4_1260 [Roseibium sp. TrichSKD4]
 gi|307774277|gb|EFO33490.1| hypothetical protein TRICHSKD4_1260 [Roseibium sp. TrichSKD4]
          Length = 403

 Score = 86.1 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 56/393 (14%), Positives = 122/393 (31%), Gaps = 61/393 (15%)

Query: 15  YAIDLAHIMYIRNQMQSALDAAVL-SGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLK 73
             ID++     R+Q Q   D   L +                 + +  T  +K +    K
Sbjct: 37  VGIDMSFAYNKRDQSQLVADEVSLFAVTTFRKYVADGMSKNQARKRAETDARKFLTARTK 96

Query: 74  QGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSL 133
                 E          INI   +   ++       ++E      ++   +     + + 
Sbjct: 97  SLDGTTEKFSIK-----INIVDREAKVVKANVNISGKHES-----YMTHAMGFDNIDYTA 146

Query: 134 RSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKN 193
            S      S          ++DVS SM      +                 P  S  S+ 
Sbjct: 147 DSES--TISFGQGKYEFIFLVDVSPSMGIGASNRDRQIMQRAIGCQFACHEPWYSSVSR- 203

Query: 194 TTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT 253
                     A A  +IDV+ ++  +LV  +++A      + +R G  +++     +  T
Sbjct: 204 -------AKSAGARLRIDVVKDALKSLVTQLEEA----TEVDLRTGLYSFSN--YLHIQT 250

Query: 254 PLSNNLNEVKSRLNKLN------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
            L+  +++ K   NK+           TN +           +      +      +K+ 
Sbjct: 251 GLNKGISKFKREANKIAIHREYLRGGGTNFHG-------VFSDFNGVLRSLKPKADVKQH 303

Query: 308 VIFITDGE--------------NSGASAYQNTLN-TLQICEYMRNAGM-KIYSVAVSAP- 350
           +I I+DG               N   +      +   + C+  +   +  ++++ V    
Sbjct: 304 IIIISDGVNHLNLRSGTNRHLWNQTPNWRPYNYSFNPRWCDEFKKGEVRTVHTMLVEPDR 363

Query: 351 ----PEGQDLLRKCTDSSGQFFAVNDSRELLES 379
                     +R C  S+  F++ N + E+ ++
Sbjct: 364 AHYVRASTSSMRACATSADFFYSANSAAEIDKA 396


>gi|168817956|ref|ZP_02829956.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205345018|gb|EDZ31782.1| von Willebrand factor, type A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320086747|emb|CBY96519.1| Inter-alpha-trypsin inhibitor heavy chain H3 Inter-alpha-inhibitor
           heavy chain 3; ITI heavy chain H3; ITI-HC3; Flags:
           Precursor [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 604

 Score = 86.1 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 60/159 (37%), Gaps = 14/159 (8%)

Query: 240 TIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTI 299
            + Y  G      +   NN   +K+ ++ L+ Y +T     +  AY +            
Sbjct: 283 IVTYAGGTHVALASTAGNNTTAIKAAIDNLDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR 342

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK 359
                   ++  TDG+ +      +  +   + +  R  G+ + ++ V      + ++ +
Sbjct: 343 --------ILLTTDGDFNLG--ITDPKDIEALVKKEREKGITLSTLGVGDDNFNEAMMVR 392

Query: 360 CTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
             D  +G +  ++    L E+   + D++ +  V +A +
Sbjct: 393 IADVGNGNYSYIDS---LSEAQKVLKDEMHQTLVTVAKD 428


>gi|223558081|gb|ACM91085.1| aerotolerance protein BatA [uncultured bacterium Rlip1]
          Length = 332

 Score = 86.1 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 68/204 (33%), Gaps = 40/204 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + + +    +                       PL+ +   + + L ++      + T
Sbjct: 112 DRLTAAKNVASDFVKGRPGDRMGLVIFSGETFTQVPLTTDHGVMLNMLAEMKNGLIDDGT 171

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L            S  + K VI +TDG N+  S     ++     E  
Sbjct: 172 AIGDGLATAISRL----------KDSEAISKVVILLTDGMNNAGS-----VDPYTAAEIA 216

Query: 336 RNAGMKIYSVAVSAPPE--------------------GQDLLRKCTD-SSGQFFAVNDSR 374
           +  G+++Y++ V +                        + LL      + G++F    ++
Sbjct: 217 KLYGIRVYTIGVGSYGTAPYPVQTPFGTQIQQMKVEIDEKLLASVASMTGGKYFRATSNQ 276

Query: 375 ELLESFDKITDKIQEQSVRIAPNR 398
           +L E +++I DK++   + +   R
Sbjct: 277 KLDEIYEEI-DKLERSKIEVTEFR 299


>gi|16124454|ref|NP_419018.1| hypothetical protein CC_0199 [Caulobacter crescentus CB15]
 gi|221233138|ref|YP_002515574.1| hypothetical protein CCNA_00199 [Caulobacter crescentus NA1000]
 gi|13421322|gb|AAK22186.1| hypothetical protein CC_0199 [Caulobacter crescentus CB15]
 gi|220962310|gb|ACL93666.1| hypothetical protein CCNA_00199 [Caulobacter crescentus NA1000]
          Length = 626

 Score = 86.1 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 66/243 (27%), Gaps = 41/243 (16%)

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG---- 246
           S      K          +++     A   + S            V              
Sbjct: 382 STVPGCEKIRFTNVDGYERVNSQSTCATERIGSQAYTDAAPSTAYVGSHYPTAGSSSSTV 441

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE-------LYNEKESSHNTI 299
                 TPLS +   +K+++N L     T     +   +         L+          
Sbjct: 442 CPTATITPLSTDKTALKAQINGLTVGGATAGQIGLAWGWYMVAPNFGYLWPNASQRPAAY 501

Query: 300 GSTRLKKFVIFITDGENS--------------------------GASAYQNTLNTLQICE 333
            +  L K VI +TDG  +                           A+   +     ++C+
Sbjct: 502 KARDLMKVVILMTDGGFNMTYCNSVVARNIGSGTNIGDDERINCDATNGSSFDQAAELCD 561

Query: 334 YMRN--AGMKIYSVAV--SAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
            ++     + +Y+V          ++ L  C  S+ + +      EL  SF  I  +I  
Sbjct: 562 SIKASANDITLYTVGFTVGNDQTARNFLTNCASSTDKAYFPATGSELKASFQAIAQEISN 621

Query: 390 QSV 392
             +
Sbjct: 622 LRI 624



 Score = 51.1 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 67/260 (25%), Gaps = 3/260 (1%)

Query: 17  IDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGS 76
           +D+  +   R QMQ ALDAA L    S  +     D T      + I    +       +
Sbjct: 49  LDVGRLSLQRRQMQDALDAATLMAARSTATSSADLDTTGDAAFLAEIAGMNLGLTASSST 108

Query: 77  YIRENAGDIAQKAQINITKDKNNPLQY-IAESKAQYEIPTENLFLKGLIPSALTNLSLRS 135
           +       +   A   +     N  Q       A  E+   +  L+  +   +T      
Sbjct: 109 FSAGTNNRVIGTATATLRPIIANLWQSGNFTVTASSEVVRASKNLEIALVLDITGSMGNG 168

Query: 136 TGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
           T I +       +   +V D                +   +         +     K  T
Sbjct: 169 TRIADLKVAAADLVDVLVRDTQTPFYS--KMALVPYSAGVNVGATYADAVRGPVPVKTIT 226

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
            + +A   A +   I     +                   VR  T   +      +  P 
Sbjct: 227 GAAWASGSARSITGITRANPAVVTASGHGLSTGDYVYITGVRGMTSVNDKIYRVTRSDPD 286

Query: 256 SNNLNEVKSRLNKLNPYENT 275
             +LN   +          T
Sbjct: 287 KVSLNSTNTSSASNYTNGGT 306


>gi|27367909|ref|NP_763436.1| aerotolerance operon protein BatA [Vibrio vulnificus CMCP6]
 gi|27359482|gb|AAO08426.1| BatA (Bacteroides aerotolerance operon) [Vibrio vulnificus CMCP6]
          Length = 323

 Score = 86.1 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 67/203 (33%), Gaps = 47/203 (23%)

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                ++  +       +               R+G + +         TPL+ +   V 
Sbjct: 107 GDYIDRLSAVKNVVTQFIEQ---------RQGDRLGLVLFADHAYLQ--TPLTADRQTVA 155

Query: 264 SRLNK--LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++LN+  +      T     +  A +   +          S   ++ VI ++DG N+   
Sbjct: 156 NQLNQTIIGLIGQKTAIGDGLALATKTFVD----------SEAPQRVVILLSDGSNTAG- 204

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAP-----------------PEGQDLLRKCTD- 362
               TL+ ++     +  G+KIY++ + A                     +  L K    
Sbjct: 205 ----TLDPIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTSADLDEKTLTKVATM 260

Query: 363 SSGQFFAVNDSRELLESFDKITD 385
           + GQ+F   D++EL   +  I  
Sbjct: 261 TGGQYFRARDAQELQTIYQAINQ 283


>gi|150024244|ref|YP_001295070.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
 gi|149770785|emb|CAL42250.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
          Length = 333

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 58/179 (32%), Gaps = 44/179 (24%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELY 289
            S RIG + Y         TP++++   V   +N +       + T     +  A   L 
Sbjct: 128 QSDRIGVVVYTAEAYTK--TPVTSDKAVVLDAINTIKYDNVLQDGTGIGMGLATAVNRL- 184

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
                      S    K +I +TDG N+        +  +   E+ +  G+K+Y++ +  
Sbjct: 185 ---------KDSKAKSKVIILMTDGVNNAG-----FIEPVTAAEFAKEFGIKVYTIGIGT 230

Query: 350 PPE----------------------GQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD 385
                                     + L++     + G++F    +  L   + +I  
Sbjct: 231 NGNAPFPYAIAPNGGFLYKMLPVEIDEQLMKDIAKKTGGKYFRAQSNSSLESIYSEINK 289


>gi|319425442|gb|ADV53516.1| lipoprotein with VWA and DUF3520 domains [Shewanella putrefaciens
           200]
          Length = 638

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/363 (11%), Positives = 95/363 (26%), Gaps = 36/363 (9%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+      +   I          S  +     K  ++  + ++    I    +I I+ 
Sbjct: 108 ASLA-AKQRSAKHVINTHYVAAPIASDAW--YGIKQPERNRFEKQIQNGIMVAGEIPIS- 163

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
                     +    Y      +    L       +                +       
Sbjct: 164 ----TFSIDVD-TGSYSTLRRMIKEGSLPEKGTIRIEEMLNYFTYDY----PLPNKNAAP 214

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
            S + E      ++D   +            +   S              +  K+ +L  
Sbjct: 215 FSVTTELAPSPYNDDMMLLRIGLKGYELTKSELGASNLVFL-LDVSGSMASADKLPLLQT 273

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L   +            ++  + Y             +++  +   L +L    +T
Sbjct: 274 ALKMLTQQLSAQD--------KVSIVVYAGAAGVVLDGASGDDIQALTYALEQLRAGGST 325

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +  AY+                     VI  TDG+ +      N    + + E  
Sbjct: 326 NGSQGILQAYQLAQKHFIQGGINR--------VILATDGDFNVGV--TNFDQLISLIEKE 375

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +  G+ + ++          L+ +  D   G +  ++    L E+   + D++    + I
Sbjct: 376 KQRGIGLTTLGFGMGNYNDQLMEQLADKGNGHYAYIDT---LNEARKVLVDELSSTLLTI 432

Query: 395 APN 397
           A +
Sbjct: 433 AKD 435


>gi|34558787|gb|AAQ75132.1| BatA protein [Alvinella pompejana epibiont 6C6]
          Length = 300

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 57/145 (39%), Gaps = 21/145 (14%)

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
           G      +PL+ +L  +    + ++       NT    A+  A + L +           
Sbjct: 133 GSFSFSASPLTYDLKALLEMFDLMSDVGIAGNNTAIGDAIFEAIKNLESG---------- 182

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCT 361
               K +I +TDG+++                  +  G+KIY+V +      + LL K  
Sbjct: 183 EAKSKVIILLTDGKHNFGKKSPKEGVV-----EAKKRGIKIYTVGIGTD-YDKKLLEKMA 236

Query: 362 -DSSGQFFAVNDSRELLESFDKITD 385
            +++ + F   +S+EL E F +I +
Sbjct: 237 KETNAKSFFAKNSKELEEVFKEIEE 261


>gi|332232505|ref|XP_003265445.1| PREDICTED: collagen alpha-5(VI) chain [Nomascus leucogenys]
          Length = 2526

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 64/167 (38%), Gaps = 13/167 (7%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +  +  +K+ +I ITDG++       +T         +R+ G+ I++V V 
Sbjct: 905 TEE----HGSRINQNVKQMLIVITDGKSHDHDQLNDT------ASELRDKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
                Q  L     +      V++  +L + F  + + +  ++  + 
Sbjct: 955 K--ANQKELEGMAGNKNNAIYVDNFDKLKDVFTLVQESMCTEASEVC 999



 Score = 70.3 bits (170), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/166 (11%), Positives = 58/166 (34%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAILNIKQITGGTYTGRALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG         +    ++  + +R   + I++
Sbjct: 529 LQIIKNGMKDRMSK-----VPCYLIVLTDGM--------SADRVVEPAKRLRAEQITIHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICTE 619



 Score = 57.2 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 52/165 (31%), Gaps = 17/165 (10%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVARDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            V      +  L + +      F V +   L     K+  ++   
Sbjct: 762 GV--YNANRSQLEEISGDGSLVFHVENFDHLKALERKLVFRVCAL 804



 Score = 42.6 bits (98), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/162 (11%), Positives = 50/162 (30%), Gaps = 17/162 (10%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLNPYENT-NTYPAMHHAYRELYNE 291
              R+    Y+               + + + L         +     A+  A+R  ++ 
Sbjct: 65  NKYRVALAQYSDEFHSEFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALREAHRTYFSA 124

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
             +  +          V+  +          ++     +  + ++  G+KI  ++V    
Sbjct: 125 HTNGRDKK--QFPPILVVLAS---------AESEDEVEEASKALKKDGVKI--ISVGVQE 171

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++ L+    S    F +   R+L   F +   +I +   +
Sbjct: 172 ASEENLKAMATSH-FHFNLRTIRDLST-FSQNMTQIIKDVTK 211


>gi|193214188|ref|YP_001995387.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
 gi|193087665|gb|ACF12940.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
          Length = 340

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 67/202 (33%), Gaps = 42/202 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----EN 274
           N + + +    +  +  +                 PL+ +   + + +++L       + 
Sbjct: 119 NRIEAAKSVATDFIHQRLSDRIGLVVFSGKSFTQCPLTLDYRLLTNFISELKAGTIEEDG 178

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T    A+  A   L            ST   K +I +TDG+N+        +  +   E 
Sbjct: 179 TAIGTAIATATNRL----------RESTAKSKVIILLTDGQNNAG-----EIEPVTAAEL 223

Query: 335 MRNAGMKIYSVAVSA----------------------PPEGQDLLRKCTDSSGQFFAVND 372
               G+KIY+V                            +   L R    S G++F   D
Sbjct: 224 AAALGIKIYTVGAGTRGYARYPIPDPLFGKRYVQMKVDVDDSTLTRIARISGGRYFRATD 283

Query: 373 SRELLESFDKITDKIQEQSVRI 394
              L +++ +I D++++  V +
Sbjct: 284 LESLKKTYHEI-DELEKTKVEV 304


>gi|283778313|ref|YP_003369068.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
 gi|283436766|gb|ADB15208.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
          Length = 591

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 51/361 (14%), Positives = 100/361 (27%), Gaps = 40/361 (11%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
           TA+++ V    I +A+D+ ++  ++ Q+Q ++DAA L+G  S+V    I      +    
Sbjct: 30  TAVLMVVMLGMIAFAVDVGYMYTMQTQLQRSVDAAALAGAGSLVEGTDIAQAKATEYLVR 89

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESK--------AQYEI 113
                 +    ++    +             +   + N      E+            E 
Sbjct: 90  NPVGSSMTFVNEEEVPAKIAQFVAEHGDDFEVEAGEWNASTRSFETTNTLPSTLSVSMEY 149

Query: 114 PTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL---QKHND 170
           PT   F   ++     ++   S  +           I +VLD S SM D           
Sbjct: 150 PTMPTFFGKILGKDSFSIRASSVAMY------QPRDIMVVLDFSGSMNDDSTFEAFGKLG 203

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
            + + SN            +   T + K+A          D             +     
Sbjct: 204 RSWVESNLQQCWADIGNPTYGSLTFEPKWANCKGAVPT--DGSKPQIY---VEYRNTSVY 258

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY----R 286
             +       +    G      + LS      +          +TN+   +   +     
Sbjct: 259 VTSTLNLENVVLQFSGGTRQTFSGLSAKTGTFQ--------GSSTNSGKQITKVWVKSGN 310

Query: 287 ELYNEKESSHNTIG------STRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
            L  E  +            +  +KK     +       S         Q     +NAG 
Sbjct: 311 NLSGEGTNYGEPFDFSSSNMNNMVKKAFGLNSVSYPYNGSWDAYIDYCEQSSNSNKNAGY 370

Query: 341 K 341
           +
Sbjct: 371 R 371


>gi|170767616|ref|ZP_02902069.1| von Willebrand factor type A domain protein [Escherichia albertii
           TW07627]
 gi|170123950|gb|EDS92881.1| von Willebrand factor type A domain protein [Escherichia albertii
           TW07627]
          Length = 586

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/364 (10%), Positives = 106/364 (29%), Gaps = 24/364 (6%)

Query: 37  VLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKD 96
           VL+      + +       +    +    + + K           A              
Sbjct: 69  VLAETTQNETQQYTDQQALQGQLQAAPAYESVAKAKATRISNLGTARYQQFDDNPVKQVA 128

Query: 97  KNNPLQYIAES-KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
           +N    +  +     Y      L    L P     +             N   SI     
Sbjct: 129 QNPLATFSLDVDTGSYANVRRFLNQGQLPPPDAVRVEEMVNYFPSDWVINDKQSIPASKP 188

Query: 156 VSRSMEDLYLQKHNDNNNMTS-NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           +  +M         +          L      ++  + N            ++ ++ ++ 
Sbjct: 189 IPFAMRYELAPAPWNEQRTLLKVDILAQDLKSEALPASNLVFLIDTSGSMYSDERLPLIQ 248

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
            S   LV  +++           I  + Y         +   N+ +E+ + ++ LN   +
Sbjct: 249 SSLKLLVKELREQDN--------ISIVTYAGDSRIALPSTSGNHKDEINAAIDSLNARGS 300

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           TN    +  AY++                    ++  TDG+ +      +  +   + + 
Sbjct: 301 TNGGAGLEMAYQQAAKGFIKGGVNR--------ILLATDGDFNVG--IDDPKSIESMVKK 350

Query: 335 MRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            R +G+ + ++ V      + ++ +  D  +G +  ++    L E+   +  ++ +  V 
Sbjct: 351 QRESGVTLSTLGVGRDNYNEAMMVRIADVGNGNYSYIDT---LSEAQKVLNSEMHQTLVT 407

Query: 394 IAPN 397
           +A +
Sbjct: 408 VAKD 411


>gi|163850366|ref|YP_001638409.1| hypothetical protein Mext_0933 [Methylobacterium extorquens PA1]
 gi|163661971|gb|ABY29338.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 473

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 63/461 (13%), Positives = 134/461 (29%), Gaps = 90/461 (19%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +      +   +D    +  + ++ +A DAA L+G  +   +    +       T
Sbjct: 25  LFALAVLPTIGLVGLGVDYGMAISSKTRLDNAADAAALAGVVT-AKEFIAANAQQSDVMT 83

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + I   + +          +        +Q+ I +          ++   Y    ++   
Sbjct: 84  AGIKAGEYQALKAFNVNASKVPFATVSLSQLEIVRS-----GQTLDATVSYTATVQST-F 137

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L   + T L+ R     + +     +   +++DVS SM         D++        
Sbjct: 138 GRLFGLSATTLTNRVNASADIA---GYLDFYLMVDVSGSMGLPTT----DSDAALLASKS 190

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
           +       F      +  +  A      + D +  +   L++   K I        RIG 
Sbjct: 191 VEDQGNCQFACHFPNRKGWNLAAGKIQLRSDAVNNAVCALLDRASKPIV---PNQYRIGI 247

Query: 241 IAYNIG-IVGNQCTPLSNNLNEVKSRLN----------KLNPYENT-------------N 276
             +          +  + +L  +K+  +           L    +T             +
Sbjct: 248 YPFINRLATLAPLSDTTTSLASLKTTADCGKAWPLAFTNLLDTGSTQLFTNNDPTTGTGS 307

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA--------------- 321
                  A  ++ +   +  N   S   K FV  ITDG  +  +                
Sbjct: 308 GGTHFETALPQMKSTIRTFGNGSSSANPKPFVFLITDGMQNSQTYSSWKDKKTYPGNPSK 367

Query: 322 -------YQNTLNTLQI----CEYMRNAGMKIYSVAV----------------------S 348
                    +     QI    C  ++ AG  I  + +                       
Sbjct: 368 FAGYRYADWDGSQPAQIDPAKCADLKKAGATISILYIPYNYVKSYTNEGTIVWENNRVNG 427

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
             P   D LR+C    G FF  N ++++  S   + D+  +
Sbjct: 428 FSPTLADPLRQCAS-PGLFFTANSAKDITASLGAMFDQALK 467


>gi|120599917|ref|YP_964491.1| von Willebrand factor, type A [Shewanella sp. W3-18-1]
 gi|120560010|gb|ABM25937.1| von Willebrand factor, type A [Shewanella sp. W3-18-1]
          Length = 638

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/363 (11%), Positives = 96/363 (26%), Gaps = 36/363 (9%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+      +   I          S  +     K  ++  + ++    I    +I I+ 
Sbjct: 108 ASLA-AKQRSAKHVINTHYVAAPIASDAW--YGIKQPERNRFEKQIQNGIMVAGEIPIS- 163

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
                     +    Y      +    L       +                +       
Sbjct: 164 ----TFSIDVD-TGSYSTLRRMIKEGSLPEKGTIRIEEMLNYFTYDY----PLPNKNAAP 214

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
            S + E      ++D   +            +   S              +  K+ +L  
Sbjct: 215 FSVTTELAPSPYNDDMMLLRIGLKGYELTKSELGASNLVFL-LDVSGSMASADKLPLLQT 273

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L   +            ++  + Y             +++  +   L +L    +T
Sbjct: 274 ALKMLTQQLSAQD--------KVSIVVYAGAAGVVLDGASGDDIQALTYALEQLRAGGST 325

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +  AY+                     VI  TDG+ +      + L  + + E  
Sbjct: 326 NGSQGILQAYQLAQKHFIQGGINR--------VILATDGDFNVGVTNFDLL--ISLIEKE 375

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +  G+ + ++          L+ +  D   G +  ++    L E+   + D++    + I
Sbjct: 376 KQRGIGLTTLGFGMDNYNDQLMEQLADKGNGHYAYIDT---LNEARKVLVDELSSTLLTI 432

Query: 395 APN 397
           A +
Sbjct: 433 AKD 435


>gi|156616290|ref|NP_001096078.1| collagen alpha-6(VI) chain precursor [Homo sapiens]
 gi|189082902|sp|A6NMZ7|CO6A6_HUMAN RecName: Full=Collagen alpha-6(VI) chain; Flags: Precursor
          Length = 2263

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/335 (12%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 305 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 364

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 365 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 424

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 425 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAPHK-----V 473

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 474 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 533

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ +      Q 
Sbjct: 534 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGI--KEANQT 578

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 579 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTE 613



 Score = 73.4 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 106/355 (29%), Gaps = 36/355 (10%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 839  ADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHM 898

Query: 117  NL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L V     D        
Sbjct: 899  FTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGIL-VLAVGIDGANPVELL 957

Query: 171  NNNMTSNKYLLPPPPKKSF--WSKNTTKSKYAPAPAPANRKIDVL---IESAGNLVNSIQ 225
                +S+KY            +S  T     +        K+D++     S     N  +
Sbjct: 958  AMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFK 1017

Query: 226  KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENT 275
            K            +     VRIG   ++                E+  ++  +     NT
Sbjct: 1018 KMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNT 1077

Query: 276  NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
            +   A+    RE+ +       +  +T   + ++ +TDG++             Q  E +
Sbjct: 1078 HIGAAL----REVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEAL 1125

Query: 336  RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            R+ G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1126 RHRGIDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTT 1178



 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 657 DRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 716

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 717 GARP------NIRKFLILITDGEAQD--------IVKEPAVVLRQEGVIIYSVGVFGSNV 762

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 763 ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 799


>gi|311268548|ref|XP_003132103.1| PREDICTED: collagen alpha-5(VI) chain-like [Sus scrofa]
          Length = 2519

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 104/370 (28%), Gaps = 34/370 (9%)

Query: 29  MQSALDAA-VLSG--CASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDI 85
           + S  D A  LS    ++  ++   +          +     ++K  ++G      +   
Sbjct: 274 LMSYSDRAETLSVLKSSTSQAEFQKQIQKLSLRAGKSNVGAAVEKMRREGFSASSGSRRA 333

Query: 86  AQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLS--LRSTGIIERSS 143
               QI +          + E+     +    +F  G+  +  T L   +        S 
Sbjct: 334 LGVPQIAVLVTNRPSDDEVREATLNLRLDDVTVFAMGIHGANKTQLEEIVSYPPRQTISM 393

Query: 144 ENLAISICMVLDVSRSMEDLYLQKHNDNNN--MTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
                 +    +         +             +K       +   +           
Sbjct: 394 LESYADLGNYTNNFLKKLQNEIWSQISTKAEQKELDKTGCVDTKEVDIYFLID------- 446

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
                + + D   +    ++  I+          VR+G + Y+                 
Sbjct: 447 --GSGSIRSDHFEQIKKFMLEVIENFDIGPDK--VRVGAVQYSDTREKEFDITDYTTDET 502

Query: 262 VKSRLNKLN-PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           ++  ++ +      T T  A+    + +   +E   N      +  ++I +TDG      
Sbjct: 503 LRKAISNIRQLGGGTYTGEALDFILQIIKKGREQRINK-----VPCYLIVLTDGM----- 552

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESF 380
              +  + L+  E +R   + ++++ +      +  L++      +     +   L    
Sbjct: 553 ---SMDDVLEPAEKLRAENIAVHAIGIG--EANRTQLQQIAGKEERVSFGQNFDSLKNIK 607

Query: 381 DKITDKIQEQ 390
           +++   I  +
Sbjct: 608 NEVLHSICTE 617



 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 59/160 (36%), Gaps = 15/160 (9%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYREL 288
           +     V+ G + Y+     +    L++N + +   L  L+     T T  A+  A    
Sbjct: 843 DVGPNRVQFGALRYSNE--PDIIFYLNSNRSAIMEYLRSLSAKGGDTYTAKALERANILF 900

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDG++       +          +R  G+ IY+V V 
Sbjct: 901 TEE----HGSRIKQNVKQMLIIITDGKSHDHIHLSDK------ASKLRAKGIIIYAVGVG 950

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
                Q+ L     +      V++   L + +  + + + 
Sbjct: 951 --EANQEELETMAGNKHYTIHVSNFDSLKDVYQPLQESMC 988



 Score = 56.5 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 59/158 (37%), Gaps = 17/158 (10%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
              RIG + ++                E+   + +++P E NT T  A+      +    
Sbjct: 661 DKTRIGVVQFSDVTKEEFKLDTYFTQKEISDAIERMSPIEQNTLTGKAL----TSIEPYF 716

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
             S        ++KF+I ITDGE           +     + +R+ G+ I++V V     
Sbjct: 717 TESKGARS--MVRKFLILITDGEAQD--------DVRNPAKVLRDKGVVIFAVGVFR--A 764

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +  L + +  S   F V    +L E  +K+  ++   
Sbjct: 765 NRTQLEEISGDSSLVFQVESFSDLQEIENKLIFRVCAL 802


>gi|297671963|ref|XP_002814093.1| PREDICTED: collagen alpha-6(VI) chain-like [Pongo abelii]
          Length = 2291

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/335 (12%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 333 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 392

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 393 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 452

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 453 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAPHK-----V 501

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 502 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 561

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ V      Q 
Sbjct: 562 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGV--KEANQT 606

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 607 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTE 641



 Score = 71.9 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 48/355 (13%), Positives = 105/355 (29%), Gaps = 36/355 (10%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 867  ADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGNTYTAEALGFSDHM 926

Query: 117  NL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L V              
Sbjct: 927  FTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGIL-VLAVGIAGANPVELL 985

Query: 171  NNNMTSNKYLLPPPPKKSF--WSKNTTKSKYAPAPAPANRKIDVL---IESAGNLVNSIQ 225
                +S+KY            +S  T     +        K+D++     S     N  +
Sbjct: 986  AMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQQNDFK 1045

Query: 226  KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENT 275
            K            +     VRIG   ++                E+  ++  +     NT
Sbjct: 1046 KMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGAFIGEKEISFQIENIKQIFGNT 1105

Query: 276  NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
            +   A+    R++ +       +  +T   + ++ +TDG++             Q  E +
Sbjct: 1106 HIGAAL----RKVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEAL 1153

Query: 336  RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            R+ G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1154 RHRGIDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTT 1206



 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 685 DRVQIGAVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 744

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 745 GARP------NVRKFLILITDGEAQD--------IVKEPAIALRQEGVIIYSVGVFGSNV 790

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 791 ---TQLEEISGRPEMVFYVENFDILQRVEDDLVFGICSPR 827


>gi|218778177|ref|YP_002429495.1| von Willebrand factor type A [Desulfatibacillum alkenivorans AK-01]
 gi|218759561|gb|ACL02027.1| von Willebrand factor type A [Desulfatibacillum alkenivorans AK-01]
          Length = 558

 Score = 85.7 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/305 (13%), Positives = 91/305 (29%), Gaps = 31/305 (10%)

Query: 95  KDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVL 154
            D  +      +  A Y      L    + P     +            +        + 
Sbjct: 105 YDPLSTFSIDVD-TASYSNVRRFLSYGNMPPVDAVRIEEMINYFHYDYPQPKGQDPFSI- 162

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
               +ME      + DN  +           K    S              +  K+ ++ 
Sbjct: 163 ----TMEMSQCPWNRDNMLVHVGLQGRCLDYKDVKPSNLVFL-LDVSGSMNSENKLPLVK 217

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN 274
            S   LV  +            R+  + Y         +  + N  ++ + L++L    +
Sbjct: 218 RSMEMLVKELGAGD--------RVSIVTYAGSAGLVLPSTSARNKRKIITALDRLEAGGS 269

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T     +  AYR      E+      +      VI  TDG+ +   +    L  +++ E 
Sbjct: 270 TAGGEGIELAYRV---AWENLIPEGNN-----RVILCTDGDFNVGVSSTPEL--VRMIEE 319

Query: 335 MRNAGMKIYSV-AVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSV 392
            R AG+ + ++          + +   +++  G F+ ++  RE  + F      ++    
Sbjct: 320 KRRAGIYL-TICGFGMGNYKDEKMEAISNAGNGNFYYIDSRREAHKVF---VQDMRANMF 375

Query: 393 RIAPN 397
            +A +
Sbjct: 376 TLAKD 380


>gi|146340337|ref|YP_001205385.1| hypothetical protein BRADO3364 [Bradyrhizobium sp. ORS278]
 gi|146193143|emb|CAL77155.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 470

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 50/473 (10%), Positives = 125/473 (26%), Gaps = 103/473 (21%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++      +  A+D    +  + Q+                +         +    
Sbjct: 20  IFALMMVPTIYLLGMALDYTQALRKQGQL--------------DAAADAAAIAAVRPAML 65

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENL-F 119
           S      +K         +     +      +IT   +       +   Q      ++  
Sbjct: 66  SVTDTSVVKNTAAAVFATKAAMNGLTAVPTPDITVTDSG-----LQRTIQVSYVARSINN 120

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY 179
              ++ S    +   +T           ++  ++LD S SM     Q   DN    ++K 
Sbjct: 121 FPSVLGSPSWQVKGSATAQAS---SAPNMNFYLLLDDSPSMAIAATQTDIDNLIAATSKQ 177

Query: 180 L-----------LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAI 228
                          P   S  S +T  +           +ID+++ +   L+       
Sbjct: 178 PGGSKNCGFACHEVHPNLDSGASSSTVDNLSIARSKSITLRIDLVVNAVKQLLVGPYTCP 237

Query: 229 QEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK---------SRLNKLN--------- 270
           Q   +  V     A N             NLN ++         ++++ +          
Sbjct: 238 QAGISGGVMQCMSAINNTTYKAAIYTFDYNLNTIQTLTSPSSAGTKISNIQLLTVDHQNC 297

Query: 271 -------PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
                      T+   A+      + +    +         ++ V  +TDG      A  
Sbjct: 298 VTTAICNTDFGTDISGALGGVNAIMPD--PGTGTNQSGDTPQEVVFLVTDGVEDKLIASS 355

Query: 324 NTLNTL--------------------QICEYMRNAGMKI---YSVAVSAPPEG------- 353
           +  +                       +C+ ++   ++I   Y+  +    +        
Sbjct: 356 SGCDPKATYPLPAAGSQVRCQQPLNTAVCDTIKKRNIRIAILYTEYLQLTTDNWYNSRIA 415

Query: 354 ------------QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
                          L+ C  S   F  V    ++ ++  K+  ++   + ++
Sbjct: 416 QFNSPSSLSGTIAQRLQACASSPDFFATVQTGGDISDALTKLFLRVASSTAKL 468


>gi|254372185|ref|ZP_04987677.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151569915|gb|EDN35569.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 339

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 74/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 112 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 169

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K +I +TDGEN+    
Sbjct: 170 MLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG-- 217

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 218 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 274

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 275 GGKYFRAQNSSDLKKVYESIDK 296


>gi|332817903|ref|XP_003310057.1| PREDICTED: collagen alpha-6(VI) chain [Pan troglodytes]
          Length = 2263

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/335 (11%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 305 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 364

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 365 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 424

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 425 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAPHK-----V 473

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 474 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 533

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ +      Q 
Sbjct: 534 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGI--KEANQT 578

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V++   L +  +++  +I  +
Sbjct: 579 QLREIAGEEKRVYYVHNFDALKDIRNQVVQEICTE 613



 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 106/355 (29%), Gaps = 36/355 (10%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 839  ADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHM 898

Query: 117  NL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L V     D        
Sbjct: 899  FTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGIL-VLAVGIDGANPMELL 957

Query: 171  NNNMTSNKYLLPPPPKKSF--WSKNTTKSKYAPAPAPANRKIDVL---IESAGNLVNSIQ 225
                +S+KY            +S  T     +        K+D++     S     N  +
Sbjct: 958  AMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFK 1017

Query: 226  KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENT 275
            K            +     VRIG   ++                E+  ++  +     NT
Sbjct: 1018 KMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNT 1077

Query: 276  NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
            +   A+    RE+ +       +  +T   + ++ +TDG++             Q  E +
Sbjct: 1078 HIGAAL----REVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEAL 1125

Query: 336  RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            R+ G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1126 RHRGIDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTT 1178



 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 657 DRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 716

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 717 GARP------NIRKFLILITDGEAQD--------IVKEPAVVLRQEGVIIYSVGVFGSNV 762

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 763 ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 799


>gi|114589213|ref|XP_516745.2| PREDICTED: hypothetical protein [Pan troglodytes]
          Length = 1859

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/335 (11%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 525 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 584

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 585 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 644

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 645 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAPHK-----V 693

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 694 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 753

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ +      Q 
Sbjct: 754 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGI--KEANQT 798

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V++   L +  +++  +I  +
Sbjct: 799 QLREIAGEEKRVYYVHNFDALKDIRNQVVQEICTE 833



 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 106/355 (29%), Gaps = 36/355 (10%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 1071 ADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHM 1130

Query: 117  NL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L V     D        
Sbjct: 1131 FTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGIL-VLAVGIDGANPMELL 1189

Query: 171  NNNMTSNKYLLPPPPKKSF--WSKNTTKSKYAPAPAPANRKIDVL---IESAGNLVNSIQ 225
                +S+KY            +S  T     +        K+D++     S     N  +
Sbjct: 1190 AMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFK 1249

Query: 226  KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENT 275
            K            +     VRIG   ++                E+  ++  +     NT
Sbjct: 1250 KMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNT 1309

Query: 276  NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
            +   A+    RE+ +       +  +T   + ++ +TDG++             Q  E +
Sbjct: 1310 HIGAAL----REVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEAL 1357

Query: 336  RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            R+ G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1358 RHRGIDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTT 1410



 Score = 63.8 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234  LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
              V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 889  DRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 948

Query: 293  ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
             +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 949  GARP------NIRKFLILITDGEAQD--------IVKEPAVVLRQEGVIIYSVGVFGSNV 994

Query: 352  EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                 L + +      F V +   L    D +   I    
Sbjct: 995  ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 1031


>gi|315650876|ref|ZP_07903919.1| von Willebrand factor type A domain protein [Eubacterium saburreum
           DSM 3986]
 gi|315486855|gb|EFU77194.1| von Willebrand factor type A domain protein [Eubacterium saburreum
           DSM 3986]
          Length = 526

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/348 (9%), Positives = 92/348 (26%), Gaps = 31/348 (8%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+GC+S              +    + +           Y  E    I +    +++ 
Sbjct: 23  ASLAGCSSAGRTYEATKSAFDSNDAGKMVEYYS----PNVGYNTEEYNIINESGFQSVST 78

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
              +      +  A Y      +    L P+    +            +          D
Sbjct: 79  SPLSTFAADVD-TASYANIRRFITDGELPPADAVRIEEMLNYFYYDYPQPKD-------D 130

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
              S+         + +       L       +    N        A      K+ ++  
Sbjct: 131 EPFSVTTEISSCPWNPDTKLMQIGLQAKNTDTTTKPSNLVFLIDVSASMDEPDKLPLVKN 190

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L + +++           I  + Y             ++   + S +  L    +T
Sbjct: 191 AFLLLCDELKENDT--------ISIVTYAGTDSVVLEGAKGSDKKSIMSAIEDLTAGGST 242

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  AY+      ++  N          V+  TDG+ +      +    +++ +  
Sbjct: 243 AGSDGIKTAYKIAEKYFKTEGNNR--------VVLATDGDLNVG--ITSEGELIKLIKKE 292

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDK 382
           + + + +  +         + ++   D+  G +  ++   E  +    
Sbjct: 293 KESNIFLSVLGFGTDNIKDNKMQSLADNGDGNYSYIDSRFEAKKVLSD 340


>gi|170743327|ref|YP_001771982.1| hypothetical protein M446_5224 [Methylobacterium sp. 4-46]
 gi|168197601|gb|ACA19548.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 478

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/455 (11%), Positives = 111/455 (24%), Gaps = 80/455 (17%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+ +      +  A+D       +  +  A         A++ +  T K         
Sbjct: 28  LFALSLIPVLGLVGLAVDYGLAAADKTTLDHAA------DTAALAAVVTAKSYIAANQGQ 81

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           + +    I   L Q + +          AQ+ +   +         +   Y    +N   
Sbjct: 82  ANLTANAIAAGLAQAANVFAVNAGSVPFAQVTLQPPQLVRSGQTLTATVSYGATIQNS-F 140

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+ +  T L    T   +       +   +++DVS SM               +    
Sbjct: 141 GKLLGTPTTLLGNSVTASADL---PSYLDFYLLVDVSGSMGLPATPGGMTQLASVNKDMW 197

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F       + +  A      + D +  +  +L+              V I  
Sbjct: 198 SDYQQGCQFACHFPGFTGWGLAAGKIQLRSDAVNAAVCSLIQRA-STPAVPNQYRVGIYP 256

Query: 241 IAYN-----------------IGIVGNQCTPLSN--NLNEVKSRLNKLNPYENTNTYPAM 281
                                     +     +N  +    +            +     
Sbjct: 257 FINQMATLVGITGSVASLNAAAQCALSWPLAFTNLLDTGTTQLFAYGDPTTGTASGGTHF 316

Query: 282 HHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----------- 330
                +L    ++  +   ST  K FV  ITDG  +G         T             
Sbjct: 317 EVVMPQLQAAIKAFGDGSSSTSPKPFVFLITDGMQNGQHYGAPANGTYAYPGNPSSFWGY 376

Query: 331 ----------------ICEYMRNAGMKIYSVAV----------------------SAPPE 352
                           +C  +++AG  I  +++                         P 
Sbjct: 377 ADAWWDGSQPSQIDPTVCAGLKSAGATISILSIPYNLITFVNNGGGVAWENNRVSGFSPT 436

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
               L+ C    G F   N   ++  S + + D+ 
Sbjct: 437 LATPLKACAS-PGFFATANTPADITASLNAMFDQA 470


>gi|328676285|gb|AEB27155.1| BatA in aerotolerance operon [Francisella cf. novicida Fx1]
          Length = 333

 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 74/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 106 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 163

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K +I +TDGEN+    
Sbjct: 164 MLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG-- 211

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 212 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 268

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 269 GGKYFRAQNSSDLKKVYESIDK 290


>gi|328675375|gb|AEB28050.1| BatA in aerotolerance operon [Francisella cf. novicida 3523]
          Length = 333

 Score = 85.3 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 77/205 (37%), Gaps = 47/205 (22%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           +      + D+++  A   +++ +           R+G I +         TPL+ ++  
Sbjct: 112 SNGQMESRFDLVMRVANQFLDTRK---------GDRVGLILFGTRAYLQ--TPLTFDIAT 160

Query: 262 VKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
           VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+ 
Sbjct: 161 VKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNS 210

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCT 361
                 TL  LQ  E  +   +KIY++ +                  +      +L K  
Sbjct: 211 G-----TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLINTSEDLDTTVLEKIA 265

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
           + + G++F   +S +L + ++ I  
Sbjct: 266 EMTGGKYFRAQNSSDLKKVYESIDK 290


>gi|307941490|ref|ZP_07656845.1| von Willebrand factor, type A [Roseibium sp. TrichSKD4]
 gi|307775098|gb|EFO34304.1| von Willebrand factor, type A [Roseibium sp. TrichSKD4]
          Length = 611

 Score = 85.3 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/319 (10%), Positives = 88/319 (27%), Gaps = 26/319 (8%)

Query: 79  RENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGI 138
            E   +        +  D  +      +  A Y      L   G                
Sbjct: 126 TERFPEAESNPLKQVKTDPVSTFSVDVD-TASYAFVRSELVNGGKPNPDAVRAEEMINYF 184

Query: 139 IERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSK 198
                   +       +VS             +  +      L   P ++      T   
Sbjct: 185 QYDYKVPDSREAPFSTNVSVVETPWNSDTKLLHIGLKGYTVPLDDLPPQNLVFLIDTSG- 243

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
                     K+ +L ++   L++++++           I  + Y             ++
Sbjct: 244 ----SMSDENKLPLLQQAFRLLLSTLREDDT--------IAIVTYAGNAGVLLEPTALSD 291

Query: 259 LNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
            +++   +  L    +T  +  +  AYR     ++           K  +I  TDG+ + 
Sbjct: 292 KSKIAEAIAALTSGGSTAGHAGLKEAYRLAETMQD--------DDTKSRIILATDGDFNV 343

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
             +  +  +  +  +  R++G+ +  +         +L++    +            L E
Sbjct: 344 GLSSAD--DMKRFVKEKRDSGITLSVLGFGRGNYNDELMQALAQNGNGV--AAYIDTLSE 399

Query: 379 SFDKITDKIQEQSVRIAPN 397
           +   + D+I      IA +
Sbjct: 400 ARKVLVDQIVSSISTIAQD 418


>gi|85374662|ref|YP_458724.1| von Willebrand factor type A domain-containing protein
           [Erythrobacter litoralis HTCC2594]
 gi|84787745|gb|ABC63927.1| von Willebrand factor type A domain protein [Erythrobacter
           litoralis HTCC2594]
          Length = 580

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/368 (10%), Positives = 101/368 (27%), Gaps = 30/368 (8%)

Query: 31  SALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQ 90
           +A  A V+SG           D + +  + +    + +   +      RE          
Sbjct: 60  AAQQAVVVSGSRIASEAAVAPDTSGQPAEAAGREYRYVMPVIVPQPEDRERYDGEEVSPV 119

Query: 91  INITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISI 150
                +  +      +    Y      L    + P A                     S 
Sbjct: 120 KIAAVEPLSTFSVDVD-TGAYANARRFLSQGQMPPKAAVRTEEFINYFRYDYDRPQDRSQ 178

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
              ++   +              +          P  +                    K+
Sbjct: 179 PFTVNFDAARTPWNEDTRLIRIGLAGYDIERSERPPANLV-----FLMDVSGSMGRPDKL 233

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
            ++  +   L   +Q           +                  +N+  ++++ LN+L 
Sbjct: 234 PLVKTALAGLAGELQ----------PQDKVSIVVYAGAAGLVLEPTNDTRKIRAALNQLQ 283

Query: 271 PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ 330
              +T     +  AY+   +                 VI  TDG+ +   + ++ L  ++
Sbjct: 284 AGGSTAGGAGIQLAYQIAEDNFIEGGVNR--------VILATDGDFNVGVSSRDAL--IE 333

Query: 331 ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQE 389
           + E  R++G+ + ++        + ++ +  +   G +  ++ + E  +    + D++  
Sbjct: 334 MIEKKRDSGITLTTLGFGTGNYNEAMMEQIANHGNGNYAYIDSALEAKKV---LGDEMSS 390

Query: 390 QSVRIAPN 397
               IA +
Sbjct: 391 TLFTIAKD 398


>gi|205353430|ref|YP_002227231.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205273211|emb|CAR38174.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
          Length = 499

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 70/190 (36%), Gaps = 22/190 (11%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ 
Sbjct: 155 RLPLIQSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDN 206

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L+ Y +T     +  AY +                    ++  TDG+ +      +  + 
Sbjct: 207 LDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDI 256

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
             + +  R  G+ + ++ V      + ++ +  D  +G +  +     L E+   + D++
Sbjct: 257 EALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIYS---LSEAQKVLKDEM 313

Query: 388 QEQSVRIAPN 397
            +  V +A +
Sbjct: 314 HQTLVTVAKD 323


>gi|326628521|gb|EGE34864.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 596

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 70/190 (36%), Gaps = 22/190 (11%)

Query: 209 KIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK 268
           ++ ++  +   LVN ++            I  + Y  G      +   NN   +K+ ++ 
Sbjct: 252 RLPLIQSALKLLVNDLRAQDN--------ITIVTYAGGTHVALASTAGNNTTAIKAAIDN 303

Query: 269 LNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           L+ Y +T     +  AY +                    ++  TDG+ +      +  + 
Sbjct: 304 LDAYGSTGGEAGLRLAYEQAEKGFIKGGVNR--------ILLTTDGDFNLG--ITDPKDI 353

Query: 329 LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKI 387
             + +  R  G+ + ++ V      + ++ +  D  +G +  +     L E+   + D++
Sbjct: 354 EALVKKEREKGITLSTLGVGDDNFNEAMMVRIADVGNGNYSYIYS---LSEAQKVLKDEM 410

Query: 388 QEQSVRIAPN 397
            +  V +A +
Sbjct: 411 HQTLVTVAKD 420


>gi|329963581|ref|ZP_08301060.1| von Willebrand factor type A domain protein [Bacteroides fluxus YIT
           12057]
 gi|328528570|gb|EGF55541.1| von Willebrand factor type A domain protein [Bacteroides fluxus YIT
           12057]
          Length = 327

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   + + L  +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           L   E  
Sbjct: 168 AIGMGIANAVTRL----------KDSKAKSKVIILLTDGVNNKGDIS-----PLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G++IY++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRIYTIGVGTNGMAPYPYPVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|332232509|ref|XP_003265447.1| PREDICTED: collagen alpha-6(VI) chain [Nomascus leucogenys]
          Length = 2264

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/335 (12%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 306 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 365

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 366 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 425

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 426 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSAVVGMFDIAPHK-----V 474

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 475 RVGAVQYADSWDLEFEINKYSNRQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 534

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ V      Q 
Sbjct: 535 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGV--KEANQT 579

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 580 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICAE 614



 Score = 73.0 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 48/355 (13%), Positives = 105/355 (29%), Gaps = 36/355 (10%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 840  ADVGKNQVRFGALKYADDPEVLFYLEDFGTKLEVISVLQNDQAMGGNTYTAEALGFSDHM 899

Query: 117  NL------FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L V              
Sbjct: 900  FTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGIL-VLAVGIAGANPAELL 958

Query: 171  NNNMTSNKYLLPPPPKKSF--WSKNTTKSKYAPAPAPANRKIDVL---IESAGNLVNSIQ 225
                +S+KY            +S  T     +        K+D++     S     N  +
Sbjct: 959  AMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFK 1018

Query: 226  KA---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENT 275
            K            +     VRIG   ++                E+  ++  +     NT
Sbjct: 1019 KMKEFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNT 1078

Query: 276  NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
            +   A+    R++ +       +  +T   + ++ +TDG++             Q  E +
Sbjct: 1079 HIGAAL----RKVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEAL 1126

Query: 336  RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            R+ G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1127 RHRGIDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICAT 1179



 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 658 DQVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 717

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 718 GARP------NIRKFLILITDGEAQD--------IVKEPAVVLRQEGVIIYSVGVFGSNV 763

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 764 ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 800


>gi|154089852|emb|CAO81741.1| collagen type VI alpha 6 [Homo sapiens]
          Length = 840

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/335 (12%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 304 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 364 LGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 423

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 424 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAPHK-----V 472

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 473 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQR 532

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ +      Q 
Sbjct: 533 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGI--KEANQT 577

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 578 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTE 612



 Score = 63.4 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 656 DRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 716 GARP------NIRKFLILITDGEAQD--------IVKEPAVVLRQEGVIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 762 ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 798


>gi|293361343|ref|XP_236593.5| PREDICTED: collagen type VI alpha 6 [Rattus norvegicus]
          Length = 2264

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/335 (11%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  ++K  K+    +  +       QI +          + ++          +F 
Sbjct: 304 QAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHRASDDNVTKAAVNLRREGVTVFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  +    L   ++   E+ +  L+    +       ++ L           +    +
Sbjct: 364 MGVEGANPEQLEKIASYPAEQFTSKLSNFSELATHNQTFLKKLRNQITHTVSVFSERTET 423

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +          P           +      +V+    A  +     V
Sbjct: 424 LKSACVDTEEADIYLLIDGSGNTQP------TDFHEMKIFLSEVVDMFNIAPHK-----V 472

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y              N  ++   ++ +      TNT  A++     L   K+  
Sbjct: 473 RVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNTNTGAALNFTLTLLQRAKKQR 532

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G +  +         L     +R   ++++++ V      Q 
Sbjct: 533 GNK-----VPCHLVVLTNGMSQDS--------VLGPAHKLREENIRVHAIGV--KEANQT 577

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V++   L +  +++  +I  +
Sbjct: 578 QLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAE 612



 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 102/354 (28%), Gaps = 34/354 (9%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 838  ADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHM 897

Query: 117  NLFL------KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L ++  +      +   
Sbjct: 898  FTEARGSRLHKGVPQVLIVITDGESHDAEKLNATAKALRDKGILVLAVGIAGANTWELLA 957

Query: 171  NNNMTSNKYLLPPPPK----KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                +   Y +          S  S +   S            + ++  S     +  QK
Sbjct: 958  MAGSSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQK 1017

Query: 227  A---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTN 276
                        +     VRIG   ++                E+ +++  +      T+
Sbjct: 1018 MKEFLASVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTH 1077

Query: 277  TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
               A+    R++ +       +  +    + ++ +TDG +             Q  E +R
Sbjct: 1078 IGDAL----RKVKHYFRPDTGSRINAGTPQVLLVLTDGRSQD--------EVAQAAEELR 1125

Query: 337  NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            + G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1126 HKGVDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNICTS 1177



 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + N++ + ++++      T T  A+    +    EK
Sbjct: 656 DRVQIGVVQFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 716 GARP------NVRKFLILITDGEAQD--------IVKDPAVALRKDGVIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 762 ---TQLEEISGKPEMVFYVENFDILQHIEDDLVLGICSPR 798


>gi|293349448|ref|XP_002727144.1| PREDICTED: collagen type VI alpha 6-like [Rattus norvegicus]
          Length = 2264

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/335 (11%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  ++K  K+    +  +       QI +          + ++          +F 
Sbjct: 304 QAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHRASDDNVTKAAVNLRREGVTVFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  +    L   ++   E+ +  L+    +       ++ L           +    +
Sbjct: 364 MGVEGANPEQLEKIASYPAEQFTSKLSNFSELATHNQTFLKKLRNQITHTVSVFSERTET 423

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +          P           +      +V+    A  +     V
Sbjct: 424 LKSACVDTEEADIYLLIDGSGNTQP------TDFHEMKIFLSEVVDMFNIAPHK-----V 472

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y              N  ++   ++ +      TNT  A++     L   K+  
Sbjct: 473 RVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNTNTGAALNFTLTLLQRAKKQR 532

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G +  +         L     +R   ++++++ V      Q 
Sbjct: 533 GNK-----VPCHLVVLTNGMSQDS--------VLGPAHKLREENIRVHAIGV--KEANQT 577

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V++   L +  +++  +I  +
Sbjct: 578 QLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAE 612



 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 102/354 (28%), Gaps = 34/354 (9%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 838  ADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHM 897

Query: 117  NLFL------KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L ++  +      +   
Sbjct: 898  FTEARGSRLHKGVPQVLIVITDGESHDAEKLNATAKALRDKGILVLAVGIAGANTWELLA 957

Query: 171  NNNMTSNKYLLPPPPK----KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                +   Y +          S  S +   S            + ++  S     +  QK
Sbjct: 958  MAGSSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQK 1017

Query: 227  A---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTN 276
                        +     VRIG   ++                E+ +++  +      T+
Sbjct: 1018 MKEFLASVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTH 1077

Query: 277  TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
               A+    R++ +       +  +    + ++ +TDG +             Q  E +R
Sbjct: 1078 IGDAL----RKVKHYFRPDTGSRINAGTPQVLLVLTDGRSQD--------EVAQAAEELR 1125

Query: 337  NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            + G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1126 HKGVDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNICTS 1177



 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + N++ + ++++      T T  A+    +    EK
Sbjct: 656 DRVQIGVVQFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 716 GARP------NVRKFLILITDGEAQD--------IVKDPAVALRKDGVIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 762 ---TQLEEISGKPEMVFYVENFDILQHIEDDLVLGICSPR 798


>gi|149018699|gb|EDL77340.1| rCG25821 [Rattus norvegicus]
          Length = 1513

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/335 (11%), Positives = 100/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  ++K  K+    +  +       QI +          + ++          +F 
Sbjct: 304 QAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHRASDDNVTKAAVNLRREGVTVFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  +    L   ++   E+ +  L+    +       ++ L           +    +
Sbjct: 364 MGVEGANPEQLEKIASYPAEQFTSKLSNFSELATHNQTFLKKLRNQITHTVSVFSERTET 423

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +          P           +      +V+    A  +     V
Sbjct: 424 LKSACVDTEEADIYLLIDGSGNTQP------TDFHEMKIFLSEVVDMFNIAPHK-----V 472

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y              N  ++   ++ +      TNT  A++     L   K+  
Sbjct: 473 RVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNTNTGAALNFTLTLLQRAKKQR 532

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G +  +         L     +R   ++++++ V      Q 
Sbjct: 533 GNK-----VPCHLVVLTNGMSQDS--------VLGPAHKLREENIRVHAIGV--KEANQT 577

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V++   L +  +++  +I  +
Sbjct: 578 QLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAE 612



 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 102/354 (28%), Gaps = 34/354 (9%)

Query: 57   KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTE 116
             D      +    K+      +        +   I++ ++          ++A       
Sbjct: 838  ADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHM 897

Query: 117  NLFL------KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
                      KG+    +      S    + ++   A+    +L ++  +      +   
Sbjct: 898  FTEARGSRLHKGVPQVLIVITDGESHDAEKLNATAKALRDKGILVLAVGIAGANTWELLA 957

Query: 171  NNNMTSNKYLLPPPPK----KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK 226
                +   Y +          S  S +   S            + ++  S     +  QK
Sbjct: 958  MAGSSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQK 1017

Query: 227  A---------IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTN 276
                        +     VRIG   ++                E+ +++  +      T+
Sbjct: 1018 MKEFLASVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTH 1077

Query: 277  TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
               A+    R++ +       +  +    + ++ +TDG +             Q  E +R
Sbjct: 1078 IGDAL----RKVKHYFRPDTGSRINAGTPQVLLVLTDGRSQD--------EVAQAAEELR 1125

Query: 337  NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            + G+ IYSV +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1126 HKGVDIYSVGIG--DVDDQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNICTS 1177



 Score = 66.9 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + N++ + ++++      T T  A+    +    EK
Sbjct: 656 DRVQIGVVQFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 716 GARP------NVRKFLILITDGEAQD--------IVKDPAVALRKDGVIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 762 ---TQLEEISGKPEMVFYVENFDILQHIEDDLVLGICSPR 798


>gi|146343040|ref|YP_001208088.1| hypothetical protein BRADO6230 [Bradyrhizobium sp. ORS278]
 gi|146195846|emb|CAL79873.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 519

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/491 (9%), Positives = 122/491 (24%), Gaps = 107/491 (21%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSA----------LDAAVLSGCASIVSDRTIK 51
            A+ +      I    D +  M ++ ++QSA          +++A  +   ++ SD ++ 
Sbjct: 29  FALALLPILTAIGCGTDYSMAMRLKVKLQSAADAASIASISVNSAGYAAAMAMTSDGSVT 88

Query: 52  DPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL---------- 101
               + D            +                 +Q+  T                 
Sbjct: 89  AGVNEADNIFKGNASTFGGYTLTSETSTVTKTRSTLSSQVQFTAAVPTTFLTVIGYQSIT 148

Query: 102 -----------------QYIAESKAQYEIPTENLFLKGLIPSA----------------- 127
                                +      +P+ +   + +   +                 
Sbjct: 149 VSGSSSSSVTLPLYLDFYLTLDVSGSMGLPSTSAEAQRMQAISPDNYRQYPTGCTLACHF 208

Query: 128 LTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKK 187
               S  +    +    N       +  VS+S     L  + +N         +      
Sbjct: 209 SPQNSACTDSGTQGYPTNNYCLGYAISRVSQSGYKSLLTTNKNNPKGVQLPSSIVSGLPN 268

Query: 188 SFWSKNTTKSKYAPAPAP--ANRKIDVLIESAGNLVNSIQKAIQEKKNLS---VRIGTIA 242
           S ++K  T +             ++D +  +   L  +     +                
Sbjct: 269 SLYNKLPTVANCPTDGTDDCIQLRLDAVGYAVNQLFTTANTTKKVANQFRIGLYPFIRYL 328

Query: 243 YNIGIVGNQCTPLSNNLNEVKSRLNKLNP-----------YENTNTYPAMHHAYRELYNE 291
           Y+   +    +  +++ + +      L                T+   A+      + + 
Sbjct: 329 YSYYPLTTNISGSTSDSSTINYAAANLATLLDTNTNASLGSGGTHIDTALSSVNSLITSV 388

Query: 292 KESSHNTIGSTRLKKFVIFITDGENS-----------GASAYQNTLNTLQICEYMRNAGM 340
            + S      T    +V  +TDG                S +  T+N    C  ++N G+
Sbjct: 389 GDGSAT----TNTLPYVFLVTDGAQDPQVKGVPNGSWSGSNHATTINPTTSCTPLKNRGI 444

Query: 341 KIYSVA------------VSAPPEGQDL---------LRKCTDSSGQFFAVNDSRELLES 379
            I  +              +   +             L+ C    G F+  N   ++  +
Sbjct: 445 IISVLYIPYQTINPVNASFAGDEDDYANNNIPNIPPSLQACAS-PGFFYTANTPADITSA 503

Query: 380 FDKITDKIQEQ 390
            + + +    +
Sbjct: 504 LNAMFNHAVSE 514


>gi|224047663|ref|XP_002193801.1| PREDICTED: vitrin [Taeniopygia guttata]
          Length = 746

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/352 (12%), Positives = 93/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + V+ + +++   K  Q   +            ++  +  G+      + +      P 
Sbjct: 416 KTYVNSKDLRNAIEKIQQKGGLSNVGKALSFVNKNFFLDANGNRGGAPNVVVVLVDGWPT 475

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E+         N+F   +  +A +                   S    ++V     
Sbjct: 476 DRVEEASRLARESGINIFFVTVAAAAQSEKQNVIEPNF-VDKAVCRTSGFYSINVPSWFS 534

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K    + +        +         VL   A    
Sbjct: 535 LHK---VVQPLVKRVCDTDRLACSKTCLNAADIGFVIDGSSSVGTGNFRTVLQFVAN--- 588

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
                   E  +   RIG + Y             +   +V + + +++     T+T  A
Sbjct: 589 ---ISKEFEISDTDTRIGAVQYTYEQRLEFSFDKYSTKQDVLNAIKRISYWSGGTSTGAA 645

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +A  +L++              +K +I ITDG +    +                 G+
Sbjct: 646 ISYASEQLFS--------KSKPNKRKIMILITDGRSYDDVSVP--------AMAAHQNGV 689

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSSG--QFFAVNDSRELLESFDKITDKIQEQ 390
             YSV V       D L            F V++   L    +++   I  +
Sbjct: 690 IAYSVGV--AWAAPDELEAIASDPAKEHSFFVDEFDNLYRYVNQLIQNICTE 739



 Score = 41.8 bits (96), Expect = 0.18,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 40/120 (33%), Gaps = 14/120 (11%)

Query: 238 IGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSH 296
           +G + Y              N  ++++ + K+      +N   A+    +  + +   + 
Sbjct: 400 MGIVQYGDDPSTEFNLKTYVNSKDLRNAIEKIQQKGGLSNVGKALSFVNKNFFLDANGNR 459

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
               +      V+ + DG  +            +     R +G+ I+ V V+A  + +  
Sbjct: 460 GGAPN-----VVVVLVDGWPTD--------RVEEASRLARESGINIFFVTVAAAAQSEKQ 506


>gi|254414936|ref|ZP_05028700.1| von Willebrand factor type A domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178425|gb|EDX73425.1| von Willebrand factor type A domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 576

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 46/365 (12%), Positives = 100/365 (27%), Gaps = 32/365 (8%)

Query: 34  DAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINI 93
           +AA L       SD      T    Q                   RE    I +   +  
Sbjct: 65  EAASL---PETQSDAENAPATKFAPQAQPSPGSNSLNRQVPEESNRETYSTIPENPFLKT 121

Query: 94  TKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMV 153
           + +  +      ++ A Y      +    L P     +            +  A     +
Sbjct: 122 SSNPLSTFSIDVDA-ASYSNVRRFINENRLPPPNAVRVEELINYFTYDYPQPQADKPFSI 180

Query: 154 LDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVL 213
                        K         +      PP    +  + + S           K+ +L
Sbjct: 181 TTEVAEAPWNSKHKLVHIGLQGKSISTENLPPSNLVFLLDVSGSMSDA------NKLPLL 234

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            E+   LV+ ++           ++  + Y             N  + + + ++KL    
Sbjct: 235 KEAFRLLVDQLRDED--------KVSIVVYAGAAGTVLPPTPGNQKDTILAAIDKLEAGG 286

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
           +T     +  AY+   +    S N          VI  TDG+ +      +    + + E
Sbjct: 287 STAGGQGIKLAYKLAQDNFIESGNNR--------VILATDGDFNVG--ISSDEQLVSLIE 336

Query: 334 YMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSV 392
             R   + +  +           + K  +   G +  +++  E  +    + ++I    +
Sbjct: 337 EKREQDIFLTVLGFGTGNLQDAKMEKIANKGNGNYAYIDNILEANKV---LVNEIGGTLL 393

Query: 393 RIAPN 397
            IA +
Sbjct: 394 TIAKD 398


>gi|194324498|ref|ZP_03058270.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
 gi|194321333|gb|EDX18819.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
          Length = 339

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 74/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 112 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 169

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K +I +TDGEN+    
Sbjct: 170 MLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG-- 217

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 218 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 274

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 275 GGKYFRAQNSSDLKKVYESIDK 296


>gi|163749961|ref|ZP_02157205.1| von Willebrand factor type A domain protein [Shewanella benthica
           KT99]
 gi|161330235|gb|EDQ01216.1| von Willebrand factor type A domain protein [Shewanella benthica
           KT99]
          Length = 648

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/333 (11%), Positives = 87/333 (26%), Gaps = 33/333 (9%)

Query: 66  KQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIP 125
               +   + ++ R  A  I    +I ++    +           Y      +    L  
Sbjct: 128 SAFSQASNRNNFARRTANGIMVVGEIPVSTFSIDTD------TGSYTTLRRWINQGRLPE 181

Query: 126 SALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPP 185
                +         + S    +     ++   +              +           
Sbjct: 182 KGTVRVEEMINYFNYQYSTPSTVEQPFSVNTELAPSPYNE----HKMLLRIGLKGYEVDK 237

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            +   S              +  K+ +L  S   L   + +           +  + Y  
Sbjct: 238 SQLGASNLVFL-LDVSGSMNSRDKLPLLKTSLKMLSQQLSEQD--------HVSIVVYAG 288

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                      N+   +   LN L    +TN    +  AYR                   
Sbjct: 289 ASGVVLDGVKGNDTQAINQALNSLKAGGSTNGGAGIQQAYRLAQKHFIQGGVNR------ 342

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS- 364
             VI  TDG+ +  +     L  L   +  R+ G+ + ++          L+ +  D   
Sbjct: 343 --VILATDGDFNVGTTDHQALMDLIAAK--RDQGIALTTLGFGQGNYNDHLMEQLADKGN 398

Query: 365 GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           G +  ++    L E+   + D++    + IA +
Sbjct: 399 GHYAYIDT---LNEARKVLVDELSSTLLTIAKD 428


>gi|118496821|ref|YP_897871.1| von Willebrand factor type A domain-containing protein [Francisella
           tularensis subsp. novicida U112]
 gi|118422727|gb|ABK89117.1| von Willebrand factor type A domain protein [Francisella novicida
           U112]
          Length = 333

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 74/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 106 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 163

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L      S          K +I +TDGEN+    
Sbjct: 164 MLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNSG-- 211

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 212 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 268

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 269 GGKYFRAQNSSDLKKVYESIDK 290


>gi|325954650|ref|YP_004238310.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
 gi|323437268|gb|ADX67732.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
          Length = 338

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 52/159 (32%), Gaps = 37/159 (23%)

Query: 254 PLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
           PL+ +   +   +N L      + T     +  A   +            S    K +I 
Sbjct: 146 PLTTDREVLIREINALESGELEDGTAIGIGLATAINHI----------KDSKAKSKVIIL 195

Query: 311 ITDGENS-GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP------------------- 350
           +TDG  S   +     ++     E   + G+K+Y++ +                      
Sbjct: 196 MTDGVESINPTNDLMYISPQTAAEMATSRGIKVYTIGIGTRGLAPFPTAYDMYGNYIFDM 255

Query: 351 ---PEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                 + LL+   D + G +F   D++ L + + +I  
Sbjct: 256 MPVDIDEKLLQNIADLTGGLYFRATDNQSLQKIYQEIDR 294


>gi|331697176|ref|YP_004333415.1| von Willebrand factor type A [Pseudonocardia dioxanivorans CB1190]
 gi|326951865|gb|AEA25562.1| von Willebrand factor type A [Pseudonocardia dioxanivorans CB1190]
          Length = 327

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 58/159 (36%), Gaps = 16/159 (10%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + +   VK  ++ L   E+T T  A+  A + + +   +   +         ++ ++DG+
Sbjct: 144 TTDRTAVKQAVDGLKLSESTATGEAIFAALQSIDSFSRTVAASGTEGPPPARIVLMSDGK 203

Query: 316 NSGASAY--QNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PEGQDLLRKC 360
            +        +   +    +      + + +++                       +++ 
Sbjct: 204 QTVPGPDGENDPRGSFTAAKQAAAEKIPVSTISFGTDYGTIDIEGGRTRVAVDDASMQQI 263

Query: 361 TD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
              S GQFF      +L + + ++ ++I  ++ ++  +R
Sbjct: 264 ASLSGGQFFTAASESQLRQVYSELGEQIGYETRQVDTSR 302


>gi|270158235|ref|ZP_06186892.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|289163509|ref|YP_003453647.1| hypothetical protein LLO_0165 [Legionella longbeachae NSW150]
 gi|269990260|gb|EEZ96514.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|288856682|emb|CBJ10493.1| putative unknown protein [Legionella longbeachae NSW150]
          Length = 342

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/215 (16%), Positives = 79/215 (36%), Gaps = 49/215 (22%)

Query: 207 NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
             +++++  +A   V               +IG I +         TPL+ + + +  RL
Sbjct: 114 TSRLNIVKSAAEQFVRE---------RSGDKIGLILFGTRAYLQ--TPLTYDRHSILLRL 162

Query: 267 NKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
                    + T+   A+  A + L +  +            + +I +TDG N+      
Sbjct: 163 EDATAGLAGKTTSIGDAVGLAVKRLDSAPKKG----------RVIILLTDGANNSGV--- 209

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPE-----------------GQDLLRKCTD-SSG 365
             L  L+  E  +  G+KIY++ + +  +                  ++ L+K +D + G
Sbjct: 210 --LAPLKAAELAKEEGIKIYTIGLGSEGDSRALVGDFLMQSPAADLDEETLKKMSDMTGG 267

Query: 366 QFFAVNDSRELLESFDKITD--KIQEQSVRIAPNR 398
           ++F   D+  L   +  I     I ++   + P +
Sbjct: 268 RYFRATDTESLHLIYKTINQLETINQEQATVRPQK 302


>gi|254373668|ref|ZP_04989152.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571390|gb|EDN37044.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 339

 Score = 85.0 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 73/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 112 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 169

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L                 K +I +TDGEN+    
Sbjct: 170 MLDDASIALPGPQTAIGDAIGLAVKKL----------KKFPGDSKALILLTDGENNSG-- 217

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 218 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 274

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 275 GGKYFRAQNSSDLKKVYESIDK 296


>gi|303240108|ref|ZP_07326629.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302592377|gb|EFL62104.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 323

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 70/193 (36%), Gaps = 41/193 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE----N 274
           N +   +K IQ+  +                    PL+ + N V+  L  ++        
Sbjct: 102 NRLEVARKTIQDFVDQRPSDRIALIAFAGTAYTRVPLTLDHNVVRESLQDISFKSVNEEG 161

Query: 275 TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEY 334
           T    A+      L            ST   K +I +TDG+N+  S   NT +TL     
Sbjct: 162 TAIGMAISVGLNRL----------KKSTSPSKIMILLTDGDNNAGSIDPNTASTL----- 206

Query: 335 MRNAGMKIYSVAVSAPPE---------------------GQDLLRKCT-DSSGQFFAVND 372
            +++G+KIY++ V +                         +DLL+K    ++GQ++   D
Sbjct: 207 AKDSGIKIYTIGVGSDKTIIPGTNEFGQTVYQEYESGLLNEDLLKKIAETTNGQYYRAKD 266

Query: 373 SRELLESFDKITD 385
           S  L + F  I  
Sbjct: 267 SNALSQVFANINK 279


>gi|256821501|ref|YP_003145464.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
 gi|256795040|gb|ACV25696.1| von Willebrand factor type A [Kangiella koreensis DSM 16069]
          Length = 582

 Score = 84.6 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/291 (12%), Positives = 81/291 (27%), Gaps = 27/291 (9%)

Query: 108 KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQK 167
              Y      L    L P     L               +      ++            
Sbjct: 130 TGSYSNVRRMLNDGYLPPEDAVRLEEFVNYFNYDYQTPDSTEQPFAVNTHVFSAPWNSNA 189

Query: 168 HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA 227
           +     M        P  ++   S              +  K+ ++ +S   L       
Sbjct: 190 YL----MEIGIKGFEPEQQELPPSNLVYL-IDVSGSMNSEDKLGLVKKSLKLLAQE---- 240

Query: 228 IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRE 287
                +   RI  + Y             N+   ++  L++L+   +TN    +  AY+ 
Sbjct: 241 ----SSDQDRISIVVYAGASGVVLEPTKGNDRMAIEQALDRLSAGGSTNGGAGIELAYKL 296

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
                               VI  TDG+ +  +   N    + + E  R +G+   ++  
Sbjct: 297 AEQAFIKDGINR--------VILATDGDFNVGTI--NREQLIDLVERKRESGISFTTLGF 346

Query: 348 SAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            +    + L+ +  D   G +  ++    L E+   + ++     + IA +
Sbjct: 347 GSGNYNEHLMEQLADKGNGNYGYIDS---LQEARKLLVEQRAGTLMTIAKD 394


>gi|299135165|ref|ZP_07028356.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298590142|gb|EFI50346.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 601

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 85/242 (35%), Gaps = 20/242 (8%)

Query: 168 HNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA 227
              N     +     P    +  S  T  +   P+ + +N           +   +    
Sbjct: 361 DWRNVLADPSATAPDPRVTPAPDSTLTQYAATNPSASVSN---GGWTGCVNDRDQNFDTT 417

Query: 228 IQ--EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAY 285
                   +  ++         +    TP+SN  + +KS++N + P  NTN    +   +
Sbjct: 418 NDAMTGSGIPSKLPYAEQWADCLPATITPMSNQWSTLKSQINAMTPSGNTNQAVGLFWGW 477

Query: 286 RELYNEKES--SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ----ICEYMRN-- 337
           + L    +   +     +   K +++ ++DG N+     Q   +       +C+ +++  
Sbjct: 478 QTLNTTNDPFKAPAKDPNWVYKDYIVLLSDGLNTQNRWTQTVSDIDARQELLCKNIKDPA 537

Query: 338 ----AGMKIYSVAVSAPPEG--QDLLRKCTDSSGQFFA-VNDSRELLESFDKITDKIQEQ 390
                 + ++S+ V+   +     +L+ C      +F  +  S +  ++F+ +   I + 
Sbjct: 538 QNGGNQITVFSIQVNISSKDPTSKVLQDCATPGAGYFQMITQSSQTADAFNNVLATIAKL 597

Query: 391 SV 392
            +
Sbjct: 598 RI 599



 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 55/209 (26%), Gaps = 23/209 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + AI+       +  A+D    +  R  +QSALD+A L               T    Q 
Sbjct: 27  IFAIVSIPLVALVGAAVDYTRAVSDRTALQSALDSAALMISK--------DAATMSASQI 78

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +T  ++ +           +             T   N+         A     T   + 
Sbjct: 79  TTRARQYVDSLYTATDAPIQ---------NFTATYTPNSGSGASILLSAN---GTMPTYF 126

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             ++ S    L + ++        +  + + +VLD + SM          +        L
Sbjct: 127 MRVLGSNFNTLPVATSS--TTKWGSTRMRVALVLDNTGSMAQNGKMAALQSAATDMITKL 184

Query: 181 -LPPPPKKSFWSKNTTKSKYAPAPAPANR 208
                     +      +K          
Sbjct: 185 SAFNTTTGDVYISIVPFAKDVNVSTSNVS 213


>gi|85374104|ref|YP_458166.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
 gi|84787187|gb|ABC63369.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
          Length = 623

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/264 (11%), Positives = 70/264 (26%), Gaps = 30/264 (11%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A  +          +D++      +++Q A D+ VL+   ++ ++  I   T      
Sbjct: 15  LIAAGLLPLLAMAGSGVDMSRAYLAESRLQQACDSGVLAARKALGTE--IATLTDIPTDA 72

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
            T  ++    + + G+Y  +N                     Y     A  ++PT    +
Sbjct: 73  GTRGQEFFNSNFQDGNYGTQNRTFNMVLEN-----------DYSVSGTATVDVPTS---V 118

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQ------KHNDNNNM 174
             +       + +     I  S     + + MVLDV+ SM+                   
Sbjct: 119 MTVFGFTKIPVKVECQARISFS----DVDVMMVLDVTGSMKHTNSGDTLSKIDSLKATVR 174

Query: 175 TSNKYLLPPPPKKSFWSK-NTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
                +       +         +           +  V   +  +   S    ++    
Sbjct: 175 NFYDQMEGAKSAGTRIRYGFVPYASNVNVGHLLKDEWVVNSWAYQSRAISGTTTVEAGTK 234

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSN 257
                   AY  G         + 
Sbjct: 235 TRENW---AYKSGSRSAWIEESTY 255



 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/278 (13%), Positives = 90/278 (32%), Gaps = 34/278 (12%)

Query: 144 ENLAISICMVLDVSRSMEDLYL--QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
            NL   + + +DVS    +     ++         +   L         +      +   
Sbjct: 349 ANLYNYLPVAMDVSNWRAEALGCMEERKSTVLTDFSSVDLSANLDLDINTVPVASDQDTQ 408

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCT-PLSNNLN 260
                   I V  + A +  +     + + K   ++ G   ++      Q    +++   
Sbjct: 409 WRPRYPDMIYVRSKEADDKGSFSPAPVYDTKKEFIQTGNWWFSGCPAPAQKLKAMTSG-- 466

Query: 261 EVKSRLNKLNPYENTNTYPAMHHAYRELYNE--KESSHNTIGSTRLKKFVIFITDGENS- 317
           E+ S L+ L P+  T     M    R L       + +++       + +IF+TDG+   
Sbjct: 467 ELDSYLDSLTPHGATYHDGGMIWGGRLLSQYGLFAAENSSKPGRTTSRHLIFLTDGQTEP 526

Query: 318 ----GASAYQNTLNTLQ-------------------ICEYMRNAGMKIYSVAVSAPPEGQ 354
                 S   + ++  +                    C  ++  G  ++ VA       +
Sbjct: 527 YDLAYGSYGIDPIDERRWTQTSSLTLAQTVEERFLFACNEVKKLGATVWVVAFGTAANDK 586

Query: 355 DLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             ++ C  S G++F   ++ +L ++F  I     +  +
Sbjct: 587 --MKTCAGS-GRYFEAANASQLNDAFSTIAKSTGDLRI 621


>gi|262202333|ref|YP_003273541.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
 gi|262085680|gb|ACY21648.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
          Length = 325

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 70/222 (31%), Gaps = 26/222 (11%)

Query: 186 KKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNI 245
            K+        S+   A   A  +I     +A    + + + I               + 
Sbjct: 86  NKATVILVMDVSRSMNATDVAPSRIRAAQSAAKKFADDLTEGIN----------LGLISF 135

Query: 246 GIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
               +     + +    K  ++KL   + T T   +  A  ++     ++          
Sbjct: 136 AGTPSTLVSPTPDHTATKKAVDKLVLADKTATGEGIFAALDQIRT--LNAVLGGPEAAPP 193

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PE 352
             ++ ++DG+ +      +           +  G+ + +++                 P 
Sbjct: 194 AHIVLLSDGKQTVPDEPTDPRGAFTAARKAKEEGIPVSTISFGTAYGTVELDGDRVPVPV 253

Query: 353 GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
               L++  + S G FF  +   EL E ++K+  +I  ++ R
Sbjct: 254 DDPSLKQIANLSGGNFFTASSLDELNEVYEKLQSEIGYETRR 295


>gi|73974730|ref|XP_539177.2| PREDICTED: similar to collagen, type XXII, alpha 1 [Canis
           familiaris]
          Length = 1628

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 68/195 (34%), Gaps = 20/195 (10%)

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
            + +      + + +   NLV++ +           R+G + Y+          L  +  
Sbjct: 53  TSSSVGKEDFEKVRQWVANLVDTFE-----VGPDRTRVGVVRYSDRPTTAFELGLFGSRE 107

Query: 261 EVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
            VK+    L     NTNT  A+    R  ++    +    G    K+  I +TDG +   
Sbjct: 108 AVKAAARHLAYHGGNTNTGDALRFITRHSFS--RQAGGRPGDRAFKQVAILLTDGRSQD- 164

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELL 377
                    L        AG++I++V V      ++ L +          F V+D   + 
Sbjct: 165 -------LVLDAAATAHRAGIRIFAVGVG--AALREELEEIASEPKSAHVFHVSDFDAID 215

Query: 378 ESFDKITDKIQEQSV 392
           +   K+  ++ E  +
Sbjct: 216 KIRGKLRRRLCENVL 230


>gi|312886236|ref|ZP_07745850.1| von Willebrand factor type A [Mucilaginibacter paludis DSM 18603]
 gi|311301261|gb|EFQ78316.1| von Willebrand factor type A [Mucilaginibacter paludis DSM 18603]
          Length = 335

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 55/192 (28%), Gaps = 40/192 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKS---RLNKLNPYENT 275
           N + + +    +                       PL+ + + + +    +      + T
Sbjct: 114 NRLEAGKNIAIDFIKNRPDDRIGLVIFSGESFTQCPLTIDHDVLINLYHDIKNGMIEDGT 173

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L           GS    K VI +TDG N+  S        +   E  
Sbjct: 174 AIGMGLATAVNRL----------RGSEAKSKVVILLTDGVNNAGSIP-----PITAAEIA 218

Query: 336 RNAGMKIYSVAVSAPP----------------------EGQDLLRKCTDSSGQFFAVNDS 373
           +  G+++Y+V +                          +   L +    + G++F   ++
Sbjct: 219 KQFGIRVYTVGIGTQGYAPYPVPSPYGGVVYQRMEVQIDEPTLTKIAAITGGKYFRATNN 278

Query: 374 RELLESFDKITD 385
             L   + +I  
Sbjct: 279 DALTRIYKQIDQ 290


>gi|312139646|ref|YP_004006982.1| integral membrane protein [Rhodococcus equi 103S]
 gi|311888985|emb|CBH48298.1| putative integral membrane protein [Rhodococcus equi 103S]
          Length = 326

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 59/152 (38%), Gaps = 16/152 (10%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + N +E K+ ++ L   E T T  A+  + + +     ++            ++ ++DG+
Sbjct: 147 TPNRDETKAAIDNLTLSERTATGEAIFTSLQSIDT--LAAVLGGSEQAPPARIVLLSDGK 204

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PEGQDLLRKCTD 362
            +   +  +           ++ G+ I +++                 P     LR+  +
Sbjct: 205 QTVPESPDDPRGGFTAARQAKDKGVPISTISFGTGYGTVEIEGDRIPVPVDDPSLREIAN 264

Query: 363 -SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            S G FF  +   EL + +D + ++I  ++ R
Sbjct: 265 LSGGNFFTASSLEELRDVYDTLEEQIGFENAR 296


>gi|325676908|ref|ZP_08156581.1| von Willebrand factor [Rhodococcus equi ATCC 33707]
 gi|325552456|gb|EGD22145.1| von Willebrand factor [Rhodococcus equi ATCC 33707]
          Length = 326

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 59/152 (38%), Gaps = 16/152 (10%)

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + N +E K+ ++ L   E T T  A+  + + +     ++            ++ ++DG+
Sbjct: 147 TPNRDETKAAIDNLTLSERTATGEAIFTSLQSIDT--LAAVLGGSEQAPPARIVLLSDGK 204

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-------------PEGQDLLRKCTD 362
            +   +  +           ++ G+ I +++                 P     LR+  +
Sbjct: 205 QTVPESPDDPRGGFTAARQAKDKGVPISTISFGTGYGTVEIEGDRIPVPVDDPSLREIAN 264

Query: 363 -SSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
            S G FF  +   EL + +D + ++I  ++ R
Sbjct: 265 LSGGNFFTASSLEELRDVYDTLEEQIGFENAR 296


>gi|296228120|ref|XP_002759672.1| PREDICTED: collagen alpha-5(VI) chain [Callithrix jacchus]
          Length = 2614

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDNPEILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +  +  +K+ +I ITDGE+       +T         +R+ G+ I++V V 
Sbjct: 905 TEE----HGSRINQNVKQMLIVITDGESDDRVELNDT------AAKLRDKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + +  + + +  +
Sbjct: 955 K--ADQKELEGMAGNKNNTIYVDNFDKLKDIYAPVQESMCTE 994



 Score = 62.6 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/166 (9%), Positives = 60/166 (36%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN-PYENTNTYPAMHHA 284
             +       VR+G + ++  +         +N  +++  +  +     +T+T  A+   
Sbjct: 469 TEMFSIGPDKVRVGVVQFSDKMRVEFSITDYSNDIDLRKAILNIQQLTGDTHTGEALDF- 527

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
              +    ++      S  +  ++I +TDG++  +         ++  + +R   + +++
Sbjct: 528 ---ILPRIKNGIKERMSQ-VPCYLIVLTDGKSQYS--------VVEPAKRVRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + +      +  L++      +     +   L    +++   I  +
Sbjct: 576 IGIG--EANKKELQEIAGKEERVSFGQNFDALKSIKNEVVHGICTE 619



 Score = 62.2 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 51/165 (30%), Gaps = 17/165 (10%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   + T    A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDDPEEEFQLNTYFTQQEISDAIDRMSLIDKGTLMGKALNFVD 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARFGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            V      +  L + +      F V +   L     K+  ++   
Sbjct: 762 GV--YGADRSQLEEISGDGSLVFYVENFDHLQALEKKLVFRVCAL 804



 Score = 44.1 bits (102), Expect = 0.038,   Method: Composition-based stats.
 Identities = 22/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S N  + K+++
Sbjct: 1018 NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSDYQNIIDLKSSLNKTQWKTQI 1072

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P + +A +++ N          +  + + ++ IT G+           
Sbjct: 1073 QTVSKSSG---FPRIDYALKKVGNMFNIRAGGRRNAGVPQTLVVITSGDP--------RY 1121

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            N     + +++ G+ +  + +      + LL   T +S +         L   +   +I 
Sbjct: 1122 NVAGAVKALKDLGICVLVLGIG-DVHKEQLL-PITGNSEKIITFQHFDRLKNVDVKKRIV 1179

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1180 REICQS 1185



 Score = 43.4 bits (100), Expect = 0.071,   Method: Composition-based stats.
 Identities = 22/197 (11%), Positives = 63/197 (31%), Gaps = 22/197 (11%)

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNN 258
              +     +    +      ++NS+       +    R+    Y+  +           
Sbjct: 35  VDSSDHLGTKSFPFVKTFINKMINSLP-----IEADKYRVALAQYSDKLHSEFHLSTFKG 89

Query: 259 LNEVKSRL--NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
            N + + L  N      +     A+  A+R  ++   +  +          V+  +    
Sbjct: 90  RNPMLNHLKKNFQFLGGSLQIGKALQEAHRTYFSAPTNGRDRK--QFPPILVVLAS---- 143

Query: 317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSREL 376
                 ++  +  +  + ++  G+KI  ++V      ++ L+    S    F +   R+L
Sbjct: 144 -----AESEDDVEEASKALQEDGVKI--ISVGVQEASEENLKAMATSH-FHFNLRTVRDL 195

Query: 377 LESFDKITDKIQEQSVR 393
              F +   +I ++  +
Sbjct: 196 ST-FSQNMTQIIKEVTK 211


>gi|146298482|ref|YP_001193073.1| von Willebrand factor, type A [Flavobacterium johnsoniae UW101]
 gi|146152900|gb|ABQ03754.1| BatA-like protein [Flavobacterium johnsoniae UW101]
          Length = 334

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 56/178 (31%), Gaps = 44/178 (24%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYN 290
           + RIG + Y         TP++++   +   +  +       + T     +  A   L  
Sbjct: 130 NDRIGLVLYASEAYTK--TPVTSDKPIILEAIKGIRYDTVLQDGTGIGMGLATAVNRL-- 185

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     S    + +I +TDG N+        +      +  +  G+K+Y++ +   
Sbjct: 186 --------KDSKAKSRVIILLTDGVNNAG-----FIEPETAADIAKQYGIKVYTIGLGTN 232

Query: 351 P----------------------EGQDLLRKCT-DSSGQFFAVNDSRELLESFDKITD 385
                                    + L++     + G +F    + +L E ++ I  
Sbjct: 233 GMAESPYAYAPNGGFLFKMQKVEIDERLMKSIAKKTDGTYFRATSNDKLAEIYNSINK 290


>gi|33152377|ref|NP_873730.1| tight adherence protein G [Haemophilus ducreyi 35000HP]
 gi|21326716|gb|AAL92476.1| TadG [Haemophilus ducreyi]
 gi|33148600|gb|AAP96119.1| tight adherence protein G [Haemophilus ducreyi 35000HP]
          Length = 562

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 58/516 (11%), Positives = 125/516 (24%), Gaps = 136/516 (26%)

Query: 3   AIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVL---------------SGCASIVSD 47
           A++       +  ++++A I+  + ++  AL+ AVL               +   +  ++
Sbjct: 27  ALLTLPIVALLFVSLEVAGIIQDKARLNDALEQAVLSLTAENNSGRKSYDYALTNAEKAN 86

Query: 48  RTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYI--- 104
                 +    + S I K  +K +L Q          I       IT        Y    
Sbjct: 87  GKYLADSEAGKRDSQIVKTFVKLYLPQIDENTMKFEPICTTQNNAITPKNGKQYAYSSSH 146

Query: 105 AESKAQYEIPTENLFLKGLIPSALTNLSLR---STGIIERSSENLAISICMVLDVSRSME 161
                   I   +LF   +  S +    +     +   + ++ NL + + +V D+S SM+
Sbjct: 147 VTCTVTGSINHRSLFPMTVGKSKIIPEQVSLSSGSMAQKINNVNLPLDLMVVADLSGSMD 206

Query: 162 DLYLQKHNDNNNMT-----------------------------------------SNKYL 180
                    +N                                                 
Sbjct: 207 YNINNHKVYSNTEASKLTLLKQVLEELTDKYLLSEEANPNNRISMIPFAMGAQHPIRNSC 266

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRK------IDVLIESAGNLVNSIQK-----AIQ 229
           + P              K +P     N +        +   +   L+++ +         
Sbjct: 267 VLPFEWNQSHIGYNDSQKVSPNEIEYNLRNLPIRSRTIFTHNLVYLLDTKKTLEKIGTRF 326

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
              ++  +   I         Q     N      + + +L     T     +  A   + 
Sbjct: 327 NNYDVEYQKSAICLEGSDKFQQQWYEKNQKINFINEVKRLKAAGATLASSGLIVAVNNML 386

Query: 290 NEKESSHNTIGSTR------LKKFVIFITDGENSGA------------------------ 319
           NE   S      TR               D   +                          
Sbjct: 387 NEPARSDVLKQQTRRTILILSDGSDSIGDDSGENNWYQKEIPFMNFSRITENLILGKQEL 446

Query: 320 -------------------------SAYQNTLNTLQICEYM--------RNAGMKIYSVA 346
                                    +     + T  +C+ +        ++   KI  V 
Sbjct: 447 FNKSPQSKNLENHIYGYRYNYPIYLTNNTEKIQTKGLCDVIRDKLNTKNKDNNTKIIFVE 506

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDK 382
           +      +D    C   +  +++      LLE+F +
Sbjct: 507 LGYNSSSKDTWLHCVGGTQNYYSATSKESLLEAFKQ 542


>gi|10334988|gb|AAD46685.2| TadG [Aggregatibacter actinomycetemcomitans]
 gi|26000721|gb|AAN75217.1| TadG [Aggregatibacter actinomycetemcomitans]
          Length = 538

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 60/481 (12%), Positives = 130/481 (27%), Gaps = 112/481 (23%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLS----------------GCASIVSDRTIKDPTTK 56
           + + +D   I+  + ++  A D A L                      VS + I   +  
Sbjct: 41  VAFTVDGTGILLDKARLAQATDQAALLLIAEDNQYRKNKDHSDVTRQRVSQQDIDRESKD 100

Query: 57  ----------KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQ------KAQINITKDKNNP 100
                     K +   + +  +K +L+      +                +       N 
Sbjct: 101 FSNAKVQAQWKKRNQELVQGLVKLYLRSDDSNGQKNSSPVTIKEPFLAECLEEKTQPRNK 160

Query: 101 LQY------IAESKAQYEIPT---ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
                    + +   Q +      + L     +      ++   T  ++     + I + 
Sbjct: 161 NGTAKSIACVVQGSVQRKFWLPWGQTLVSSSQLHDGRVGINSGETYAVKEKQITIPIDLM 220

Query: 152 MVLDVSRSMEDLYL----------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
           MV D+SRSM    +           +  D      +       PK      +        
Sbjct: 221 MVTDLSRSMNWAIVSHRDVEVPPPNRRIDALREVVSNIQDILLPKAIRDDISPYNRIGFV 280

Query: 202 APAPANRKIDVLIESA-------------------GNLVNSIQKAIQEKKNLSVRIGTIA 242
           + A   R+ D                         G +    ++  +             
Sbjct: 281 SFAAGARQKDETDNCVLPYYSKQNKQAEISNYFNSGQISQGFEELSRSMDIEKTINQITQ 340

Query: 243 YNIGIVGNQCTPLSN-----------------------NLNEVKSRLNKLNPYENTNTYP 279
           +  G   +    LS+                       +   V   L ++ P   T    
Sbjct: 341 FKNGEKKSYPFSLSSLSSRNFCLENNKGKATTQAWFSKSKPGVADALKEIEPLGGTAVTS 400

Query: 280 AMHHAYRELYNEKESSHNTIG--STRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMR 336
            +      + +  +         +T  ++ ++ ++DGE++  S     T     +CE ++
Sbjct: 401 GIFIGTNLMTDTNKDPEAAPNKLNTNTRRVLLILSDGEDNRPSKNTLVTFMNSGMCEKIK 460

Query: 337 NA------------GMKIYSVAVSAPPEGQDL--LRKCTDSSGQFFAVNDSRELLESFDK 382
                           +I  VA+   P    L   +KC     Q++ VN  + LL++F +
Sbjct: 461 EKINSLQDSNYPQVEARIAFVALGFNPPQDQLIAWKKCV--GKQYYPVNSKQGLLDAFKQ 518

Query: 383 I 383
           I
Sbjct: 519 I 519


>gi|307548796|dbj|BAJ19118.1| TadG [Aggregatibacter actinomycetemcomitans]
 gi|307548811|dbj|BAJ19132.1| TadG [Aggregatibacter actinomycetemcomitans]
          Length = 538

 Score = 84.6 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 60/481 (12%), Positives = 130/481 (27%), Gaps = 112/481 (23%)

Query: 13  ITYAIDLAHIMYIRNQMQSALDAAVLS----------------GCASIVSDRTIKDPTTK 56
           + + +D   I+  + ++  A D A L                      VS + I   +  
Sbjct: 41  VAFTVDGTGILLDKARLAQATDQAALLLIAEDNQYRKNKDHSDVTRQRVSQQDIDRESKD 100

Query: 57  ----------KDQTSTIFKKQIKKHLKQGSYIRENAGDIAQ------KAQINITKDKNNP 100
                     K +   + +  +K +L+      +                +       N 
Sbjct: 101 FSNAKVQAQWKKRNQELVQGLVKLYLRSDDSNGQKNSSPVTIKEPFLAECLEEKTQPRNK 160

Query: 101 LQY------IAESKAQYEIPT---ENLFLKGLIPSALTNLSLRSTGIIERSSENLAISIC 151
                    + +   Q +      + L     +      ++   T  ++     + I + 
Sbjct: 161 NGTAKSIACVVQGSVQRKFWLPWGQTLVSSSQLHDGRVGINSGKTYAVKEKQITIPIDLM 220

Query: 152 MVLDVSRSMEDLYL----------QKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAP 201
           MV D+SRSM    +           +  D      +       PK      +        
Sbjct: 221 MVTDLSRSMNWAIVSHRDVEVPPPNRRIDALREVVSNIQDILLPKAIRDDISPYNRIGFV 280

Query: 202 APAPANRKIDVLIESA-------------------GNLVNSIQKAIQEKKNLSVRIGTIA 242
           + A   R+ D                         G +    ++  +             
Sbjct: 281 SFAAGARQKDETDNCVLPYYSKQNKQAEISNYFNSGQISQGFEELSRSMDIEKTINQITQ 340

Query: 243 YNIGIVGNQCTPLSN-----------------------NLNEVKSRLNKLNPYENTNTYP 279
           +  G   +    LS+                       +   V   L ++ P   T    
Sbjct: 341 FKNGEKKSYPFSLSSLSSRNFCLENNKGKATTQAWFSKSKPGVADALKEIEPLGGTAVTS 400

Query: 280 AMHHAYRELYNEKESSHNTIG--STRLKKFVIFITDGENSGASAYQ-NTLNTLQICEYMR 336
            +      + +  +         +T  ++ ++ ++DGE++  S     T     +CE ++
Sbjct: 401 GIFIGTNLMTDTNKDPEAAPNKLNTNTRRVLLILSDGEDNRPSKNTLVTFMNSGMCEKIK 460

Query: 337 NA------------GMKIYSVAVSAPPEGQDL--LRKCTDSSGQFFAVNDSRELLESFDK 382
                           +I  VA+   P    L   +KC     Q++ VN  + LL++F +
Sbjct: 461 EKINSLQDSNYPQVEARIAFVALGFNPPQDQLIAWKKCV--GKQYYPVNSKQGLLDAFKQ 518

Query: 383 I 383
           I
Sbjct: 519 I 519


>gi|326918160|ref|XP_003205359.1| PREDICTED: hypothetical protein LOC100539194 [Meleagris gallopavo]
          Length = 1584

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 70/200 (35%), Gaps = 22/200 (11%)

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
            + +      + + +   NLV + +           R+G + Y+                
Sbjct: 45  ASSSVGKEDFEKVRQWVSNLVETFE-----IGPDKTRVGVVRYSDRPTTEFDLGKYKTRE 99

Query: 261 EVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
           E+K    K+     NTNT  A+ +     ++  + +   +    +KK  I +TDG +   
Sbjct: 100 EIKEAARKIRYYGGNTNTGDALRYINTYSFS--KEAGGRLSDRTVKKVAILLTDGRSQDY 157

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELL 377
                           R AG++I++V V      ++ L +          F V+D   + 
Sbjct: 158 VLDP--------ANAARQAGIRIFAVGVG--EALKEELDEIASEPKSAHVFHVSDYNAID 207

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           +   K+  ++ E    + PN
Sbjct: 208 KIRGKLRRRLCENV--LCPN 225


>gi|258624772|ref|ZP_05719703.1| putative Flp pilus assembly protein TadG [Vibrio mimicus VM603]
 gi|258582934|gb|EEW07752.1| putative Flp pilus assembly protein TadG [Vibrio mimicus VM603]
          Length = 419

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/427 (8%), Positives = 115/427 (26%), Gaps = 62/427 (14%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           ++     + + + + L+       ++  A + A L+          I  P    +   + 
Sbjct: 17  MMFPAMMMILAFTMQLSQQFLAHARLSEASEVASLAL---------IASPKEDDENNVSY 67

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
            +K + +++       +      +    +     +       +         ++      
Sbjct: 68  ARKLVDRYVVDNIDDIKVTVKNKRCEYKDGCVQSSGEAAPFTDFTVAATAKHKSWISYE- 126

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
              +L      +   + R      + +  ++D+S SM   +    +  + + +       
Sbjct: 127 -NISLKPEFTVNGSSVTRKFLPQPVDVYFIVDMSASMRATWQNGKSQIDEVKNVIT-RVV 184

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
              K F ++  ++           ++    +E+    +       Q   N+      +  
Sbjct: 185 NDLKDFDTEVKSRVALLGYHNFNIKQGGRSLEAYDYAL--YNTPQQTVSNMFFPPKRVNP 242

Query: 244 NIGI-VGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMHHAYRELYNEKESSHNT 298
                  ++   L+ N +     +N  N        T ++  +             + + 
Sbjct: 243 GDSALFSHRDIDLTQNYSSFLQIMNDRNFYPPRSACTESWQGII--------AAAQAADK 294

Query: 299 IGSTRLKKFVIFITDGENSGA------------SAYQNTLNTLQICEYMRNA-------- 338
                 ++  I ++DG +                 Y   L    +C+ ++          
Sbjct: 295 ATDINPEQVFIILSDGADCPWQRQDRWGRLRTTEYYLKKLVDGGLCKNLKQRIRQKPNRF 354

Query: 339 -----------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
                       + +  + V+      D    C       +         + +  I + I
Sbjct: 355 QSSTPTENEKTKVTMGVIGVNYQVNPNDGFGDCV-GRENIYHATQGE---DVYKYILNLI 410

Query: 388 QEQSVRI 394
            E++ R+
Sbjct: 411 NEETGRL 417


>gi|251779520|ref|ZP_04822440.1| von Willebrand factor, type A domain protein [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243083835|gb|EES49725.1| von Willebrand factor, type A domain protein [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 815

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 99/355 (27%), Gaps = 85/355 (23%)

Query: 123 LIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME--DLYLQKHNDNNNMTSNKYL 180
           ++   +           E   E     I +VLD S SM      +  +N      ++   
Sbjct: 68  IVGEDILIKGKIIPKPFEMEMERQKKEIVLVLDTSGSMNEKVGKVCTNNRGWYCKTHNSS 127

Query: 181 LPPPPKKSFWSKNTTKS-------KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ---- 229
                +  F+                  A    + K++ L ++A N ++ ++        
Sbjct: 128 DLYHRESLFYHNWINDYCEEHGKVGQHYASYSKSTKMEELKKAANNFIDKMKDVPDLKIC 187

Query: 230 -----------------EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY 272
                            +K + SV                  L++N N + S +N L   
Sbjct: 188 IVNYSSEATINPCGYNGDKNSASVEEDRHHTIPNYKSLGTKFLNSNDNTLHSMINGLKAL 247

Query: 273 ENTNTYPAMHHA--------------------------------------YRELYNEKES 294
             TNT   +  A                                      Y  L    ++
Sbjct: 248 GGTNTGEGLRKAEYMLEQGDKDAKKTIVFMSDGLPTYYSVYKNHQNVQKYYWVLKYSWDN 307

Query: 295 SHNTIGSTRLKKFVIF----ITD-------GENSGASAYQNTLNTLQICEYMRNAGMKIY 343
            ++       K+   +     TD       G  +            +I E +++    ++
Sbjct: 308 GYHWEKEYYWKEEDYWDYYTSTDDTFPNYAGTGNSDDQGCCKKYAKKIGEIIKSNNSNVF 367

Query: 344 SVAVSA---PPEGQDLLRKCTDSSGQF---FAVNDSRELLESFDKITDKIQEQSV 392
           S+         +   ++++  DS G     F   D+  + E F++I DKI E   
Sbjct: 368 SLGYGLGNKNSDANKIMKEIHDSMGGAEKDFFATDTGAIDEIFNQIADKIIESYT 422


>gi|115525407|ref|YP_782318.1| hypothetical protein RPE_3406 [Rhodopseudomonas palustris BisA53]
 gi|115519354|gb|ABJ07338.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 580

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 81/262 (30%), Gaps = 20/262 (7%)

Query: 151 CMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKI 210
              +  + +    Y       +   S   +          +  T     A          
Sbjct: 317 YDSVQRTVASCTGYNSTECSCSGWPSVCKIYHTWRPADTVTPVTAADTAATPSTSTWNGC 376

Query: 211 DVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN 270
                +     N   + +    +        A  I     + T ++NN   + + ++ L 
Sbjct: 377 VTDRGTYSGPSNDYDRNVSLPLSGVPASRFPAEQISSCAPKVTEMNNNWATMNTTVDGLF 436

Query: 271 PYENTNTYPAMHHAYRELYNE--KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
           P   TN    +   ++ L       +          +  ++ ++DG N+    Y N  +T
Sbjct: 437 PVGGTNQPIGLVWGWQSLVGGGPFPTPPVKDEQYTYQDIIVLMSDGLNTVDRWYGNGWDT 496

Query: 329 -------------LQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTD---SSGQFFA-V 370
                           C  ++ AG+K+Y+V V+     +  LL+ C       G+ F  V
Sbjct: 497 NTSVDNRMYASATTGTCVNVKAAGIKVYTVHVNTNGSPESTLLKNCASPADDGGKEFQMV 556

Query: 371 NDSRELLESFDKITDKIQEQSV 392
             +  L  +F+ I  K+ +  V
Sbjct: 557 TSASGLNAAFNSIATKLTDLRV 578



 Score = 80.3 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/252 (11%), Positives = 65/252 (25%), Gaps = 26/252 (10%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +  I       F+  A+D +  +  R  MQSALD+  L        ++        K   
Sbjct: 27  LFGIACVPLITFVGAAVDYSRAVAARTAMQSALDSTALMVAKDYSLNKISASEIDGK--- 83

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                        +  +        A   ++      N       +     ++PT+    
Sbjct: 84  ------------AKSIFSALYTNKSANSVEVVAVLTPNTGKGSTIKVDGTGKVPTD---F 128

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKY- 179
             L+  +  ++   S      +  +  + + +VLD + SM D                  
Sbjct: 129 MKLVNISQIDIGASS----TTTWGSTRLRVALVLDTTGSMNDNGKIGALKTATQNLLTQL 184

Query: 180 -LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN--LVNSIQKAIQEKKNLSV 236
                 P+  + S            +          +      +++  +   +     +V
Sbjct: 185 KDAAGKPEDVYVSIIPFSKDVNVGASNYTANWIDWTDWKSQPPVLDYAKSGSKSGLVDNV 244

Query: 237 RIGTIAYNIGIV 248
               +       
Sbjct: 245 AWKDVGPGSKCP 256


>gi|258620794|ref|ZP_05715829.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586992|gb|EEW11706.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 419

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/427 (8%), Positives = 118/427 (27%), Gaps = 62/427 (14%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           ++     + + + + L+       ++  A + A L+          I  P    +   + 
Sbjct: 17  MMFPAMMMILAFTMQLSQQFLAHARLSEASEVASLAL---------IASPKEDDENNVSY 67

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
            +K + +++       +      +    +     +       +         ++      
Sbjct: 68  ARKLVDRYVVDNIDDIKVTVKNKRCEYKDGCVQSSGEAAPFTDFTVAATAKHKSWISYE- 126

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
              +L      +   + R      + +  ++D+S SM   +    +  + + +       
Sbjct: 127 -NISLKPEFTVNGSSVTRKFLPQPVDVYFIVDMSASMRATWQNGKSQIDEVKNVIT-RVV 184

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
              K F ++  ++           ++    +E+    +       Q   N+      +  
Sbjct: 185 NDLKDFDTEVKSRVALLGYHNFNIKQGGRSLEAYDYAL--YNTPQQTVSNMFFPPKRVNP 242

Query: 244 NI-GIVGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMHHAYRELYNEKESSHNT 298
           +  G+  ++   L+ N +     +N  N        T ++  +             + + 
Sbjct: 243 SDSGLFSHRDIDLTQNYSSFLQIMNDRNFYPPRSACTESWQGII--------AAAQAADK 294

Query: 299 IGSTRLKKFVIFITDGENSGA------------SAYQNTLNTLQICEYMRNA-------- 338
                 ++  I ++DG +                 Y   L    +C+ ++          
Sbjct: 295 ATDINPEQVFIILSDGADCPWQRQDRWGRLRTTEYYLKKLVDGGLCKNLKQRIRQKPNRF 354

Query: 339 -----------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
                       + +  + V+      D    C       +         + +  I + I
Sbjct: 355 QSSTPTENEKTKVTMGVIGVNYQVNPNDGFGDCV-GRENIYHATQGE---DVYKYILNLI 410

Query: 388 QEQSVRI 394
            E++ R+
Sbjct: 411 NEETGRL 417


>gi|269926132|ref|YP_003322755.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789792|gb|ACZ41933.1| von Willebrand factor type A; type II secretion system protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 643

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 86/275 (31%), Gaps = 21/275 (7%)

Query: 118 LFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSN 177
           L +          L+  S   +  S   ++ +    + ++ S  +       D +     
Sbjct: 15  LVILTFYSYFTEALAANSGNTVRVSIREVSTTSQPKIVMTLSANNSKGLPVTDLSADDFI 74

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVR 237
                    K             P P      +D       +   + Q A     N    
Sbjct: 75  ----VKENGKEQSDIAVYPFYQNPDPIDVVLALDTSASMNDDAFTAAQDAAYGLINGLSP 130

Query: 238 IGTIAYNIGIVGNQCT-PLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH 296
              +         +   PL+ +   V+  + KL+    T  Y  +  A +E+   + +  
Sbjct: 131 EDKVGLITFDKTARVIEPLAQDHARVQESIQKLSRSVGTALYQGLSLAAQEVAKGQNT-- 188

Query: 297 NTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                    K ++ +TDG N+  +         +     +  G  +++V      + Q L
Sbjct: 189 ---------KAIVLMTDGFNTSRNTTL-----EEAVAKAQEVGASVFTVGFGKKVDTQGL 234

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
            +   ++ G++F+   + +L   F  I+ K+ ++ 
Sbjct: 235 QKIANETGGEYFSAPTNAQLRRVFADISQKLHQEY 269


>gi|56707447|ref|YP_169343.1| hypothetical protein FTT_0293 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669918|ref|YP_666475.1| hypothetical protein FTF0293 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314141|ref|YP_762864.1| hypothetical protein FTH_0198 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|254370860|ref|ZP_04986865.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874284|ref|ZP_05246994.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56603939|emb|CAG44926.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320251|emb|CAL08309.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129040|gb|ABI82227.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|151569103|gb|EDN34757.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840283|gb|EET18719.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 339

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 76/205 (37%), Gaps = 47/205 (22%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           A      + D+++  A   +++ +           R+G I +         TPL+ ++  
Sbjct: 118 ANGQMESRFDLVMRVANQFIDTRK---------GDRVGLILFGTRAYLQ--TPLTFDIAT 166

Query: 262 VKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
           VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+ 
Sbjct: 167 VKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNS 216

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCT 361
                 TL  LQ  E  +   +KIY++ +                  +      +L K  
Sbjct: 217 G-----TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIA 271

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + G++F   +S +L + ++ I  
Sbjct: 272 TMTGGKYFRAQNSSDLKKVYESIDK 296


>gi|296445280|ref|ZP_06887239.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
 gi|296257235|gb|EFH04303.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
          Length = 575

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/412 (9%), Positives = 101/412 (24%), Gaps = 71/412 (17%)

Query: 50  IKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKA 109
                +K           +     + + ++ +    +   ++      +N      +   
Sbjct: 164 SAGGKSKIAALRDAATSFVNNIYSKTTDVKMSIVPFSAGVRVLDPSVSSNRTLSWIDVNG 223

Query: 110 QYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHN 169
                        L+ +     +  +             S+    D     E      + 
Sbjct: 224 NNSQHWLVFGDGSLVAATAKAAAKTAGFTSRFDIFTKLKSLNSSWDWGGCFEGPKYPLNV 283

Query: 170 DNNNMTSNKY------LLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS 223
            +  + ++         L P    +    N +                 +      L  +
Sbjct: 284 SDTAVDTSNAETLFVPFLAPDEPSTKDKYNNSLYTNNYLAETGGSCSGTVTGDWKLLTRA 343

Query: 224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHH 283
            +    + K      G  +            L+   + + ++++ L     TN +     
Sbjct: 344 CKY--GKPKKDGSGAGPNSSCPTSSSQTVLQLTATQSTITTKISGLTENGYTNLHEGFMW 401

Query: 284 AYRELYNEKE-SSHNTIGSTRLKKFVIFIT------------------------------ 312
            +R +      ++     +    K ++F+T                              
Sbjct: 402 GWRTISPTGPFAAGRAYATKDNHKIIVFMTDGFNNWQSATSTVTGSAYQAAGYYSYNGTA 461

Query: 313 -----DGENSGASAYQN----------------------TLNTLQICEYMRNAGMKIYSV 345
                DG  +  +                             TL+ C   + AG++IY++
Sbjct: 462 NQRFPDGTATNGNGVNYQTTLEAAAGSSTDYHDTSRNMQDELTLEACTNAKTAGVEIYTI 521

Query: 346 AVSA-----PPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             S        +G  +++ C   +  +FA  D   L  +F  I   + +  +
Sbjct: 522 GFSVPVDPIDAQGLKMMQDCATDANHYFAATDVDSLNAAFASIGSGVGKLRL 573



 Score = 68.0 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/269 (8%), Positives = 66/269 (24%), Gaps = 5/269 (1%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-Q 59
           +  +      L +   +D    +  ++ +Q A D+A L+   +IV+  T +   ++    
Sbjct: 27  IFGLSFIPLVLMLGAGVDYGRAVSTKSNLQQATDSAALAVAKTIVATTTNQQAQSQAQVY 86

Query: 60  TSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL-QYIAESKAQYEIPTENL 118
             T  +  +    K           +   AQI  T  K   +     ++    + P    
Sbjct: 87  LLTNVRNAVAVVTKAEISADRLTLCLDSTAQIPTTIMKIAHIETITTKATTCAQTPGGMN 146

Query: 119 FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNK 178
               +      + S+  +   +     L  +    ++   S            +      
Sbjct: 147 GTYEIALVLDNSGSMSKSAGGKSKIAALRDAATSFVNNIYSKTTDVKMSIVPFSAGVRVL 206

Query: 179 YLLPPPPKKSFWSKNTTKSKY---APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                  +   W      +                           +      + K   S
Sbjct: 207 DPSVSSNRTLSWIDVNGNNSQHWLVFGDGSLVAATAKAAAKTAGFTSRFDIFTKLKSLNS 266

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
                  +         +  + + +  ++
Sbjct: 267 SWDWGGCFEGPKYPLNVSDTAVDTSNAET 295


>gi|56477526|ref|YP_159115.1| hypothetical protein ebA3711 [Aromatoleum aromaticum EbN1]
 gi|56313569|emb|CAI08214.1| hypothetical protein ebA3711 [Aromatoleum aromaticum EbN1]
          Length = 441

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/236 (11%), Positives = 64/236 (27%), Gaps = 8/236 (3%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+ + V   F   A+D  H+   + ++Q+  DA  L+    +       +  T+ +  
Sbjct: 18  ITALSLVVLVGFAGLALDGGHLYLTKTELQNGADACALAASYELTGSPISPENFTRAENA 77

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDK-NNPLQYIAESKAQYEIPTENLF 119
                 + +    QG  I     D+     +  +              +          +
Sbjct: 78  GKTVGTENRVDF-QGGAIAAADIDVTFSTSLAGSWLPAGGATGNSKYVRCTITRNGIAPW 136

Query: 120 LKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS-MEDLYLQKHNDNNN-MTSN 177
              ++      +S  +T  +  S  N AI + +    S S     Y++    + N   S 
Sbjct: 137 FMQVMGFGDQTVSAIATATLAPSQNNCAIPMGLCTHPSSSAPHFGYVKGDWYSMNFKESG 196

Query: 178 KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
              +        W      +          +++                       
Sbjct: 197 GGTMENLTGDFRWVDFDPSTTTPNCSGKGAQEL----SCLFEGAGQCNLPPNGPST 248


>gi|89889805|ref|ZP_01201316.1| BatA, aerotolerance operon [Flavobacteria bacterium BBFL7]
 gi|89518078|gb|EAS20734.1| BatA,  aerotolerance operon [Flavobacteria bacterium BBFL7]
          Length = 337

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 62/182 (34%), Gaps = 44/182 (24%)

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE----NTNTYPAMHHAYR 286
           K   + RIG + Y         TP++ +       +N++         T     +  A  
Sbjct: 129 KGRPNDRIGVVVYAGESYTK--TPITTDEMISLRAINEIAFDGVLENGTAIGMGLATAVN 186

Query: 287 ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            L            S  L K +I +TDG N+        ++     E      +K+Y++ 
Sbjct: 187 RL----------KDSEALSKVIILMTDGVNNSG-----FIDPKIASELALEYDIKVYTIG 231

Query: 347 VSAPPE----------------------GQDLLRKCT-DSSGQFFAVNDSRELLESFDKI 383
           +                            ++L+++   D+ G++F   ++++L E + +I
Sbjct: 232 IGTNGNAPSPVAQIGRNKFRMAMMPVEIDEELMKQIAVDTGGKYFRATNNKKLEEIYGEI 291

Query: 384 TD 385
             
Sbjct: 292 DK 293


>gi|187932172|ref|YP_001892157.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187713081|gb|ACD31378.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 333

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 76/205 (37%), Gaps = 47/205 (22%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           A      + D+++  A   +++ +           R+G I +         TPL+ ++  
Sbjct: 112 ANGQMESRFDLVMRVANQFIDTRK---------GDRVGLILFGTRAYLQ--TPLTFDIAT 160

Query: 262 VKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
           VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+ 
Sbjct: 161 VKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNS 210

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCT 361
                 TL  LQ  E  +   +KIY++ +                  +      +L K  
Sbjct: 211 G-----TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIA 265

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + G++F   +S +L + ++ I  
Sbjct: 266 TMTGGKYFRAQNSSDLKKVYESIDK 290


>gi|150005795|ref|YP_001300539.1| hypothetical protein BVU_3288 [Bacteroides vulgatus ATCC 8482]
 gi|149934219|gb|ABR40917.1| conserved hypothetical protein BatA [Bacteroides vulgatus ATCC
           8482]
          Length = 332

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/252 (12%), Positives = 68/252 (26%), Gaps = 56/252 (22%)

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
               +         +          S    A      +++   + A   +          
Sbjct: 72  ARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLKPNRLEAAKQVASEFI---------- 121

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY--------ENTNTYPAMHH 283
            N                    PL+ +   + +  N +           + T     + +
Sbjct: 122 -NGRPNDNIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRGLIEDGTAIGMGIAN 180

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           A   L            S    K +I +TDG N+           L   E  +  G++IY
Sbjct: 181 AVTRL----------KDSKAKSKVIILLTDGSNNRGDIS-----PLTAAEIAKQFGIRIY 225

Query: 344 SVAVSAPPE--------------------GQDLLRKCT-DSSGQFFAVNDSRELLESFDK 382
           ++ V                          +  L +    ++G +F    + +L E + +
Sbjct: 226 TIGVGTNGTAPYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRATSNSKLKEVYQE 285

Query: 383 ITDKIQEQSVRI 394
           I DK+++  + +
Sbjct: 286 I-DKLEKTKLNV 296


>gi|89255637|ref|YP_512998.1| hypothetical protein FTL_0203 [Francisella tularensis subsp.
           holarctica LVS]
 gi|134302613|ref|YP_001122584.1| hypothetical protein FTW_1793 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156501587|ref|YP_001427652.1| hypothetical protein FTA_0219 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009921|ref|ZP_02274852.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella tularensis subsp. holarctica FSC200]
 gi|224456527|ref|ZP_03665000.1| hypothetical protein FtultM_01598 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254367031|ref|ZP_04983067.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953465|ref|ZP_06558086.1| hypothetical protein FtulhU_03745 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313263|ref|ZP_06803900.1| hypothetical protein FtulhU_03730 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143468|emb|CAJ78644.1| hypothetical membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|134050390|gb|ABO47461.1| conserved membrane protein with von Willebrand factor type A domain
           [Francisella tularensis subsp. tularensis WY96-3418]
 gi|134252857|gb|EBA51951.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|156252190|gb|ABU60696.1| conserved membrane protein with von Willebrand factor, type A
           domain [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|282158589|gb|ADA77980.1| hypothetical protein NE061598_01650 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 333

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 76/205 (37%), Gaps = 47/205 (22%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           A      + D+++  A   +++ +           R+G I +         TPL+ ++  
Sbjct: 112 ANGQMESRFDLVMRVANQFIDTRK---------GDRVGLILFGTRAYLQ--TPLTFDIAT 160

Query: 262 VKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
           VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+ 
Sbjct: 161 VKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNS 210

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCT 361
                 TL  LQ  E  +   +KIY++ +                  +      +L K  
Sbjct: 211 G-----TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIA 265

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + G++F   +S +L + ++ I  
Sbjct: 266 TMTGGKYFRAQNSSDLKKVYESIDK 290


>gi|262173885|ref|ZP_06041562.1| protein TadG associated with Flp pilus assembly [Vibrio mimicus
           MB-451]
 gi|261891243|gb|EEY37230.1| protein TadG associated with Flp pilus assembly [Vibrio mimicus
           MB-451]
          Length = 403

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/427 (8%), Positives = 118/427 (27%), Gaps = 62/427 (14%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           ++     + + + + L+       ++  A + A L+          I  P    +   + 
Sbjct: 1   MMFPAMMMILAFTMQLSQQFLAHARLSEASEVASLAL---------IASPKEDDENNVSY 51

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
            +K + +++       +      +    +     +       +         ++      
Sbjct: 52  ARKLVDRYVVDNIDDIKVTVKNKRCEYKDGCVQSSGEAAPFTDFTVAATAKHKSWISYE- 110

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
              +L      +   + R      + +  ++D+S SM   +    +  + + +       
Sbjct: 111 -NISLKPEFTVNGSSVTRKFLPQPVDVYFIVDMSASMRATWQNGKSQIDEVKNVIT-RVV 168

Query: 184 PPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAY 243
              K F ++  ++           ++    +E+    +       Q   N+      +  
Sbjct: 169 NDLKDFDTEVKSRVALLGYHNFNIKQGGRSLEAYDYAL--YNTPQQTVSNMFFPPKRVNP 226

Query: 244 NI-GIVGNQCTPLSNNLNEVKSRLNKLN----PYENTNTYPAMHHAYRELYNEKESSHNT 298
           +  G+  ++   L+ N +     +N  N        T ++  +             + + 
Sbjct: 227 SDSGLFSHRDIDLTQNYSSFLQIMNDRNFYPPRSACTESWQGII--------AAAQAADK 278

Query: 299 IGSTRLKKFVIFITDGENSGA------------SAYQNTLNTLQICEYMRNA-------- 338
                 ++  I ++DG +                 Y   L    +C+ ++          
Sbjct: 279 ATDINPEQVFIILSDGADCPWQRQDRWGRLRTTEYYLKKLVDGGLCKNLKQRIRQKPNRF 338

Query: 339 -----------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKI 387
                       + +  + V+      D    C       +         + +  I + I
Sbjct: 339 QSSTPTENEKTKVTMGVIGVNYQVNPNDGFGDCV-GRENIYHATQGE---DVYKYILNLI 394

Query: 388 QEQSVRI 394
            E++ R+
Sbjct: 395 NEETGRL 401


>gi|146292146|ref|YP_001182570.1| von Willebrand factor, type A [Shewanella putrefaciens CN-32]
 gi|145563836|gb|ABP74771.1| von Willebrand factor, type A [Shewanella putrefaciens CN-32]
          Length = 633

 Score = 84.2 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/363 (10%), Positives = 94/363 (25%), Gaps = 41/363 (11%)

Query: 36  AVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITK 95
           A L+    I +        +              K  ++  + ++    I    +I I+ 
Sbjct: 108 ASLAAKHVINTHYVAAPIASDAW--------YGIKQPERNRFEKQIQNGIMVAGEIPIS- 158

Query: 96  DKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLD 155
                     +    Y      +    L       +                +       
Sbjct: 159 ----TFSIDVD-TGSYSTLRRMIKEGSLPEKGTIRIEEMLNYFTYDY----PLPNKNAAP 209

Query: 156 VSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIE 215
            S + E      ++D   +            +   S              +  K+ +L  
Sbjct: 210 FSATTELAPSPYNDDMMLLRIGLKGYELTKSELGASNLVFL-LDVSGSMASADKLPLLQT 268

Query: 216 SAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENT 275
           +   L   +            ++  + Y             +++  +   L +L    +T
Sbjct: 269 ALKMLTQQLSAQD--------KVSIVVYAGAAGVVLDGASGDDIQALTYALEQLRAGGST 320

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
           N    +  AY+                     VI  TDG+ +      N    + + E  
Sbjct: 321 NGSQGILQAYQLAQKHFIQGGINR--------VILATDGDFNVGV--TNFDQLISLIEKE 370

Query: 336 RNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRI 394
           +  G+ + ++          L+ +  D   G +  ++    L E+   + D++    + I
Sbjct: 371 KQRGIGLTTLGFGMDNYNDQLMEQLADKGNGHYAYIDT---LNEARKVLVDELSSTLLTI 427

Query: 395 APN 397
           A +
Sbjct: 428 AKD 430


>gi|254882023|ref|ZP_05254733.1| BatA aerotolerance operon protein [Bacteroides sp. 4_3_47FAA]
 gi|294776174|ref|ZP_06741663.1| von Willebrand factor type A domain protein [Bacteroides vulgatus
           PC510]
 gi|319640969|ref|ZP_07995677.1| hypothetical protein HMPREF9011_01274 [Bacteroides sp. 3_1_40A]
 gi|254834816|gb|EET15125.1| BatA aerotolerance operon protein [Bacteroides sp. 4_3_47FAA]
 gi|294449997|gb|EFG18508.1| von Willebrand factor type A domain protein [Bacteroides vulgatus
           PC510]
 gi|317387414|gb|EFV68285.1| hypothetical protein HMPREF9011_01274 [Bacteroides sp. 3_1_40A]
          Length = 332

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/252 (12%), Positives = 68/252 (26%), Gaps = 56/252 (22%)

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
               +         +          S    A      +++   + A   +          
Sbjct: 72  ARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLKPNRLEAAKQVASEFI---------- 121

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY--------ENTNTYPAMHH 283
            N                    PL+ +   + +  N +           + T     + +
Sbjct: 122 -NGRPNDNIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRGLIEDGTAIGMGIAN 180

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           A   L            S    K +I +TDG N+           L   E  +  G++IY
Sbjct: 181 AVTRL----------KDSKAKSKVIILLTDGSNNRGDIS-----PLTAAEIAKQFGIRIY 225

Query: 344 SVAVSAPPE--------------------GQDLLRKCT-DSSGQFFAVNDSRELLESFDK 382
           ++ V                          +  L +    ++G +F    + +L E + +
Sbjct: 226 TIGVGTNGTAPYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRATSNSKLKEVYQE 285

Query: 383 ITDKIQEQSVRI 394
           I DK+++  + +
Sbjct: 286 I-DKLEKTKLNV 296


>gi|256820507|ref|YP_003141786.1| von Willebrand factor type A [Capnocytophaga ochracea DSM 7271]
 gi|256582090|gb|ACU93225.1| von Willebrand factor type A [Capnocytophaga ochracea DSM 7271]
          Length = 333

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 66/181 (36%), Gaps = 43/181 (23%)

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
           K   + RIG + Y         TP++ +   + + L++L      + T     +  A   
Sbjct: 126 KDRPNDRIGLVIYAGESYTK--TPVTTDKGIILNALSELTYGQIEDGTAIGMGLATAVNR 183

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
           L            S    + +I +TDG N+        ++     E     G+++Y++ +
Sbjct: 184 L----------KESKAKSRVIILLTDGVNNTG-----FIDPQTAAELAAEYGIRVYTIGI 228

Query: 348 SAPPE----------------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKIT 384
            +                          + L++K  + + G++F   D+++L + +D+I 
Sbjct: 229 GSNGTALSPYALNPDGSIMYRMLQVEIDEPLMKKIAEVTHGRYFRATDNQKLQQIYDEIN 288

Query: 385 D 385
            
Sbjct: 289 K 289


>gi|301758046|ref|XP_002914871.1| PREDICTED: LOW QUALITY PROTEIN: vitrin-like [Ailuropoda
           melanoleuca]
          Length = 686

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/352 (11%), Positives = 92/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ R +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 356 RTHMNSRDLKTAIDKITQRGGLSNAGRAISYVTKNFFSKANGNRGGAPNVAVVIVDGWPT 415

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E+         N+F   +  +        +             +    L+V     
Sbjct: 416 DKVEEASRLARESGINIFFITVEGATENEKQYVTEPNFSNK-AVCRTNGFYSLNVQSWFS 474

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K  + S +        +         VL   A    
Sbjct: 475 LRKT---VQPLLKRVCDTDRLACSKTCWNSADIGFVIDGSSSVGTGNFRTVLQFVAN--- 528

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
                   E      R+G + Y             +  +++ + + ++      T+T  A
Sbjct: 529 ---ISKEFEISETDTRVGAVQYTYEQRLEFGFDDYHTKSDILNAIKRVGYWSGGTSTGAA 585

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +++A  +L+               +K +I ITDG +                    + G+
Sbjct: 586 INYALEQLF--------KKSKPNKRKLMILITDGRSYDDVRIP--------AMVAHHKGV 629

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ V      QD L            F V++   L +   K+   I  +
Sbjct: 630 TTYAIGV--AWAAQDELEVIATHPASDHSFFVDEFDNLYKFVPKVIRNICTE 679



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 50/156 (32%), Gaps = 19/156 (12%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           + +   R+  +  +   ++  ++             +G + Y              N  +
Sbjct: 309 SSSIGKRRFRIQKQFLADVAQTLDIGPGGPL-----MGVVQYGDNPAAQFSLRTHMNSRD 363

Query: 262 VKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           +K+ ++K+      +N   A+ +  +  +++   +     +       + I DG  +   
Sbjct: 364 LKTAIDKITQRGGLSNAGRAISYVTKNFFSKANGNRGGAPN-----VAVVIVDGWPTD-- 416

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                    +     R +G+ I+ + V    E +  
Sbjct: 417 ------KVEEASRLARESGINIFFITVEGATENEKQ 446


>gi|268316013|ref|YP_003289732.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
 gi|262333547|gb|ACY47344.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
          Length = 329

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 58/159 (36%), Gaps = 39/159 (24%)

Query: 251 QCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKF 307
              P + +   + + L +L      + T    A+  A   L            S    K 
Sbjct: 140 TQVPPTLDYRFLLTMLQRLQVGRLEDGTAIGTAIATAINRL----------KNSEARSKV 189

Query: 308 VIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA--------------VSAPPE- 352
           +I +TDG+N+        ++ L   E  R AG++IY++                   P+ 
Sbjct: 190 IILLTDGQNNRG-----EIDPLTAAELARQAGIRIYTIGLSGRGEAPYPVQTPFGTRPQP 244

Query: 353 -----GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                 + ++R+  + + G++F   D+R L   + +I  
Sbjct: 245 VPVEIDEAMMREVAEKTGGRYFRATDARTLEAIYAEIDR 283


>gi|281341943|gb|EFB17527.1| hypothetical protein PANDA_002811 [Ailuropoda melanoleuca]
          Length = 652

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/352 (11%), Positives = 92/352 (26%), Gaps = 31/352 (8%)

Query: 42  ASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPL 101
            + ++ R +K    K  Q   +            ++  +  G+      + +      P 
Sbjct: 322 RTHMNSRDLKTAIDKITQRGGLSNAGRAISYVTKNFFSKANGNRGGAPNVAVVIVDGWPT 381

Query: 102 QYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSME 161
             + E+         N+F   +  +        +             +    L+V     
Sbjct: 382 DKVEEASRLARESGINIFFITVEGATENEKQYVTEPNFSNK-AVCRTNGFYSLNVQSWFS 440

Query: 162 DLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLV 221
                                   K  + S +        +         VL   A    
Sbjct: 441 LRKT---VQPLLKRVCDTDRLACSKTCWNSADIGFVIDGSSSVGTGNFRTVLQFVAN--- 494

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPA 280
                   E      R+G + Y             +  +++ + + ++      T+T  A
Sbjct: 495 ---ISKEFEISETDTRVGAVQYTYEQRLEFGFDDYHTKSDILNAIKRVGYWSGGTSTGAA 551

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           +++A  +L+               +K +I ITDG +                    + G+
Sbjct: 552 INYALEQLF--------KKSKPNKRKLMILITDGRSYDDVRIP--------AMVAHHKGV 595

Query: 341 KIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKIQEQ 390
             Y++ V      QD L            F V++   L +   K+   I  +
Sbjct: 596 TTYAIGV--AWAAQDELEVIATHPASDHSFFVDEFDNLYKFVPKVIRNICTE 645



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 50/156 (32%), Gaps = 19/156 (12%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           + +   R+  +  +   ++  ++             +G + Y              N  +
Sbjct: 275 SSSIGKRRFRIQKQFLADVAQTLDIGPGGPL-----MGVVQYGDNPAAQFSLRTHMNSRD 329

Query: 262 VKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
           +K+ ++K+      +N   A+ +  +  +++   +     +       + I DG  +   
Sbjct: 330 LKTAIDKITQRGGLSNAGRAISYVTKNFFSKANGNRGGAPN-----VAVVIVDGWPTD-- 382

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL 356
                    +     R +G+ I+ + V    E +  
Sbjct: 383 ------KVEEASRLARESGINIFFITVEGATENEKQ 412


>gi|297286914|ref|XP_001113364.2| PREDICTED: collagen alpha-6(VI) chain-like [Macaca mulatta]
          Length = 2262

 Score = 84.2 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/335 (12%), Positives = 101/335 (30%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  IKK  K+    R  +       QI +     +    + ++          +F 
Sbjct: 306 KAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGVTIFT 365

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  ++ T L   ++   E+    L     +       ++ L           +    +
Sbjct: 366 LGIKGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 425

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 426 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKIFLSEVVGMFNIAPHK-----V 474

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN-PYENTNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +     NTNT  A++     L   K+  
Sbjct: 475 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQLGGNTNTGAALNFTLSLLQKAKKQR 534

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ +      Q 
Sbjct: 535 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGI--KEANQT 579

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 580 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICAE 614



 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 63/164 (38%), Gaps = 15/164 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYR 286
              +  N  VRIG   ++                E+  ++  +     NT+   A+    R
Sbjct: 1030 DFDVSNKRVRIGAAQFSDAYRPEFPLGTFIGAKEISIQIENITQIFGNTHIGAAL----R 1085

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            ++ +       +  +T   + ++ +TDG++             Q  E +R  G+ IYSV 
Sbjct: 1086 KVEHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEALRRRGIDIYSVG 1137

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +    + Q L++  T ++ +   V++  EL +   +I   I   
Sbjct: 1138 IG-DVDDQQLMQ-ITGTAEKKLTVHNFDELKKVNKRIVRNICTT 1179



 Score = 67.2 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 61/174 (35%), Gaps = 15/174 (8%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TN 276
             +++ ++KA  +     VR G + Y                 EV S L         T 
Sbjct: 831 DFMIDIVRKA--DVGMNRVRFGALKYADDPEVLFYLDNFGTKPEVISVLQTDQAMGGNTY 888

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
           T  A+  +          +  +  +  + + +I ITDG     S   + LN     + +R
Sbjct: 889 TAEALGFSDHMFTE----ARGSRLNKGVPQVLIVITDG----DSHDADKLNAT--AKALR 938

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + G+ + +V + A     +LL     SS ++F V     L      +T  +   
Sbjct: 939 DKGILVLAVGI-ADANPVELL-AMAGSSDKYFFVETFGGLKGIISDVTASVCNS 990



 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 54/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 658 DRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTK 717

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            S         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 718 GSRP------SVRKFLILITDGEAQD--------IVKEPAVALRQEGVIIYSVGVFGSNV 763

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 764 ---TQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPR 800


>gi|294141918|ref|YP_003557896.1| von Willebrand factor type A domain-containing protein [Shewanella
           violacea DSS12]
 gi|194578715|dbj|BAG66042.1| von Willebrand factor typeA domain protein [Shewanella violacea]
 gi|293328387|dbj|BAJ03118.1| von Willebrand factor type A domain protein [Shewanella violacea
           DSS12]
          Length = 689

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/332 (10%), Positives = 90/332 (27%), Gaps = 33/332 (9%)

Query: 67  QIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPS 126
             ++     ++ R+ A  I    +I ++    +           Y      +    L   
Sbjct: 154 AFREASSSDNFKRQTANGIMVAGEIPVSTFSIDTD------TGSYTTLRRWINQGRLPEK 207

Query: 127 ALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPK 186
               +         + S    +     ++   +        ++    +            
Sbjct: 208 GTVRVEEMINYFNYQYSTPSTVEQPFSVNTELAPSPY----NDHKMLLRIGLKGYEVDKS 263

Query: 187 KSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIG 246
           +   S              +  K+ +L  S   L   + +           +  + Y   
Sbjct: 264 QLGASNLVFL-LDVSGSMNSRDKLPLLKTSLKMLSQQLSEQD--------HVSIVVYAGA 314

Query: 247 IVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKK 306
                     N++  +   LN L    +TN    +  AY                     
Sbjct: 315 SGVVLDGVKGNDIYAINQALNNLKAGGSTNGGAGIQQAYGLAQKHFIQGGVNR------- 367

Query: 307 FVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-G 365
            VI  TDG+ +  +   +    + +    R+ G+ + ++          L+ +  D   G
Sbjct: 368 -VILATDGDFNVGT--TDHQALMDLIASKRDQGIALTTLGFGQGNYNDHLMEQLADKGNG 424

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            +  ++    L E+   + D++    + IA +
Sbjct: 425 HYAYIDT---LNEARKVLVDELSSTLLTIAKD 453


>gi|254368552|ref|ZP_04984568.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157121455|gb|EDO65646.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 339

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 75/205 (36%), Gaps = 47/205 (22%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           A      + D+++  A   +++ +           R+G I +         TPL+ ++  
Sbjct: 118 ANGQMESRFDLVMRVANQFIDTRK---------GDRVGLILFGTRAYLQ--TPLTFDIAT 166

Query: 262 VKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSG 318
           VK  L+  +   P   T    A+  A ++L      S          K +I +TDGEN+ 
Sbjct: 167 VKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------KALILLTDGENNS 216

Query: 319 ASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-----------------PEGQDLLRKCT 361
                 TL  LQ  E  +   +KIY++ +                         +L K  
Sbjct: 217 G-----TLQPLQAAEIAKQYHIKIYTIGLGGDQMIVETTFGQRLVNTSEDLDTTVLEKIA 271

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + G++F   +S +L + ++ I  
Sbjct: 272 TMTGGKYFRAQNSSDLKKVYESIDK 296


>gi|332185631|ref|ZP_08387379.1| hypothetical protein SUS17_560 [Sphingomonas sp. S17]
 gi|332014609|gb|EGI56666.1| hypothetical protein SUS17_560 [Sphingomonas sp. S17]
          Length = 420

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 50/435 (11%), Positives = 116/435 (26%), Gaps = 64/435 (14%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M A+ + V    I   +D A     +++        + +   +       K+     D T
Sbjct: 2   MFALALPVLTCSIGMGVDYARAAKAQSK--------LNAIADAAALLAVSKNAMRADDAT 53

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +  F +             +         Q     +          + ++          
Sbjct: 54  AAYFARSFFSLQSAALVKSDGITLSNVTVQAPTDGNGRRTAVVNYRATSE-------NVF 106

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKH-NDNNNMTSNKY 179
             ++  +   +S +S      +     I   M+LDVS SM         N      +++ 
Sbjct: 107 ARILGMSTLTISGKSETANAIA---PDIDFYMLLDVSASMALPTTSSGLNKVAQSNTSRC 163

Query: 180 LLPPPPKKSFWSKNTTKSKY-----APAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234
           +      +  +       K               +ID   ++   L  + +     K   
Sbjct: 164 VFACHTGEKRFRGYDAHGKQTDLYGVALSYGLPLRIDAEGDAVNQLTATARSMA-SKNGS 222

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-----------------YENTNT 277
             RI    +      +   PL+N+L     +   L P                     + 
Sbjct: 223 DYRIAITTFRGARGFSVRQPLTNDLTAAGHKAANLKPPYYASIGCPTSACKSSEVGWNDR 282

Query: 278 YPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT---LQICEY 334
                 A  ++        + +     +  V  +TDG  +  S              C+ 
Sbjct: 283 DTGSSDAMDQINAMIPQPGSGVNGQDPQAVVFMVTDGMRNEKSPKGARPEVAFDTAKCDM 342

Query: 335 MRNAGMKI---YSVAVSAPPEG---------------QDLLRKCTDSSGQFFAVNDSREL 376
           +++ G++I   Y+  +    +G               +  L+ C    G +  V    ++
Sbjct: 343 IKHRGIRIAVLYTEYLRDAVKGTTNLERSVEPYLYQVEPALQSCAS-PGLYTKVTTDGDI 401

Query: 377 LESFDKITDKIQEQS 391
             + + +       +
Sbjct: 402 SAALNTLFQNAVATT 416


>gi|149918184|ref|ZP_01906676.1| hypothetical protein PPSIR1_11265 [Plesiocystis pacifica SIR-1]
 gi|149820944|gb|EDM80351.1| hypothetical protein PPSIR1_11265 [Plesiocystis pacifica SIR-1]
          Length = 522

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/334 (12%), Positives = 93/334 (27%), Gaps = 24/334 (7%)

Query: 65  KKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLI 124
                          E+     +    +  +   + +    +  A Y      L    L 
Sbjct: 29  SSYQTHSSPLLEVGSEDYAPRRENPYFDAARVPLSTVSVDVD-TAAYSNVRRFLRDGHLP 87

Query: 125 PSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPP 184
           PS    +            +  A +  +    S + E       ++   +          
Sbjct: 88  PSDAVRIEELINYFDYDYPQPAADAEGVAEPFSVTTEVGPCPWSDEARLVHIGLQGKS-I 146

Query: 185 PKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN 244
           P++    +N               K+ +L +S   LVN +             +  + Y 
Sbjct: 147 PERELPPRNLVFLLDVSGSMHDQDKLPLLTDSLRVLVNQLG--------ERDHVAIVVYA 198

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRL 304
                       ++   + + +++L    +TN    +  AY       +           
Sbjct: 199 GASGVVLPPTRGSDRGTILAAISELRAGGSTNGGEGIQKAYALAREHFDPQGINR----- 253

Query: 305 KKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS 364
              VI  TDG+ +  +  ++ L    + E  R +G+ +  +       G   +    D  
Sbjct: 254 ---VILATDGDFNVGTTTESGL--ENLIERERESGVFLTVLGFGRGNLGDRTMEMLADKG 308

Query: 365 -GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
            G +  ++    L E+   +  +     V IA +
Sbjct: 309 NGNYAYIDS---LAEARKVLGTEAGSTLVTIAKD 339


>gi|238020799|ref|ZP_04601225.1| hypothetical protein GCWU000324_00689 [Kingella oralis ATCC 51147]
 gi|237867779|gb|EEP68785.1| hypothetical protein GCWU000324_00689 [Kingella oralis ATCC 51147]
          Length = 554

 Score = 83.8 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/354 (10%), Positives = 95/354 (26%), Gaps = 30/354 (8%)

Query: 47  DRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY-IA 105
           +R+      +          +    +     + +N     +     +     NP+     
Sbjct: 48  ERSNAAAVKEYAGAPAYAALEKTARIAPAPSLPQNTEKYGKIESNPVQAVARNPVSTFSI 107

Query: 106 ES-KAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLY 164
           +     Y      L    L P+    +           +         V   +       
Sbjct: 108 DVDTGSYANARRFLNDNRLPPAHAVRIEELINYFDYGYAPPSDGKPFAVYTETIDSPWQA 167

Query: 165 LQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI 224
             K                PP    +  + + S  A        K+ ++ ++   L   +
Sbjct: 168 DAKLIKIAIKAKEIRSSALPPANLVFLVDVSGSMQA------QDKLPLVKKTLRILTKRL 221

Query: 225 QKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHA 284
           +           ++  I Y              + + +   +N+L    +T    A+  A
Sbjct: 222 RAED--------KVTLITYASNEKLVLPPTSGKDKDTILQAINQLEAGGSTAGEQALQMA 273

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
           Y +       +            ++  TDG+ +      NTL         R AG+ + +
Sbjct: 274 YAQAQKAYIKNGINR--------ILLATDGDFNVGITDFNTL--KDTVAEKRKAGISLTT 323

Query: 345 VAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           +        + L+ +  D+  G +  +++  E  +       ++      +A +
Sbjct: 324 LGFGTGNYNEQLMEQLADAGDGNYSYIDNETEAKKVLQ---RQLSSTLATVAQD 374


>gi|160889563|ref|ZP_02070566.1| hypothetical protein BACUNI_01987 [Bacteroides uniformis ATCC 8492]
 gi|317480055|ref|ZP_07939167.1| von Willebrand factor type A domain-containing protein [Bacteroides
           sp. 4_1_36]
 gi|156861080|gb|EDO54511.1| hypothetical protein BACUNI_01987 [Bacteroides uniformis ATCC 8492]
 gi|316903797|gb|EFV25639.1| von Willebrand factor type A domain-containing protein [Bacteroides
           sp. 4_1_36]
          Length = 327

 Score = 83.8 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   + + L  +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           L   E  
Sbjct: 168 AIGMGIANAVTRL----------KDSKAKSKVIILLTDGVNNKGDIS-----PLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|225024147|ref|ZP_03713339.1| hypothetical protein EIKCOROL_01015 [Eikenella corrodens ATCC
           23834]
 gi|224943172|gb|EEG24381.1| hypothetical protein EIKCOROL_01015 [Eikenella corrodens ATCC
           23834]
          Length = 573

 Score = 83.8 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 40/383 (10%), Positives = 98/383 (25%), Gaps = 39/383 (10%)

Query: 18  DLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSY 77
           D       R  +++   AAV S                              + +     
Sbjct: 50  DYYESRNARFSLRAMPQAAVKSAA-------PADLSANAAPMAEAAVGSVATRQMAPPRQ 102

Query: 78  IRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTG 137
             E  G         + +   +      ++ +   I         L P+    +      
Sbjct: 103 NTERYGHYEPNPVHAVAEQPVSTFSIDVDTGSYANIRRFLTQTGRLPPADAVRIEEIINY 162

Query: 138 IIERSSENLAISICMV--LDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTT 195
                ++        V    V                    ++  LPP            
Sbjct: 163 FDYGYAKPTDGKPFAVHTETVDSPFRSGAKLIRIGIQAKEVSQAALPPANLVFLVD---- 218

Query: 196 KSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL 255
                     +  K+ ++  +   L +  +           RI  + Y  G         
Sbjct: 219 ----VSGSMYSRDKLPMVKYTLCTLAHQTRAQD--------RITLVTYADGNKVVLPPTP 266

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
            N   ++ + L+ L    +T    A+         +   +            ++  TDG+
Sbjct: 267 GNQRQKILAALDSLKAGGSTAGENAIQ--------QAYQAAQRAYIRNGINRILLATDGD 318

Query: 316 NSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSR 374
            +      NTL +  +    R +G+ + ++   +    + L+ +  D+  G +  ++   
Sbjct: 319 FNVGITDFNTLRS--MVAEKRKSGISLTTLGFGSGNYNERLMEQLADAGDGNYSYIDSPE 376

Query: 375 ELLESFDKITDKIQEQSVRIAPN 397
           E  +    +  ++      +A +
Sbjct: 377 EAQKV---LHRQLSSTLATVAQD 396


>gi|87306401|ref|ZP_01088548.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
 gi|87290580|gb|EAQ82467.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
          Length = 578

 Score = 83.8 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/334 (11%), Positives = 91/334 (27%), Gaps = 22/334 (6%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           + A+++ V   F+  ++D+ ++  +++Q+Q ++D+A L+G  +++    +   T  +  T
Sbjct: 26  LAAVLMIVMMGFMALSVDVGYMFTMQSQLQRSVDSAALAGAGTLIEGEDVATGTVHEYLT 85

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIA--------ESKAQYE 112
                 Q K+  +  +    +         + +T  + N                  +  
Sbjct: 86  HNPVGLQWKEFTEGNTADNVDKFLTKYGDGLQLTIGEWNDTSGQVVAAEKNPTTVSVRMT 145

Query: 113 IPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNN 172
                 F   L+     +++  S           +  I +VLD+S SM D          
Sbjct: 146 YENMPFFFGHLLGRDSFDITAESIATY------QSRDIMLVLDLSGSMNDDSEFNSIGKL 199

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKS---KYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                                       +YA    P  +       S     NS+     
Sbjct: 200 GFDHIYSNSQQMYADLGSPIFGNLQFDPQYAVVNGPTPQSSGQAKSSVTYRGNSVVVKSD 259

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELY 289
           +         +               + N N+    +         +         +   
Sbjct: 260 KTIKQISVKTSNGSTYNYYPGSSLNYTANPNKEIRYV--WVTSGKNSNNSD---QVQSFD 314

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            + +  +    +  L         G  +    Y 
Sbjct: 315 FDGQRINTIKTALGLDNLAYPYPGGSWNDYVNYC 348



 Score = 48.4 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 42/373 (11%), Positives = 86/373 (23%), Gaps = 63/373 (16%)

Query: 67  QIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPS 126
                           G++    Q  +           A+S   Y   +  +     I  
Sbjct: 205 YSNSQQMYADLGSPIFGNLQFDPQYAVVNGPTPQSSGQAKSSVTYRGNSVVVKSDKTIKQ 264

Query: 127 ALTNLS---------LRSTGIIERSSENLAISICMVLDVSRS----MEDLYLQKHNDNNN 173
                S           S       ++ +          S +        +  +  +   
Sbjct: 265 ISVKTSNGSTYNYYPGSSLNYTANPNKEIRYVWVTSGKNSNNSDQVQSFDFDGQRINTIK 324

Query: 174 MTSN-KYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                  L  P P  S+                  R           L+     +     
Sbjct: 325 TALGLDNLAYPYPGGSWNDYVNYCLGTGQNNNAGYRYRFGYFNWINYLLERQYSSNSTPD 384

Query: 233 ------------NLSVRIGTIAYNIGIVGNQC---------------TPLSNNLNEVKSR 265
                         SV +       G   ++                + L+ NL  + ++
Sbjct: 385 LWKASAQPITAVKNSVDLFIHFMQEGDGRDRIGLAVYNAPNGDGLLESTLTENLPFIMTQ 444

Query: 266 LNKLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAY 322
             +         TN    M     EL           G     K ++ +TDG+ +  +  
Sbjct: 445 SRQRQAGHYHNYTNIGGGMTVGREELQT--------RGRKGAVKMMVLLTDGQANWVNGG 496

Query: 323 QNTLNTLQ-ICEYM---RNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAV-------N 371
            N       +        + G  I ++++ A  +   + +    + G  F V        
Sbjct: 497 VNNNAAKNYVLNEAYLCADQGFTIITISLGAGADKALMDQVAEITGGVHFNVPGGQTVDE 556

Query: 372 DSRELLESFDKIT 384
            S +L E F ++ 
Sbjct: 557 YSEDLTEIFRQVA 569


>gi|90418447|ref|ZP_01226359.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338119|gb|EAS51770.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 636

 Score = 83.8 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/290 (12%), Positives = 70/290 (24%), Gaps = 76/290 (26%)

Query: 174 MTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKN 233
                   P     S +  N      + +P  A   +    + A    +           
Sbjct: 350 TLFVPTFAPDEYDDSDYGWNDYLDSGSGSPGSAKEAMAEQAKVAKYFDSGYSITTPSSNR 409

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKE 293
                     N        TPL+  L  V   ++ +     TN    +   +R L     
Sbjct: 410 SD-----WGPNSTCATTPITPLTKTLKTVTDAIDVMGAQGATNIPHGLAWGWRLLTARPP 464

Query: 294 -SSHNTIGSTRLKKFVIFITDGENSGA--------------------------------- 319
            +   +       K ++ +TDG N+                                   
Sbjct: 465 FTEGRSHDEPDNLKVLVLMTDGNNTYNLNSGGRPLEIRDYNRSTYGSYGYGAAYSHGSSS 524

Query: 320 -----SAYQNTLNTLQ----------------ICEYMRN--------AGMKIYSVAVSAP 350
                     T N                   +CE ++          G+ I+++A    
Sbjct: 525 RKPGRIYDGTTGNAKDYSVDSYVAAMDQNVAKVCENVKADGRKPGGTDGILIFTIAFDLR 584

Query: 351 PEG--QDLLRKCTDSS------GQFFAVNDSRELLESFDKITDKIQEQSV 392
                + L+  C  +         ++      EL  +F  IT++I    +
Sbjct: 585 DGEPVKKLMEDCASNGLIDASEKLYYDAQSQEELAAAFQSITEQISSLRI 634



 Score = 41.4 bits (95), Expect = 0.26,   Method: Composition-based stats.
 Identities = 42/351 (11%), Positives = 84/351 (23%), Gaps = 66/351 (18%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             + + V  L    A+DL+ I      +Q                   +      ++   
Sbjct: 38  FGLTLPVLALCFATAVDLSGIYGANRSLQQ---------------AADVAALAAGREYGR 82

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTEN-LFL 120
           T     +   + +  +      +     Q +           I +  A+ ++PT     L
Sbjct: 83  TQDADYL-SSVSEAFFFHNAGDETRGTTQFSYDGVFREDGLTILKVTARRQLPTFFGDAL 141

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             +    L           E   +N +I + +VLD S SM+D                  
Sbjct: 142 MWVTGGKLDWRQFPLYAKSEIVVQNRSIELALVLDNSGSMQDRPR--------------- 186

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                                    +  KID++ ++A +L      + +           
Sbjct: 187 ----------------------SGGSKSKIDIIKDAAEDLAKQFLSSDKGSTEEFPVQFA 224

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRL----NKLNPYENT--NTYPAMHHAYRELYNEKES 294
           +      V       + +  + + R       L+        T           +     
Sbjct: 225 VVPFSSSVNVGPQYKNADWMDTQGRSPIHHENLDWGGWLSGATSGGWEWIRDRGWVYTAP 284

Query: 295 SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQI------CEYMRNAG 339
           S     +     +   IT GE        +             C   R  G
Sbjct: 285 SSGAPMARYNGSYWTRITTGEPLTRFYVYDNARYKSQFGTWRGCVEARPNG 335


>gi|119720657|ref|YP_921152.1| von Willebrand factor, type A [Thermofilum pendens Hrk 5]
 gi|119525777|gb|ABL79149.1| von Willebrand factor, type A [Thermofilum pendens Hrk 5]
          Length = 327

 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 62/205 (30%), Gaps = 26/205 (12%)

Query: 191 SKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGN 250
                 S       P   KI+V   +A  LV  +   +                      
Sbjct: 103 VLVVDVSGSMEDSIPGGVKIEVARRAATLLVERMPGGVDVG----------LLAFSDRIV 152

Query: 251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIF 310
              P + +   V   +  L P   T     +  A   L                   V+F
Sbjct: 153 LSLPPTGDRRRVLDAIESLKPGGGTMYTYPLQAALSWLKP--------YKLFNASTLVVF 204

Query: 311 ITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-GQDLLRKCT-DSSGQFF 368
           ++DG         +      +    R+ G+ +Y+V +    + G+  L+     + G+ +
Sbjct: 205 VSDGLP------ADAATYRTLLSEFRSLGIPVYTVYIGPGGDEGERELKLIAGSTGGEEY 258

Query: 369 AVNDSRELLESFDKITDKIQEQSVR 393
               + ELL++F  + +K     VR
Sbjct: 259 TAGSAEELLKAFKTLAEKASSILVR 283


>gi|307565272|ref|ZP_07627765.1| von Willebrand factor type A domain protein [Prevotella amnii CRIS
           21A-A]
 gi|307345941|gb|EFN91285.1| von Willebrand factor type A domain protein [Prevotella amnii CRIS
           21A-A]
          Length = 318

 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 67/196 (34%), Gaps = 31/196 (15%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY- 272
            +   N +   ++   +  +                    PL+ +   + + LN +    
Sbjct: 103 NDVIPNRLEVAKEVASDFISGRPNDNIGLTIFAGEAFTQCPLTTDHASLINLLNSVRTDL 162

Query: 273 -------ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNT 325
                  + T     + +A   L            S    K VI +TDG N+  S     
Sbjct: 163 VVKGLIQDGTAIGMGLINAVGRL----------KSSKAKSKVVILLTDGSNNVGSIS--- 209

Query: 326 LNTLQICEYMRNAGMKIYSVAVSAPPE------GQDLLRKCTD-SSGQFFAVNDSRELLE 378
              +   E  +   +++Y++ +               LR+  + ++G+F++     EL +
Sbjct: 210 --PMTAAEIAKKFNIRVYTIGLGTEQNNGYSDIDYTTLRQIANVTNGKFYSAQSQTELSQ 267

Query: 379 SFDKITDKIQEQSVRI 394
            +  I +K+++  ++I
Sbjct: 268 IYKDI-NKLEKTKLKI 282


>gi|208780564|ref|ZP_03247903.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
 gi|208743539|gb|EDZ89844.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
          Length = 333

 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 73/202 (36%), Gaps = 43/202 (21%)

Query: 210 IDVLIESAGNLVNSIQKAIQEKKNLSV-----RIGTIAYNIGIVGNQCTPLSNNLNEVKS 264
           I  + ++ G + +     ++            R+G I +         TPL+ ++  VK 
Sbjct: 106 IQDMKKANGQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQ--TPLTFDIATVKK 163

Query: 265 RLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASA 321
            L+  +   P   T    A+  A ++L                 K +I +TDGEN+    
Sbjct: 164 MLDDASIALPGPQTAIGDAIGLAVKKL----------KKFPGDSKALILLTDGENNSG-- 211

Query: 322 YQNTLNTLQICEYMRNAGMKIYSVAVS-----------------APPEGQDLLRKCTD-S 363
              TL  LQ  E  +   +KIY++ +                  +      +L K    +
Sbjct: 212 ---TLQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMT 268

Query: 364 SGQFFAVNDSRELLESFDKITD 385
            G++F   +S +L + ++ I  
Sbjct: 269 GGKYFRAQNSSDLKKVYESIDK 290


>gi|192359934|ref|YP_001981670.1| von Willebrand factor type A domain-containing protein [Cellvibrio
           japonicus Ueda107]
 gi|190686099|gb|ACE83777.1| von Willebrand factor type A domain protein [Cellvibrio japonicus
           Ueda107]
          Length = 674

 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/389 (8%), Positives = 90/389 (23%), Gaps = 31/389 (7%)

Query: 10  FLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIK 69
            +      +L+     +++ ++  D         +   +    P       +        
Sbjct: 140 IVVTGMRAELSQAEERQHKAKAIADR-----QRRMAEAQMAAKPMAAAPTAAVHADAYAP 194

Query: 70  KHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAES-KAQYEIPTENLFLKGLIPSAL 128
             + Q +                I    N    +  +   A Y      L    L P   
Sbjct: 195 ADILQATTREYRDRFNQVDDNPVIATRDNPFSTFSIDVDTAAYSFTRRLLNQGQLPPKDA 254

Query: 129 TNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKS 188
             +               +       +++              +       L      +S
Sbjct: 255 VRIEEMVNYFDYSYPLPSSAQTPFTTNITVLDSPWKPGNKL-LHIGIQGYQLPAGHIPQS 313

Query: 189 FWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIV 248
                               K+ ++ +S   L+++++            +  + Y     
Sbjct: 314 NLV----FLLDVSGSMDEPSKLPLVKQSMELLLSTLKPEDT--------VAIVVYAGAAG 361

Query: 249 GNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
                      +++ + L+ L    +T     +  AY+                     +
Sbjct: 362 TVLEPTKVREKSKILAALHNLQAGGSTAGGEGLALAYQLAEANFNPKGVNR--------I 413

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFF 368
           I  TDG+ +        L      E  R  G+ +  +          L++    +     
Sbjct: 414 ILATDGDFNVGQTGDEPL--QDFVERKRAKGIYLSVLGFGQGNYQDALMQTLAQNGNG-- 469

Query: 369 AVNDSRELLESFDKITDKIQEQSVRIAPN 397
                  L E+   + ++       IA +
Sbjct: 470 TAAYIDTLSEAQKVLVNEATSTLFPIARD 498


>gi|153812017|ref|ZP_01964685.1| hypothetical protein RUMOBE_02410 [Ruminococcus obeum ATCC 29174]
 gi|149831916|gb|EDM87002.1| hypothetical protein RUMOBE_02410 [Ruminococcus obeum ATCC 29174]
          Length = 2099

 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 46/368 (12%), Positives = 107/368 (29%), Gaps = 31/368 (8%)

Query: 51   KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQY-IAESKA 109
            +  +     T    +      ++      +     +    I  T    +          A
Sbjct: 1192 ETGSQVNGYTVETTQTVSGGDVQSDGKSTKIGEKDSATFTITNTYTPIDINSVIEYNKTA 1251

Query: 110  QYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHN 169
                  +  +   L  S+ T  S+++   I    +         ++ ++        +  
Sbjct: 1252 TLLDWNQRTYKIDLTASSKTTQSMKTPYDIVLVLDQSGSMSQKFVEYNKINGSSMFWRKT 1311

Query: 170  DNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQ 229
                  +  Y        + WS   + S       P    + V  +S    +++++ A  
Sbjct: 1312 YYIKTQNGIYQQLSWSWDNTWSYTDSYSGKTVTVDPNTTDVYVAQKSNQTKIDALKSAAT 1371

Query: 230  E------KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE-------VKSRLNKLNPYENTN 276
                    KN   R+G + ++        T  S  L +       + + ++ L    +T 
Sbjct: 1372 TFVNNVANKNSDCRVGIVTFSNDGYIKPITNNSYTLAKVGTSKGDIINTIDGLKTGGDTY 1431

Query: 277  TYPAMHHAYRELYNEKESSHNT-IGSTRLKKFVIFITDGEN---SGASAYQNTLNT-LQI 331
                +  A         +S  T   +   KK V+F+TDG     +  +  +N        
Sbjct: 1432 PAKGLDKANEIFSENSSNSWETVEQTDGRKKMVVFLTDGVPAPANTNNFDENLAGAGTNS 1491

Query: 332  CEYMRNAGMKIYSVA-VSAPPEG-----------QDLLRKCTDSSGQFFAVNDSRELLES 379
             + + + G+  Y++    A                  ++    S  ++   +    L   
Sbjct: 1492 AKILHDQGVATYALGIFGAANSDGTMDNASVQRIDKYMQSIASSHEKYMTADSVDNLSSL 1551

Query: 380  FDKITDKI 387
            F+ IT+ I
Sbjct: 1552 FESITNNI 1559


>gi|256419476|ref|YP_003120129.1| hypothetical protein Cpin_0430 [Chitinophaga pinensis DSM 2588]
 gi|256034384|gb|ACU57928.1| conserved hypothetical protein [Chitinophaga pinensis DSM 2588]
          Length = 336

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 72/205 (35%), Gaps = 41/205 (20%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + + ++      +  +                 P++ +   +K+++ ++      + T
Sbjct: 116 DRLEAAKRVAMNFVDSRISDRIGLVIFSGESFTQCPITTDHGVLKNQIAQVKSGMLQDGT 175

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  +   L            S    K +I +TDG N+        ++ L   E  
Sbjct: 176 AIGMGLATSVERL----------RTSKAKSKVIILLTDGVNNTGL-----IDPLTALEIA 220

Query: 336 RNAGMKIYSVAVSA-----------PPE----------GQDLLRKCT-DSSGQFFAVNDS 373
           +   +++Y++ V                           + L++K + ++ G++F    +
Sbjct: 221 KAFKIRVYTIGVGTIGKAPFPMTMPDGSIQMQMQDVQLDEPLMKKISVETGGKYFRATSN 280

Query: 374 RELLESFDKITDKIQEQSVRIAPNR 398
           +EL   + +I DK+++  V I   +
Sbjct: 281 KELENIYGEI-DKLEKTKVEITSYK 304


>gi|19031201|gb|AAL17974.1| proximal thread matrix protein 1 [Mytilus galloprovincialis]
          Length = 453

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/236 (11%), Positives = 72/236 (30%), Gaps = 18/236 (7%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           +   +              +     +                +  +   A       ++ 
Sbjct: 218 NYVLTTNSFSELSTLLKLVIDLACEVCVVDCAGHADIAFVFDASSSIN-ANNPNNYQLMK 276

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-- 272
               ++V+   K   +    +V    + +             ++  ++K  ++K++P   
Sbjct: 277 NFMKDIVDRFNKTGPDGTQFAV----VTFADRATKQFGLKDYSSKADIKGAIDKVSPSII 332

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T     + +A  E++  +           ++K VI +TDG+N+G  + ++        
Sbjct: 333 GQTAIGDGLENARLEVFPNRNGGGR----EEVQKVVILLTDGQNNGHKSPEHES------ 382

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
             +R  G+ I ++ V      +  L     S    F  +   +L +  + +     
Sbjct: 383 SLLRKEGVVIVAIGVGTG-FLKSELINIASSEEYVFTTSSFDKLSKIMEDVVKLAC 437



 Score = 78.0 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/216 (12%), Positives = 60/216 (27%), Gaps = 14/216 (6%)

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                   +           ++ +    LV+S        +N S
Sbjct: 39  PGNTGKDAEECDVQADIIVLFDDSSSIQYDNKENYQMMKDFVKELVDSFTTVGVNGRNGS 98

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE 293
            + G + ++ G+             ++K  +  + P     T     + H     ++  E
Sbjct: 99  -QFGVVQFSQGVKTAFPLNKFKTKEDIKKGIQDMVPRNGGQTEIGTGLKHVRENSFSGAE 157

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
                 G+   +K VI +TDG+++                 ++  G+ + ++ +      
Sbjct: 158 GG----GNPDKQKIVILMTDGKSNAG------APPQHEAHKLKAEGVTVIAIGIGQG-FV 206

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +  L +           N   EL      + D   E
Sbjct: 207 KTELEQIATMKNYVLTTNSFSELSTLLKLVIDLACE 242


>gi|218678237|ref|ZP_03526134.1| hypothetical protein RetlC8_04927 [Rhizobium etli CIAT 894]
          Length = 120

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 2/109 (1%)

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT--LQICEYMRNAGMKIYSVA 346
            + ++++H        KK+++F+TDG+N+  S+   + +T   + C+  ++ G++IY++A
Sbjct: 11  NDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTATKKTCDDAKSKGIEIYTIA 70

Query: 347 VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIA 395
             AP  GQ LL  C      +F      +LL +F+ I  K   Q  R+ 
Sbjct: 71  FMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFEAIGAKSAAQVTRLT 119


>gi|326672754|ref|XP_002664126.2| PREDICTED: collagen alpha-1(XXI) chain-like [Danio rerio]
          Length = 572

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 65/176 (36%), Gaps = 19/176 (10%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHA 284
                      ++G + Y+     +       + +++   +  +      TNT  A+  A
Sbjct: 68  TMSFNIGQKFTQVGVVQYSDDPFLHIPLGKHFSSSDLIKAMESIEYMGGNTNTGRAIKFA 127

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
             +L+   E   N      + K  + +TDG++            L   E  R  G+ +++
Sbjct: 128 NDKLFALSERGPN-----GIAKIAVVLTDGKSQD--------EVLAAAEAARKKGIILFA 174

Query: 345 VAVSAPPEGQDLLRKCTDSSG--QFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           + V +    +  LR   +       F+V D + + +  + I  K+ E++V   P +
Sbjct: 175 IGVGSE-TEEAQLRAIANKPSSTYVFSVKDYKAIAKIREVIRQKLCEETV--CPAK 227


>gi|218462279|ref|ZP_03502370.1| hypothetical protein RetlK5_23628 [Rhizobium etli Kim 5]
          Length = 347

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 43/325 (13%), Positives = 100/325 (30%), Gaps = 45/325 (13%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQM----------QSALDAAVLSGCASIVSDRTI 50
           MTA+++         A+D AH + +R Q+            A  +  ++   ++ S+ T+
Sbjct: 19  MTALLMVPLLGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVAAAMAMNSNGTV 78

Query: 51  KDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQ 110
                 K     IF  Q+   L           ++     I++TK  N     +      
Sbjct: 79  SLG---KTDARNIFMSQMSGELA----------EVQVDLGIDVTKTANKLNSQV------ 119

Query: 111 YEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND 170
               T       ++      +S  +T           +   ++LD + SM          
Sbjct: 120 SFTATVPTTFMQILGRDSITISGTATA---EYQTAAFMDFYILLDNTPSMGVGATPDDVS 176

Query: 171 NNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQE 230
                +          K+  +    KS           +IDV+ ++   L ++ +     
Sbjct: 177 KLEAKAGCAFACHQMDKTINNYTIAKS------LGVAMRIDVVRQATQALTDTAKTERVS 230

Query: 231 KKNLSVRIGTIAYNIGIVG-NQCTPLSNNLNEVKSRLNKLNPY------ENTNTYPAMHH 283
                + + T             + L+++L +VK+  + ++         N +       
Sbjct: 231 SDQFRMGVYTFGTKAEDAKLTTISGLTSDLTKVKNYTDAVDLMTIPYQNYNNDQITNFDS 290

Query: 284 AYRELYNEKESSHNTIGSTRLKKFV 308
           A  ++    + + +   +   +K  
Sbjct: 291 AMTQMNTIIDQAGDGTSNISAEKSC 315


>gi|59713864|ref|YP_206639.1| hypothetical protein VF_A0681 [Vibrio fischeri ES114]
 gi|59482112|gb|AAW87751.1| hypothetical membrane spanning protein [Vibrio fischeri ES114]
          Length = 321

 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 71/204 (34%), Gaps = 47/204 (23%)

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
            +      ++  + +   + ++  +           R+G + +         TPL+ + N
Sbjct: 102 TSNGDFVDRLTAVKQVVSDFIDQRK---------GDRLGLVLFGDHAYLQ--TPLTFDRN 150

Query: 261 EVKSRLNK--LNPYE-NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS 317
            V+ +L++  LN     T     +  A +                  ++ +I ++DG N+
Sbjct: 151 TVREQLDRTVLNLVGQRTAIGEGLGLATKTFIESN----------APQRTIILLSDGANT 200

Query: 318 GASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-----------------PEGQDLLRKC 360
                   L  L+  +  ++   KIY+V + A                     +D L K 
Sbjct: 201 AGV-----LEPLEAAQLAKDNHAKIYTVGIGAGEMQVRGFFGKQTVNTARDLDEDTLTKI 255

Query: 361 TD-SSGQFFAVNDSRELLESFDKI 383
              + GQ+F   ++ EL E +  I
Sbjct: 256 ATMTGGQYFRARNADELAEIYQTI 279


>gi|91216721|ref|ZP_01253686.1| batA protein [Psychroflexus torquis ATCC 700755]
 gi|91185190|gb|EAS71568.1| batA protein [Psychroflexus torquis ATCC 700755]
          Length = 334

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 60/176 (34%), Gaps = 44/176 (25%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY----ENTNTYPAMHHAYRELYN 290
           + RIG + Y         TPL+ + + + + +N L         T     +  +  +L  
Sbjct: 130 NDRIGLVIYAGESYTK--TPLTTDKSIIFNAINDLEYSQNIEGGTAIGMGLATSVNKL-- 185

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
                     S    K +I +TDGEN+        ++     +      +K Y++ V + 
Sbjct: 186 --------KDSKAESKVIILLTDGENNAG-----FIDPKTATQLATEYDIKTYTIGVGSN 232

Query: 351 P----------------------EGQDLLRKCT-DSSGQFFAVNDSRELLESFDKI 383
                                    + LL+     + G++F   D+++    +++I
Sbjct: 233 GMALSPVGIKANGQFEYRNIEVKIDEALLKTIAESNGGKYFRATDNQKFEAIYEEI 288


>gi|270296687|ref|ZP_06202886.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270272674|gb|EFA18537.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 327

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   + + L  +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           L   E  
Sbjct: 168 AIGMGIANAVTRL----------KDSKAKSKVIILLTDGVNNKGDIS-----PLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|300776751|ref|ZP_07086609.1| aerotolerance protein BatA [Chryseobacterium gleum ATCC 35910]
 gi|300502261|gb|EFK33401.1| aerotolerance protein BatA [Chryseobacterium gleum ATCC 35910]
          Length = 330

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 71/211 (33%), Gaps = 41/211 (19%)

Query: 212 VLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271
           +  +   + + +++    +                       P++++   V   +  LN 
Sbjct: 101 LAKDLNPDRITALKDIAVKFVQKRPNDRIGVVAYAAEAFTKVPVTSDHQVVIDEIKNLNS 160

Query: 272 YE---NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNT 328
                 T     +  A   L   K  S          K VI +TDG ++     QN +  
Sbjct: 161 AGLEPGTAIGEGLSVAVNHLVKSKAKS----------KVVILMTDGVSN----IQNAIPP 206

Query: 329 LQICEYMRNAGMKIYSVAVSAPPE----------------------GQDLLRKCT-DSSG 365
               E  +N  +K+Y++ +                            ++ LR+    + G
Sbjct: 207 QVAAELAKNNNIKVYAIGIGTNGYALMPTSQDIFGDLVFTETEVTIDENTLREIAQTTGG 266

Query: 366 QFFAVNDSRELLESFDKITDKIQEQSVRIAP 396
           ++F    +  L E +D+I +++++  V+++ 
Sbjct: 267 KYFRATSNSSLEEVYDEI-NQLEKSDVKVSK 296


>gi|237737388|ref|ZP_04567869.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421250|gb|EEO36297.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
          Length = 319

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 63/180 (35%), Gaps = 40/180 (22%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKS-----RLNKLNPYENTNTYPAMHHAYRELY 289
           + RI  + +          PL+ + N VK        + +     T     +  +   L 
Sbjct: 120 NDRISLVVFGGDAYTK--VPLTFDHNVVKDITSKLTTDDITSNNRTAIGMGLGVSLNRL- 176

Query: 290 NEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA 349
                      S    K +I +TDGEN+           +   E  +  G+KIY++ + A
Sbjct: 177 ---------KDSEAKSKVIILMTDGENNSGEMS-----PMGASEIAKELGIKIYTIGIGA 222

Query: 350 ----------------PPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSV 392
                               ++LL+     + G++F     +E  E F++I D +++  +
Sbjct: 223 REIQIRVPFGHTTVKNTELDENLLKNIASTTGGEYFRAGSEKEFQEIFNRI-DSLEKTKI 281


>gi|305665951|ref|YP_003862238.1| BatA protein [Maribacter sp. HTCC2170]
 gi|88710726|gb|EAR02958.1| batA protein [Maribacter sp. HTCC2170]
          Length = 332

 Score = 83.0 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 61/193 (31%), Gaps = 41/193 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N ++++++   +                      TP++++ + V + L ++      + T
Sbjct: 111 NRLSALKEVAADFIRQRPNDRIGLVAYAGEAFTKTPITSDKSIVLNSLREITYGQLNDGT 170

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  +   L            S  + K +I +TDG N+        +      +  
Sbjct: 171 AIGMGLATSVNRL----------KESKAISKIIILLTDGVNNSG-----FIEPQTAADLA 215

Query: 336 RNAGMKIYSVAVSAPPE----------------------GQDLLRKCT-DSSGQFFAVND 372
              G+K Y++ +                            + LL      + G++F   D
Sbjct: 216 VEYGIKSYTIGLGTNGNALSPIAYNADGSYRYGMRQVEIDEKLLEGIAETTGGKYFRATD 275

Query: 373 SRELLESFDKITD 385
           + +L   +D+I  
Sbjct: 276 NEKLEAIYDEINK 288


>gi|296228118|ref|XP_002759733.1| PREDICTED: collagen alpha-6(VI) chain [Callithrix jacchus]
          Length = 2267

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 40/335 (11%), Positives = 99/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
           +      IKK  K+    R  +       QI +          + ++          +F 
Sbjct: 304 NAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRASEDNVTKAAVNLRREGVAIFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYL----QKHNDNNNMTS 176
            G+  +  + L   ++   E+    L     +       ++ L           +    +
Sbjct: 364 LGIEGARDSQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTET 423

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A  +     V
Sbjct: 424 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKSFLSEVVGMFNIAPHK-----V 472

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y             +N  ++   +  +      TNT  A++     L   K+  
Sbjct: 473 RVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKQQR 532

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ V      + 
Sbjct: 533 GNK-----VPCHLVVLTNGM--------SKDSILEPANRLREEHIRVYAIGV--KEANKT 577

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 578 QLREIAGEEKRVYYVHDFDALKDIRNQVVQEICAE 612



 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 60/164 (36%), Gaps = 15/164 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN-PYENTNTYPAMHHAYR 286
              +     VRIG   ++                E+  ++  +     NT+   A+    R
Sbjct: 1028 DFDVSLNRVRIGAAQFSHNYRQEFPLGTFIGEKEISFQIENIQQLGGNTHIGDAL----R 1083

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            ++ +       +  +T   + ++ +TDG++             Q  E +R+ G+ IYSV 
Sbjct: 1084 QVGHYFRPDMGSRINTGTPQVLLVLTDGQSQD--------EVAQAAEALRHRGIDIYSVG 1135

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1136 IG--DVDDQQLIQITGAAEKKLTVHNFDELKKVKKRIVRNICTT 1177



 Score = 69.9 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 58/162 (35%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYREL 288
           +     VR G + Y             +   EV S L    P    T T  A+  +    
Sbjct: 839 DVGKNRVRFGALKYADDPEVLFYLGDFDTKLEVISVLQNDQPMGGNTYTSEALGFSDHMF 898

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
                 +  +  +  + + +I ITDGE    S   + LN     + +R+ G+ + +V + 
Sbjct: 899 TE----AQGSRLNKGVPQVLIVITDGE----SHDADKLNAT--AKALRDKGILVLAVGI- 947

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           A     +LL     SS ++F V     L   F  +T  +   
Sbjct: 948 AGANPVELL-AMAGSSDKYFFVETFGGLKGIFSDVTASVCNS 988



 Score = 63.0 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 54/159 (33%), Gaps = 19/159 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + +++ + ++++      T T  A+    +     K
Sbjct: 656 NRVQIGVVQFSGVNKEEFQLNRFMSQSDISNAIDQMVHIGETTLTGSALSFVSQYFSPTK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         ++KF+I ITDGE              +    +R  G+ IYSV    +  
Sbjct: 716 GARP------NVRKFLILITDGEAQD--------VVKEPAVALRQEGIIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                L + +      F V +   L    D +   I   
Sbjct: 762 ---TQLEEISGRPEMVFYVENFDILQHIEDDLVFGICSP 797



 Score = 42.6 bits (98), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/162 (12%), Positives = 53/162 (32%), Gaps = 17/162 (10%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL--NKLNPYENTNTYPAMHHAYRELYNE 291
              R+    Y+  +            N + + L  N      +     A+  A+R  ++ 
Sbjct: 61  DKYRVALAQYSDKLHSEFHLSTFKGRNPMLNHLKKNFQFLGGSLQIGKALQEAHRTYFSA 120

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
             +  +          V+  +          ++  +  +  + ++  G+KI  ++V    
Sbjct: 121 PTNGRDRK--QFPPILVVLAS---------AESEDDVEEASKALQKDGVKI--ISVGVQD 167

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             ++ L+    S    F +   R+L   F +   +I +   +
Sbjct: 168 ASEENLKAMATSH-FHFNLRTVRDLST-FSQNMTQIIKDVTK 207


>gi|313203640|ref|YP_004042297.1| von willebrand factor type a [Paludibacter propionicigenes WB4]
 gi|312442956|gb|ADQ79312.1| von Willebrand factor type A [Paludibacter propionicigenes WB4]
          Length = 327

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 57/170 (33%), Gaps = 40/170 (23%)

Query: 249 GNQCTPLSNNLN---EVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLK 305
                PL+ +      + + +N     + T     + +A   +                 
Sbjct: 138 SFTQCPLTTDHAVLVNLFNGVNNGMIEDGTAIGLGLANAVNRI----------KDGKSKS 187

Query: 306 KFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA---------------- 349
           K +I +TDG N+        +  +   E  +  G++IY++ V                  
Sbjct: 188 KVIILLTDGSNNSG-----DIAPITAAEIAKTFGIRIYTIGVGTHGVINIPVSTPMGIQY 242

Query: 350 ----PPEGQDLLRKCTD-SSGQFFAVNDSRELLESFDKITDKIQEQSVRI 394
                      L    + + G++F   D+ +L   + +I DK+++  ++I
Sbjct: 243 QRVQSEFDAKSLENIANLTGGKYFGATDNSKLRNIYQEI-DKLEKTRIKI 291


>gi|255693880|ref|ZP_05417555.1| BatA protein [Bacteroides finegoldii DSM 17565]
 gi|260620309|gb|EEX43180.1| BatA protein [Bacteroides finegoldii DSM 17565]
          Length = 327

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   +   ++ +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGESFTQCPLTVDHAVLLDMIHNIKCGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           +   E  
Sbjct: 168 AVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNNKGDIS-----PMTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVSMPVEIDEKTLTQIAGTTDGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|226314068|ref|YP_002773964.1| hypothetical protein BBR47_44830 [Brevibacillus brevis NBRC 100599]
 gi|226097018|dbj|BAH45460.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 677

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 72/205 (35%), Gaps = 16/205 (7%)

Query: 199 YAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPL--- 255
           +    + +  K D    +       +   I   +    RIG +AYN  IV  Q       
Sbjct: 49  FVVDTSNSMNKTDPGKTA----AEVMSMFIDMSEATRTRIGFVAYNDRIVQAQSPASMAE 104

Query: 256 SNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGE 315
           + N  ++K  +  L     ++    +      +   K+ +                TD  
Sbjct: 105 ARNREQLKRTIQGLRYSGYSDLGLGLRRGAEMIEKAKDPARKPFLILLSDG----GTDLR 160

Query: 316 NSGA--SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE-GQDLLRKCTD-SSGQFFAVN 371
            +    S   +  +   +    +  G  IY++ ++      ++ L+K  + + G  F   
Sbjct: 161 QNAGGRSVAASNKDVETVISKAKAQGYPIYTIGLNNDGSVQKEQLKKIAEATGGTSFVTQ 220

Query: 372 DSRELLESFDKITDK-IQEQSVRIA 395
            + +L E F++I  K IQ Q V +A
Sbjct: 221 STDDLPEIFNQIFAKHIQSQLVSVA 245


>gi|73990557|ref|XP_853279.1| PREDICTED: similar to alpha 3 type VI collagen isoform 1 precursor
           [Canis familiaris]
          Length = 1634

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 41/335 (12%), Positives = 99/335 (29%), Gaps = 31/335 (9%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  I+K  K+    R  +       QI +          + ++          +F 
Sbjct: 303 KAYTGAAIRKIRKEVFSARNGSRKNQGVPQIAVLVTHRPSEDNVTKAAVNLRREGVTIFT 362

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHND----NNNMTS 176
            G+  ++ + L   ++   E+    L     +       ++ L  Q        +    +
Sbjct: 363 MGIEGASDSQLEKIASHPAEQHVSKLKTFSELAAHNQTFLKKLRNQITLTVSVFSERTET 422

Query: 177 NKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSV 236
            K       +   +                      +      +V     A        V
Sbjct: 423 LKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAP-----QKV 471

Query: 237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNEKESS 295
           R+G + Y              N +++   +  +      TNT  A++     L   K+  
Sbjct: 472 RVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKAKKQR 531

Query: 296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD 355
            N      +   ++ +T+G         +  + L+    +R   +++Y++ V      Q 
Sbjct: 532 GNR-----VPCHLVVLTNGM--------SKDSILEPANRLREELIRVYAIGV--KEANQT 576

Query: 356 LLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            LR+      + + V+D   L +  +++  +I  +
Sbjct: 577 QLREIAGEDKRVYYVHDFDALKDIRNQVVQEICAE 611



 Score = 74.6 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 58/164 (35%), Gaps = 15/164 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYR 286
              +     VRIG   ++                E+  ++  +      T+   A+    R
Sbjct: 1027 DFDVSVNRVRIGAAQFSHTYRPEFPLGTFIGKKEISFQIENIQQIFGYTHIGAAL----R 1082

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            E+ +       +  +    + ++ +TDG++             Q  E +R+ G+ IYSV 
Sbjct: 1083 EVGDYFRPDMGSRINAGTPQVLLVLTDGQSQD--------EVAQAAEELRHKGIDIYSVG 1134

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +         L + T ++ +   V++  EL +   +I   I   
Sbjct: 1135 IG--DVDDQQLIQITGTADKKLTVHNFDELTKVKKRIVRNICTS 1176



 Score = 68.0 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 65/174 (37%), Gaps = 15/174 (8%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TN 276
             +V+ ++KA  +     VR G + Y             +   EV S L K  P    T 
Sbjct: 828 DFMVDLVKKA--DVGKNQVRFGALKYADDPEVLFYLDDLSTKWEVISVLQKDQPMGGNTY 885

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
           T  A+  +          +  +     + + +I ITDGE+  A    +T       + +R
Sbjct: 886 TAEALGFSDHMFTE----ARGSRLHKGVPQVLIVITDGESHDADKLNDT------AKALR 935

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + G+ + +V + A     +LL     SS ++F V     L   F  ++  +   
Sbjct: 936 DKGILVLAVGI-AGANPVELL-AMAGSSDKYFFVETFGGLKGIFSDVSASVCNS 987



 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 53/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + NE+ + ++++      T T  A+    +     K
Sbjct: 655 DRVQIGVVQFSDINKEEFQLNRYMSQNEISNAIDRMAHIGETTLTGSALTFVSQYFSPAK 714

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         +++F+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 715 GARP------NVRRFLILITDGEAQD--------IVKDPAVALRQEGIIIYSVGVFGSNV 760

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 761 ---TQLEEISGRPEMVFYVENFDILQHIEDDLVFGICSPR 797


>gi|54025448|ref|YP_119690.1| hypothetical protein nfa34780 [Nocardia farcinica IFM 10152]
 gi|81374389|sp|Q5YU15|Y3478_NOCFA RecName: Full=UPF0353 protein NFA_34780
 gi|54016956|dbj|BAD58326.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 335

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 64/198 (32%), Gaps = 27/198 (13%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTY 278
            +     K   +     + +G + +       Q    + N   VK+ ++ +   E T T 
Sbjct: 112 EVAQQAGKEFVDGLTQGINLGFVTFAGTASVMQSP--TTNREAVKAAIDNIKLAERTATG 169

Query: 279 PAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENS--GASAYQNTLNTLQICEYMR 336
             +  A + +             T     ++ ++DG+ +        N  +        +
Sbjct: 170 EGILTALQSIETLATVLGGA--ETPPPARIVLMSDGKQTVPDDKDVDNPRHAFTAARLAK 227

Query: 337 NAGMKIYSVAVSAPPE--------------------GQDLLRKCTD-SSGQFFAVNDSRE 375
           + G+ + +++                            + LR+    S G+F+  +   E
Sbjct: 228 SKGIPVSTISFGTEWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLSGGEFYTASSLEE 287

Query: 376 LLESFDKITDKIQEQSVR 393
           L   +D + ++I  ++ R
Sbjct: 288 LTAVYDTLEEQIGYETTR 305


>gi|153806291|ref|ZP_01958959.1| hypothetical protein BACCAC_00547 [Bacteroides caccae ATCC 43185]
 gi|149130968|gb|EDM22174.1| hypothetical protein BACCAC_00547 [Bacteroides caccae ATCC 43185]
          Length = 327

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   +   ++ +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           L   E  
Sbjct: 168 AVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNNKGDIS-----PLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|260061451|ref|YP_003194531.1| aerotolerance operon BatA [Robiginitalea biformata HTCC2501]
 gi|88785583|gb|EAR16752.1| BatA (Bacteroides aerotolerance operon) [Robiginitalea biformata
           HTCC2501]
          Length = 333

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 61/177 (34%), Gaps = 43/177 (24%)

Query: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRELYNE 291
           + RIG +AY         TP++++ + V   L ++      + T     +  +   L   
Sbjct: 130 NDRIGLVAYAGESYTK--TPITSDKSIVLGALREITYGQLNDGTAIGMGLATSVNRL--- 184

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
                    ST + K +I +TDG N+        +      +     G+K Y++ +    
Sbjct: 185 -------KESTAISKVIILLTDGVNNAG-----FIEPQTAADLALEYGIKTYTIGLGTNG 232

Query: 352 E----------------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKITD 385
                                   ++LL      + G++F   D+ +L   +++I  
Sbjct: 233 NALSPIGYNPDGSFRYGMRQVEIDEELLTDIATATGGEYFRATDNEKLEAIYEEINK 289


>gi|298207017|ref|YP_003715196.1| aerotolerance-related membrane protein [Croceibacter atlanticus
           HTCC2559]
 gi|83849651|gb|EAP87519.1| aerotolerance-related membrane protein [Croceibacter atlanticus
           HTCC2559]
          Length = 334

 Score = 83.0 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 71/205 (34%), Gaps = 53/205 (25%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            +++ L + A   +             + R+G + Y         TP++++ + V   LN
Sbjct: 112 NRLEALKDVASEFIQ---------GRPNDRVGIVLYAGESYTK--TPITSDKSIVLGALN 160

Query: 268 KLNPY----ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
            +         T     +  +   L            S  L K +I +TDG N+      
Sbjct: 161 DVKFSEVLENGTAIGMGLATSVNRL----------KDSKALSKVIILLTDGVNNSG---- 206

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPP----------------------EGQDLLRKCT 361
            T++     E     G+K Y++ + +                          +DLL++  
Sbjct: 207 -TIDPKLASELAVEYGIKTYTIGIGSNGMALSPIGIKSNGQFQYGNQKVEIDEDLLKQIA 265

Query: 362 D-SSGQFFAVNDSRELLESFDKITD 385
             + GQ+F   ++++L   +++I  
Sbjct: 266 TVTGGQYFRATNNQKLEAIYEEINK 290


>gi|297671961|ref|XP_002814089.1| PREDICTED: collagen alpha-5(VI) chain-like [Pongo abelii]
          Length = 2586

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRNRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             +    H +     +K+ +I ITDG++       +T         +R+ G+ I++V V 
Sbjct: 905 TEK----HGSRIKQNVKQVLIVITDGKSHDHDQLNDT------ASELRDKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 955 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 994



 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 529 LQIIKNGTKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICTE 619



 Score = 59.2 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 52/165 (31%), Gaps = 17/165 (10%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQVGADKTQIGVVQFSDKTKEEFQLSRYFTQQEISDAIDRMSLINEGTLTGKALNFVS 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            V      +  L + +      F V +   L     K+  ++   
Sbjct: 762 GV--YNANRSQLEEISGDGSLVFHVENFDHLKALERKLVFRVCAL 804


>gi|149187170|ref|ZP_01865468.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
 gi|148838706|gb|EDL55645.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
          Length = 324

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 72/213 (33%), Gaps = 47/213 (22%)

Query: 192 KNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQ 251
             +   +          ++  +     + V+  +           R+G + +        
Sbjct: 94  SYSMSQQDMAYQDDYIDRLTAVKHVVSDFVDRRK---------GDRVGLVYFADHAYLQ- 143

Query: 252 CTPLSNNLNEVKSRLNK--LNPYEN-TNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
            TPL+ +   VK++LN+  L      T     +  A +   +              ++ +
Sbjct: 144 -TPLTFDRETVKTQLNQTVLKLIGTQTAIGDGIGLATKTFVDSN----------APQRVM 192

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP----------------- 351
           I ++DG N+        L+ +Q  E  +  G  IY++ V A                   
Sbjct: 193 ILLSDGSNNAGV-----LDPVQAAEIAKKYGTTIYTIGVGAGEMQVKDFFMTRTVNTAED 247

Query: 352 -EGQDLLRKCTDSSGQFFAVNDSRELLESFDKI 383
            + + L++    + GQ+F   ++ EL   +D I
Sbjct: 248 LDEKTLIKIANITGGQYFRARNADELATIYDTI 280


>gi|315223608|ref|ZP_07865462.1| aerotolerance protein BatA [Capnocytophaga ochracea F0287]
 gi|314946389|gb|EFS98384.1| aerotolerance protein BatA [Capnocytophaga ochracea F0287]
          Length = 340

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 66/181 (36%), Gaps = 43/181 (23%)

Query: 231 KKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYRE 287
           K   + RIG + Y         TP++ +   + + L++L      + T     +  A   
Sbjct: 133 KDRPNDRIGLVIYAGESYTK--TPVTTDKGIILNALSELTYGQIEDGTAIGMGLATAVNR 190

Query: 288 LYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAV 347
           L            S    + +I +TDG N+        ++     E     G+++Y++ +
Sbjct: 191 L----------KESKAKSRVIILLTDGVNNTG-----FIDPQTAAELAAEYGIRVYTIGI 235

Query: 348 SAPPE----------------------GQDLLRKCTD-SSGQFFAVNDSRELLESFDKIT 384
            +                          + L++K  + + G++F   D+++L + +++I 
Sbjct: 236 GSNGTALSPYALNPDGSIMYRMLQVEIDEPLMKKIAEVTHGRYFRATDNQKLQQIYNEIN 295

Query: 385 D 385
            
Sbjct: 296 K 296


>gi|256426121|ref|YP_003126774.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
 gi|256041029|gb|ACU64573.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
          Length = 462

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 68/189 (35%), Gaps = 19/189 (10%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
            KI    ++A  L++ +             +  + Y+  +     +    N   +K+ ++
Sbjct: 96  DKIKYARQAAKFLIDQLNSTD--------HLSIVNYDDRVEVTSPSQSVKNKEALKAAID 147

Query: 268 KLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLN 327
           K++   +TN    M   Y ++ + ++  +           V+ +TDG  +        L 
Sbjct: 148 KIHDRGSTNLSGGMLEGYTQVKSTRKEGYVNR--------VLLLTDGLANQGITDPLELK 199

Query: 328 TLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDK 386
            L      +  G+ + +  V A    +DLL    ++    ++ ++   ++ + F      
Sbjct: 200 RLAE-NKYKEDGIALSTFGVGAD-YNEDLLTMLAENGRANYYFIDSPDKIPQIFAGELKG 257

Query: 387 IQEQSVRIA 395
           +     + A
Sbjct: 258 LLSVVAQNA 266


>gi|327399949|ref|YP_004340788.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
 gi|327315457|gb|AEA46073.1| von Willebrand factor type A [Archaeoglobus veneficus SNP6]
          Length = 527

 Score = 82.6 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 78/214 (36%), Gaps = 29/214 (13%)

Query: 182 PPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTI 241
                 +    +   +  +      N    +   +A + V+ +     +   +S      
Sbjct: 61  TGSEWTTSVPIDVVFALDSSGSMGWNDPSGLRKTAAKSFVDKLNSTTDQAGVVS------ 114

Query: 242 AYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
                   +    L+NN + VKS+++ ++    T+    ++ A   L   K+++ +    
Sbjct: 115 ---WDNNIDFTQTLTNNFSLVKSKIDAVDSSGGTDLNVGLNAAISLLDTGKQANSSW--- 168

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA--VSAPPEGQDLLRK 359
                 +IF+++G+ + + +               N G  +Y++   +S     +  L+ 
Sbjct: 169 -----VIIFLSNGQGTYSHST---------AVVAANKGYTVYTIGLAISPGSTAESNLKD 214

Query: 360 CT-DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               + G++++  ++  L   F+ I  ++   ++
Sbjct: 215 IANTTGGKYYSSPNATNLDAVFNDIYKEVVTSTI 248


>gi|254459074|ref|ZP_05072497.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
 gi|207084345|gb|EDZ61634.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
          Length = 279

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 65/154 (42%), Gaps = 21/154 (13%)

Query: 245 IGIVGNQCTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGS 301
            G      +P++     V   L  L      +NT    A+    R              S
Sbjct: 110 YGDFAFIASPITYEKEIVTQMLGYLTQGMAGQNTAIGEAIAMGVRSF----------KHS 159

Query: 302 TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSA-PPEGQDLLRKC 360
               K ++ ++DGE++  S         +  E  +  G+KIY++A+       + LL   
Sbjct: 160 KAKTKVIVLLSDGEHNSGSVS-----PKEATELAKEQGIKIYTIAMGNKGEADEALLETI 214

Query: 361 T-DSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
             DS+G+FF+ + ++EL   +D+I DK++  +++
Sbjct: 215 AKDSNGEFFSASSAKELKNIYDEI-DKLESSNIK 247


>gi|78776855|ref|YP_393170.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497395|gb|ABB43935.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 309

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 71/180 (39%), Gaps = 19/180 (10%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN---PYENT 275
           +  + +++ + +  +            G      +PL+ ++N +   L++L      + T
Sbjct: 109 SRFDVVKEIVSDFISQRKNDNMGLVVFGAYSFIASPLTYDVNILNKILSQLQIGMAGKYT 168

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
               ++      L            S    K  I +TDG ++      +T+      + +
Sbjct: 169 ALNTSLAQGANLL----------KQSKSKTKIAILLTDGYSTPQV---DTITLDIALDMI 215

Query: 336 RNAGMKIYSVAVSAPP--EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           +  G+K+Y + +  P     + LL+   +S G  F  + + EL E + KI D +++  ++
Sbjct: 216 KKEGIKVYPIGIGMPHEYNTEALLKIANESGGVAFGASSAAELQEVYKKI-DSLEKSKIK 274


>gi|296228122|ref|XP_002759734.1| PREDICTED: collagen alpha-4(VI) chain-like [Callithrix jacchus]
          Length = 2348

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
           +  +  +  VR+G   YN  I            + V  ++  L      TNT  A+    
Sbjct: 263 SGLDVSSDRVRVGLAQYNDDIYPAFQLNQHPLKSMVLEQIQNLPYRTGGTNTGNALEFIR 322

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
                E   S       R+ + VI +TDGE++            +  + ++  G+ +Y V
Sbjct: 323 TSYLTEGSGSRAK---DRVPQIVILVTDGESND--------EVQEAADQLKEDGIVVYVV 371

Query: 346 AVSAPPEGQDLLRKCTDSS-GQF-FAVNDSRELLESFDKITDKIQEQS 391
            +    +    L+K       +F F + +   L +    I   +    
Sbjct: 372 GI--NVQDVQELQKIASEPFEKFLFNIENFNILQDFSGSILQTLCSAV 417



 Score = 56.1 bits (133), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 59/158 (37%), Gaps = 21/158 (13%)

Query: 234  LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLN-PYENTNTYPAMHHAYRELYNEK 292
              V+ G I Y+  I           + E+K  ++ +      T T  A+++  +   +  
Sbjct: 878  DRVQFGVIQYSDEIKSKFVLSQYPTVAELKVAIDNIQQGGGGTTTGEALNNMTQVFADTA 937

Query: 293  ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352
                       + +++I ITDG++S   A           E +R +G+ IY++ V     
Sbjct: 938  R--------INVARYLIVITDGKSSDPVAD--------AAEGLRASGVIIYAIGV--REA 979

Query: 353  GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
              D L++      + F V +   L +   ++   I   
Sbjct: 980  NIDELKEIAK--DKIFFVYEFDLLKDIQKEVVRDICSS 1015



 Score = 54.5 bits (129), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 59/162 (36%), Gaps = 17/162 (10%)

Query: 230  EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYREL 288
                 S++IG + ++            ++  ++ + +  +    + T T  A++      
Sbjct: 1055 NIGTDSIQIGLLQFSSIPKEEFRLNRYSSKVDIYNAIFAVQQMRDGTRTGKALNFTLPFF 1114

Query: 289  YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             + K           +++++I ITDG            N +   + +R+  + I+++ V 
Sbjct: 1115 ESSKGGRP------SVQQYLIVITDGVAQD--------NVILPAKALRDKNIIIFAIGVG 1160

Query: 349  APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
               +   LL   T+   + +   D   L     +I  K+ + 
Sbjct: 1161 -EAKKSQLLE-ITNDEDRVYYDVDFEVLQNLEKEILSKVCDP 1200



 Score = 51.8 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 96/310 (30%), Gaps = 31/310 (10%)

Query: 89  AQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAI 148
            Q  +          + ++  +       +   G+       L    +  +    +    
Sbjct: 535 PQYAVVITSGKSKDEVQDAAQRLREKGVKVMSVGVQDFDRRELEWMGSPDLVYDIQREDR 594

Query: 149 SICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANR 208
              +V D++  ++    ++H +  N  +        P    +       +++    P  +
Sbjct: 595 VRHVVEDMNVVIQGTGQREHRNTANKEAVGACATAIPADLVFLT----EEFSRVRQPNFQ 650

Query: 209 K-IDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
           + I  L      L           +  +VR G + Y+             N  E+   L+
Sbjct: 651 QVISFLKTIVSLL---------SIRPDAVRFGLVFYSEEPRLEFSLDTFQNPAEILEHLD 701

Query: 268 KLNPY---ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN 324
           KL        T T  A+     E++        +  S  +++  + IT+  +  + +   
Sbjct: 702 KLTYRERRGRTKTGAALDFLRNEVF---IQEKGSRSSHGVQQIAVVITENFSQDSVSGP- 757

Query: 325 TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDK 382
                     +R AG+ IY+V      E +D L K            +    +L     K
Sbjct: 758 -------ASRLRRAGVTIYAVGTQDVSESKD-LEKMASYPPWKHSVPLESFLQLSIIGSK 809

Query: 383 ITDKIQEQSV 392
           +T+++  + V
Sbjct: 810 LTNQLCPEIV 819



 Score = 50.3 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 54/171 (31%), Gaps = 16/171 (9%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYREL 288
              + ++R+G   Y+            +  N+V   + +            A+      L
Sbjct: 63  NVSSKTIRVGLAQYSDVPHSEFLLSTYHRKNDVLRHIRQFQFKPGGKKMGLALQFI---L 119

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
            +  + +  +  S  + +  + ++ G                  E +R AG+ +Y+V V 
Sbjct: 120 DHHFQEAAGSRASQGVPQIAVVMSSGPAEDHVHGP--------GEALRRAGILVYAVGV- 170

Query: 349 APPEGQDLLRKCTDSSGQFF--AVNDSRELLESFDKITDKIQEQSVRIAPN 397
                   LR+   S  + F   V     L     K+  ++ +   + A  
Sbjct: 171 -KDAVWAELREIASSPQENFTSFVPSLSGLSSLAQKLRQELCDTLAKAASR 220


>gi|152990152|ref|YP_001355874.1| von Willebrand factor A [Nitratiruptor sp. SB155-2]
 gi|151422013|dbj|BAF69517.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 305

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 53/139 (38%), Gaps = 20/139 (14%)

Query: 252 CTPLSNNLNEVKSRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFV 308
            +PL+ N   VK  L+ L+       T    A+  + R L            S    K V
Sbjct: 141 ASPLTFNKEAVKKILDYLDIGVAGSKTAIDDALIESVRLL----------KESQAKSKIV 190

Query: 309 IFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP-PEGQDLLRKCTDSS-GQ 366
           I +TDG ++ +    +        +  +  G+KIY++ +       +  LR       G 
Sbjct: 191 ILLTDGIDTASKTPPDV-----AVKMAKKYGVKIYTIGIGDKRGIDEAFLRWLAQQGHGY 245

Query: 367 FFAVNDSRELLESFDKITD 385
           +F   D+  L + +D+I  
Sbjct: 246 YFYAKDASMLRKIYDEINR 264


>gi|262164956|ref|ZP_06032694.1| protein TadG associated with Flp pilus assembly [Vibrio mimicus
           VM223]
 gi|262027336|gb|EEY46003.1| protein TadG associated with Flp pilus assembly [Vibrio mimicus
           VM223]
          Length = 403

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/430 (8%), Positives = 116/430 (26%), Gaps = 68/430 (15%)

Query: 4   IIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTI 63
           ++     + + + + L+       ++  A + A L+          I  P    +   + 
Sbjct: 1   MMFPAMMMILAFTMQLSQQFLAHARLSEASEVASLAL---------IASPKEDDENNVSY 51

Query: 64  FKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGL 123
            +K + +++       +      +    +     +       +         ++      
Sbjct: 52  ARKVVDRYVVDNIDDIKVTVKNKRCEYKDGCVQSSGEAAPFTDFTVAATAKHKSWISYE- 110

Query: 124 IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPP 183
              +L      +   + R      + +  ++D+S SM   +    +  + +      +  
Sbjct: 111 -NISLKPEFTVNGSSVTRKFLPQPVDVYFIVDMSASMRATWQNGKSQIDEVKEVITRVVN 169

Query: 184 PPKK---SFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
             K       S+ +  + +       +R ++    +            Q   N+ +    
Sbjct: 170 DLKGFDTEVKSRVSLLAYHNYNIKQGSRTLEAYDYAL------YNTPQQTVSNMFLPPKR 223

Query: 241 IAYNIGI-VGNQCTPLSNNLNEVKSRLNKLNP----YENTNTYPAMHHAYRELYNEKESS 295
           +  +      ++   L+ N +     +N  N        T ++  +             +
Sbjct: 224 VTPSDSALFSHRDIDLTQNYSSFLQIMNDRNFYPPKSACTESWQGII--------AAAQA 275

Query: 296 HNTIGSTRLKKFVIFITDGENSGA------------SAYQNTLNTLQICEYMRNA----- 338
            +       ++  I ++DG +                 Y   L    +C+ ++       
Sbjct: 276 ADKATDINPEQVFIILSDGADCSWQRQDRWGRWLTTKNYLKKLVDSGLCKNLKQRIRQKP 335

Query: 339 --------------GMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
                          + +  + V+      D    C       +         + +  I 
Sbjct: 336 NRFQSSTPTENEKTKVTMGVIGVNYQVNPNDGFGDCV-GRENIYHATQGE---DVYKYIL 391

Query: 385 DKIQEQSVRI 394
           + I E++ R+
Sbjct: 392 NLINEETGRL 401


>gi|109071570|ref|XP_001110086.1| PREDICTED: collagen alpha-1(XXI) chain-like isoform 2 [Macaca
           mulatta]
          Length = 959

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 65/176 (36%), Gaps = 22/176 (12%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNK-LNPYENTNTYPAMHHA 284
               +     +++G + Y+   V        ++   + + +   L    NT T  A+  A
Sbjct: 64  TKNFDIGPKFIQVGVVQYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTRTGKAIQFA 123

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
              L+           S  L K  + +TDG++          +     E  R++ + +++
Sbjct: 124 LDYLF--------AKSSRFLTKIAVVLTDGKSQD--------DVKDAAEAARDSKITLFA 167

Query: 345 VAVSAPPEGQDLLRKCTDSSG--QFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
           + V +  E  + LR   +       F V D   + +  + I  K+ E+SV   P R
Sbjct: 168 IGVGSETEDAE-LRAIANKPSSTYVFYVEDYIAISKIREVIKQKLCEESV--CPTR 220


>gi|212720733|ref|NP_001132911.1| collagen, type XXII, alpha 1 [Gallus gallus]
          Length = 1599

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 70/200 (35%), Gaps = 22/200 (11%)

Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLN 260
            + +      + + +   NLV + +           R+G + Y+                
Sbjct: 45  ASSSVGKEDFEKVRQWVSNLVETFE-----IGPDKTRVGVVRYSDRPTTEFDLGKYKTCE 99

Query: 261 EVKSRLNKLNP-YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGA 319
           E+K    K+     NTNT  A+ +     ++  + +   +    +KK  I +TDG +   
Sbjct: 100 EIKEAARKIRYYGGNTNTGDALRYINTYSFS--KEAGGRLSDRTVKKVAILLTDGRSQDY 157

Query: 320 SAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS--GQFFAVNDSRELL 377
                           R AG++I++V V      ++ L +          F V+D   + 
Sbjct: 158 VLDP--------ANAARQAGIRIFAVGVG--EALKEELDEIASEPKSAHVFHVSDYNAID 207

Query: 378 ESFDKITDKIQEQSVRIAPN 397
           +   K+  ++ E    + PN
Sbjct: 208 KIRGKLRRRLCENV--LCPN 225


>gi|212693197|ref|ZP_03301325.1| hypothetical protein BACDOR_02707 [Bacteroides dorei DSM 17855]
 gi|237709939|ref|ZP_04540420.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237725394|ref|ZP_04555875.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265753591|ref|ZP_06088946.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212664302|gb|EEB24874.1| hypothetical protein BACDOR_02707 [Bacteroides dorei DSM 17855]
 gi|229436081|gb|EEO46158.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229456032|gb|EEO61753.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263235305|gb|EEZ20829.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 332

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/252 (12%), Positives = 68/252 (26%), Gaps = 56/252 (22%)

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
               +         +          S    A      +++   + A   +          
Sbjct: 72  ARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLKPNRLEAAKQVASEFI---------- 121

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY--------ENTNTYPAMHH 283
            N                    PL+ +   + +  N +           + T     + +
Sbjct: 122 -NGRPNDNIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRGLIEDGTAIGMGIAN 180

Query: 284 AYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIY 343
           A   L            S    K +I +TDG N+           L   E  +  G++IY
Sbjct: 181 AVTRL----------KDSKAKSKVIILLTDGSNNRGDIS-----PLTAAEIAKQFGIRIY 225

Query: 344 SVAVSAPPE--------------------GQDLLRKCT-DSSGQFFAVNDSRELLESFDK 382
           ++ V                          +  L +    ++G +F    + +L E + +
Sbjct: 226 TIGVGTNGTAPYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRATSNSKLKEVYQE 285

Query: 383 ITDKIQEQSVRI 394
           I DK+++  + +
Sbjct: 286 I-DKLEKTKLNV 296


>gi|332817900|ref|XP_526306.3| PREDICTED: collagen alpha-5(VI) chain isoform 2 [Pan troglodytes]
          Length = 2526

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-NKLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDGE+       +T         +RN G+ I++V V 
Sbjct: 905 TEE----HGSRIKQNVKQMLIVITDGESHDHDQLNDT------ALELRNKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 955 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 994



 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYVTDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 529 LQIIKNGMKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKTELQEIAGKEERVSFGQNFDALKSIKNEVIREICAE 619



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            V      +  L + +  S   F V +   L  
Sbjct: 762 GV--YNANRSQLEEISGDSSLVFHVENFDHLKA 792



 Score = 46.8 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S    + K+++
Sbjct: 1018 NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQI 1072

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P +  A +++ N          +  + + ++ IT G+           
Sbjct: 1073 QNVSKSGG---FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDP--------RY 1121

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            +     + +++ G+ +  + +      + LL   T +S +     D  +L   +   +I 
Sbjct: 1122 DVADAVKTLKDLGICVLVLGIG-NVYKEQLL-PITGNSEKIITFQDFDKLKNVDVKKRII 1179

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1180 REICQS 1185


>gi|332817898|ref|XP_003310056.1| PREDICTED: collagen alpha-5(VI) chain isoform 1 [Pan troglodytes]
          Length = 2615

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-NKLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDGE+       +T         +RN G+ I++V V 
Sbjct: 905 TEE----HGSRIKQNVKQMLIVITDGESHDHDQLNDT------ALELRNKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 955 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 994



 Score = 71.5 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYVTDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 529 LQIIKNGMKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKTELQEIAGKEERVSFGQNFDALKSIKNEVIREICAE 619



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            V      +  L + +  S   F V +   L  
Sbjct: 762 GV--YNANRSQLEEISGDSSLVFHVENFDHLKA 792



 Score = 46.8 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S    + K+++
Sbjct: 1018 NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQI 1072

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P +  A +++ N          +  + + ++ IT G+           
Sbjct: 1073 QNVSKSGG---FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDP--------RY 1121

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            +     + +++ G+ +  + +      + LL   T +S +     D  +L   +   +I 
Sbjct: 1122 DVADAVKTLKDLGICVLVLGIG-NVYKEQLL-PITGNSEKIITFQDFDKLKNVDVKKRII 1179

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1180 REICQS 1185


>gi|325286051|ref|YP_004261841.1| von Willebrand factor type A [Cellulophaga lytica DSM 7489]
 gi|324321505|gb|ADY28970.1| von Willebrand factor type A [Cellulophaga lytica DSM 7489]
          Length = 332

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 59/193 (30%), Gaps = 41/193 (21%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           + + +++K   +                      TP++++ + V S L ++      + T
Sbjct: 111 DRLTALKKVAADFIKKRPNDRIGLVAYAAESYTKTPITSDKSIVLSSLRQITHGQLEDGT 170

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                +  A   L            S    K +I +TDG N+        +      +  
Sbjct: 171 AIGMGLATAVNRL----------KDSKSKSKVIILLTDGVNNSG-----FIEPKTAADLA 215

Query: 336 RNAGMKIYSVAVSAPPE----------------------GQDLLRKCTD-SSGQFFAVND 372
               +K Y++ +                            + LL +    + GQ+F   D
Sbjct: 216 VEYKIKTYTIGLGTNGNALTPIAFNPDRTYRYGMRQVEIDEKLLEEIATVTGGQYFRATD 275

Query: 373 SRELLESFDKITD 385
           + +L   +++I  
Sbjct: 276 NEKLSAIYNEINK 288


>gi|183583553|ref|NP_694996.5| collagen alpha-5(VI) chain [Homo sapiens]
          Length = 2526

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-NKLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDGE+       +T         +RN G+ I++V V 
Sbjct: 905 TEE----HGSRIKQNVKQMLIVITDGESHDHDQLNDT------ALELRNKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 955 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 994



 Score = 71.1 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 529 LQIIKNGMKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICAE 619



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            V      +  L + +  S   F V +   L  
Sbjct: 762 GV--YNANRSQLEEISGDSSLVFHVENFDHLKA 792



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S    + K+++
Sbjct: 1018 NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQI 1072

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P +  A +++ N          +  + + ++ IT G+           
Sbjct: 1073 QNVSKSGG---FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDP--------RY 1121

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            +     + +++ G+ +  + +      + LL   T +S +     D  +L   +   +I 
Sbjct: 1122 DVADAVKTLKDLGICVLVLGIG-DVYKEHLL-PITGNSEKIITFQDFDKLKNVDVKKRII 1179

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1180 REICQS 1185


>gi|189082691|sp|A8TX70|CO6A5_HUMAN RecName: Full=Collagen alpha-5(VI) chain; AltName: Full=Collagen
           alpha-1(XXIX) chain; AltName: Full=von Willebrand factor
           A domain-containing protein 4; Flags: Precursor
 gi|158828630|gb|ABW81241.1| collagen XXIX alpha 1 [Homo sapiens]
          Length = 2615

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-NKLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 845 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALF 904

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDGE+       +T         +RN G+ I++V V 
Sbjct: 905 TEE----HGSRIKQNVKQMLIVITDGESHDHDQLNDT------ALELRNKGITIFAVGVG 954

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 955 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 994



 Score = 71.1 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 469 TEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 528

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 529 LQIIKNGMKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 575

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 576 VGIG--AANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICAE 619



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 656 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 715

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 716 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 761

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            V      +  L + +  S   F V +   L  
Sbjct: 762 GV--YNANRSQLEEISGDSSLVFHVENFDHLKA 792



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S    + K+++
Sbjct: 1018 NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQI 1072

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P +  A +++ N          +  + + ++ IT G+           
Sbjct: 1073 QNVSKSGG---FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDP--------RY 1121

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            +     + +++ G+ +  + +      + LL   T +S +     D  +L   +   +I 
Sbjct: 1122 DVADAVKTLKDLGICVLVLGIG-DVYKEHLL-PITGNSEKIITFQDFDKLKNVDVKKRII 1179

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1180 REICQS 1185


>gi|119599630|gb|EAW79224.1| hypothetical protein FLJ35880 [Homo sapiens]
          Length = 2531

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 230 EKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL-NKLNPYENTNTYPAMHHAYREL 288
           +     V+ G + Y+            +N + +   L  + +   NT T  A+ HA    
Sbjct: 790 DVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHANALF 849

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
             E    H +     +K+ +I ITDGE+       +T         +RN G+ I++V V 
Sbjct: 850 TEE----HGSRIKQNVKQMLIVITDGESHDHDQLNDT------ALELRNKGITIFAVGVG 899

Query: 349 APPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
                Q  L     +      V++  +L + F  + +++  +
Sbjct: 900 K--ANQKELEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTE 939



 Score = 71.1 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKL-NPYENTNTYPAMHHA 284
             +       VR+G + Y+            +N  +++  +  +      T T  A+ + 
Sbjct: 414 TEMFSIGPDKVRVGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYI 473

Query: 285 YRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYS 344
            + + N  +   +      +  ++I +TDG ++           ++  + +R   + +++
Sbjct: 474 LQIIKNGMKDRMSK-----VPCYLIVLTDGMSTD--------RVVEPAKRLRAEQITVHA 520

Query: 345 VAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           V +      +  L++      +     +   L    +++  +I  +
Sbjct: 521 VGIG--AANKIELQEIAGKEERVSFGQNFDALKSIKNEVVREICAE 564



 Score = 55.7 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP-YENTNTYPAMHHAY 285
              +      +IG + ++                E+   +++++   E T T  A++   
Sbjct: 601 TKIQIGADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVG 660

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +   + K +           KF+I ITDG                    +R   + I+SV
Sbjct: 661 QYFTHSKGARLGAK------KFLILITDGVAQDDVRDP--------ARILRGKDVTIFSV 706

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLE 378
            V      +  L + +  S   F V +   L  
Sbjct: 707 GV--YNANRSQLEEISGDSSLVFHVENFDHLKA 737



 Score = 46.1 bits (107), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 66/186 (35%), Gaps = 20/186 (10%)

Query: 207  NRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL 266
            N     +     +L+++      + ++  ++IG   +            S    + K+++
Sbjct: 963  NSDFVTMTTFLSDLIDNF-----DIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQI 1017

Query: 267  NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
              ++       +P +  A +++ N          +  + + ++ IT G+           
Sbjct: 1018 QNVSKSGG---FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDP--------RY 1066

Query: 327  NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELL--ESFDKIT 384
            +     + +++ G+ +  + +      + LL   T +S +     D  +L   +   +I 
Sbjct: 1067 DVADAVKTLKDLGICVLVLGIG-DVYKEHLL-PITGNSEKIITFQDFDKLKNVDVKKRII 1124

Query: 385  DKIQEQ 390
             +I + 
Sbjct: 1125 REICQS 1130


>gi|237716505|ref|ZP_04546986.1| aerotolerance protein BatA [Bacteroides sp. D1]
 gi|262408103|ref|ZP_06084651.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294645097|ref|ZP_06722823.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CC 2a]
 gi|294809498|ref|ZP_06768201.1| von Willebrand factor type A domain protein [Bacteroides
           xylanisolvens SD CC 1b]
 gi|298484179|ref|ZP_07002345.1| BatA protein [Bacteroides sp. D22]
 gi|229444152|gb|EEO49943.1| aerotolerance protein BatA [Bacteroides sp. D1]
 gi|262354911|gb|EEZ04003.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292639603|gb|EFF57895.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CC 2a]
 gi|294443316|gb|EFG12080.1| von Willebrand factor type A domain protein [Bacteroides
           xylanisolvens SD CC 1b]
 gi|295084189|emb|CBK65712.1| von Willebrand factor type A domain. [Bacteroides xylanisolvens
           XB1A]
 gi|298269683|gb|EFI11278.1| BatA protein [Bacteroides sp. D22]
          Length = 327

 Score = 82.6 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 63/205 (30%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   +   ++ +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLITDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           +   E  
Sbjct: 168 AVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNNKGDIS-----PMTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L      + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVSMPVEIDEKTLTEIAGTTDGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|323136144|ref|ZP_08071226.1| hypothetical protein Met49242DRAFT_0613 [Methylocystis sp. ATCC
           49242]
 gi|322398218|gb|EFY00738.1| hypothetical protein Met49242DRAFT_0613 [Methylocystis sp. ATCC
           49242]
          Length = 652

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/198 (16%), Positives = 59/198 (29%), Gaps = 46/198 (23%)

Query: 244 NIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKESS-HNTIG 300
                    T L+NNL+ V + ++ +N      T     +  A+R L  +K  +      
Sbjct: 454 PNASCPEPLTRLTNNLSTVTAAIDSMNYWLNGGTVISEGLMWAWRTLSPQKPYADGAAYT 513

Query: 301 STRLKKFVIFITDGEN-----------SGASAYQNTL----------------------- 326
             + KK ++ +TDG N           + +                              
Sbjct: 514 DKKTKKVIVLMTDGVNGLADNGNAASANISDYSAYGYMGASRLSVADGVTTYAGLQTFLD 573

Query: 327 -NTLQICEYMRNAGMKIYSVAVSAP--------PEGQDLLRKCTDSSGQFFAVNDSRELL 377
               + C+  +  G+ IY+V  +               LL  C       F   DS  L 
Sbjct: 574 DRLKKACDNAKAKGISIYTVMFNHNGFLSATEQARSATLLSYCASKPEYAFLATDSAALN 633

Query: 378 ESFDKITDKIQEQSVRIA 395
            +F +I        +R+ 
Sbjct: 634 SAFGQIASSAAASPLRLT 651



 Score = 46.8 bits (109), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 54/200 (27%), Gaps = 27/200 (13%)

Query: 2   TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTS 61
             + +         AID      +R+ +Q           A   +       +  +    
Sbjct: 4   FGLAMIPVTFMAGAAIDYGRATLLRSSLQK---------AADAGALAAGARTSLTQLARE 54

Query: 62  TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLK 121
            I K  +  +L              +   +++T  +  P   + + + Q  I T  + + 
Sbjct: 55  QIAKNAVLANLGA------------KARNLSLTITETEPSAGVFQVQIQASIATSIMKVA 102

Query: 122 GLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLL 181
                    + + S   +        I I + LD + SM D            T  + ++
Sbjct: 103 RF---DTIPVVVTSEARV-VGGSTNPIEIALALDNTGSMRDDM--PALKQAAKTLAQNVM 156

Query: 182 PPPPKKSFWSKNTTKSKYAP 201
                    S     +   P
Sbjct: 157 SGSGGNVKVSVVPYVAAVNP 176


>gi|301784735|ref|XP_002927783.1| PREDICTED: collagen alpha-6(VI) chain-like [Ailuropoda melanoleuca]
          Length = 2267

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/339 (12%), Positives = 99/339 (29%), Gaps = 39/339 (11%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  I+K  K+    R  +       QI +          + ++          +F 
Sbjct: 304 KAYTGAAIRKIRKEVFSARNGSRKNQGVPQIAVLVTHRPSEDNVTKAAVNLRREGVTIFT 363

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNN-------- 172
            G+  ++ + L   ++   E+    L        D++   +    +  N           
Sbjct: 364 MGIEGASDSQLEKIASHPAEQHVSKLKTFS----DLAAHNQTFLKKLRNQIMHTVSVFSE 419

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              + K       +   +                      +      +V     A     
Sbjct: 420 RTETLKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAP---- 469

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNE 291
              VR+G + Y              N +++   +  +      TNT  A++     L   
Sbjct: 470 -QKVRVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKA 528

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           K+   N      +   ++ +T+G         +  + L+    +R   +++Y++ V    
Sbjct: 529 KKQRGNR-----VPCHLVVLTNGM--------SKDSILEPANRLREELIRVYAIGV--KE 573

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
             Q  LR+      + + V+D   L +  +++  +I  +
Sbjct: 574 ANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICAE 612



 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 59/164 (35%), Gaps = 15/164 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYR 286
              +     VRIG   ++                E+  ++  +      T+   A+    R
Sbjct: 1028 DFDVSVNRVRIGAAQFSHTYRPEFPLGTFVGKKEISFQIENIQQIFGYTHIGAAL----R 1083

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            ++ +       +  +    + ++ +TDG++             +  E +R+ G+ IYSV 
Sbjct: 1084 QVGHYFRPDMGSRINAGTPQVLLVLTDGQSQD--------EVARAAEDLRHKGVDIYSVG 1135

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +         L + T ++G+   V++  EL +   +I   I   
Sbjct: 1136 IG--DVDDQQLIQITGTAGKKLTVHNFDELTKVKKRIVRNICTS 1177



 Score = 66.1 bits (159), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 53/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + NE+ + ++++      T T  A+    +     K
Sbjct: 656 DRVQIGVVQFSDVNKEEFQLNRYMSQNEISNAIDRMTHIGETTLTGSALTFVSQYFSPAK 715

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         +++F+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 716 GARP------NVRRFLILITDGEAQD--------IVKDPAVALRQEGIIIYSVGVFGSNV 761

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 762 ---TQLEEISGRPEMVFYVENFDILQHIEDDLVFGICSPR 798



 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 65/174 (37%), Gaps = 15/174 (8%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TN 276
             +V+ ++KA  +     VR G + Y              +  EV S L K  P    T 
Sbjct: 829 DFMVDLVKKA--DVGKNQVRFGALKYADDPEVLFYLGDLGSKWEVISVLQKDQPMGGNTY 886

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
           T  A+  +          +  +     + + +I ITDGE    S   + LN     + +R
Sbjct: 887 TAEALGFSDHMFTE----ARGSRLQKGVPQVLIVITDGE----SHDADKLNAT--AKALR 936

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + G+ + +V + A     +LL     SS ++F V     L   F  ++  +   
Sbjct: 937 DKGILVLAVGI-AGANPVELL-AMAGSSDKYFFVETFGGLKGIFSDVSASVCNS 988



 Score = 44.1 bits (102), Expect = 0.038,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 59/160 (36%), Gaps = 17/160 (10%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLN-PYENTNTYPAMHHAYRELYNEKE 293
            R+    Y+  +          + N + + L   L     +  T  A+  A+R  ++   
Sbjct: 63  YRVAVAQYSDRLHSEFQLGTFKSRNPMLNHLKKNLGFLGGSLRTGHALREAHRTYFSAPA 122

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
              +          V+  +          Q+  +  +  + +R  G++I SV +      
Sbjct: 123 GGRDKK--QFPPILVVLAS---------AQSEDDVEEASKALREDGVRIVSVGLQ--SAS 169

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++ L+    ++   F +  +R+L  +F +   +I +++ +
Sbjct: 170 EEELKAMA-TAQFHFNLRSARDL-GAFSQNMTQIIKEATQ 207


>gi|281345782|gb|EFB21366.1| hypothetical protein PANDA_017603 [Ailuropoda melanoleuca]
          Length = 2245

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/339 (12%), Positives = 99/339 (29%), Gaps = 39/339 (11%)

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
                  I+K  K+    R  +       QI +          + ++          +F 
Sbjct: 284 KAYTGAAIRKIRKEVFSARNGSRKNQGVPQIAVLVTHRPSEDNVTKAAVNLRREGVTIFT 343

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNN-------- 172
            G+  ++ + L   ++   E+    L        D++   +    +  N           
Sbjct: 344 MGIEGASDSQLEKIASHPAEQHVSKLKTFS----DLAAHNQTFLKKLRNQIMHTVSVFSE 399

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
              + K       +   +                      +      +V     A     
Sbjct: 400 RTETLKSGCVDTEEADIYLLIDGSGSTQ------ATDFHEMKTFLSEVVGMFNIAP---- 449

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAYRELYNE 291
              VR+G + Y              N +++   +  +      TNT  A++     L   
Sbjct: 450 -QKVRVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKA 508

Query: 292 KESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           K+   N      +   ++ +T+G         +  + L+    +R   +++Y++ V    
Sbjct: 509 KKQRGNR-----VPCHLVVLTNGM--------SKDSILEPANRLREELIRVYAIGV--KE 553

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
             Q  LR+      + + V+D   L +  +++  +I  +
Sbjct: 554 ANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICAE 592



 Score = 72.2 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 59/164 (35%), Gaps = 15/164 (9%)

Query: 228  IQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYR 286
              +     VRIG   ++                E+  ++  +      T+   A+    R
Sbjct: 1008 DFDVSVNRVRIGAAQFSHTYRPEFPLGTFVGKKEISFQIENIQQIFGYTHIGAAL----R 1063

Query: 287  ELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA 346
            ++ +       +  +    + ++ +TDG++             +  E +R+ G+ IYSV 
Sbjct: 1064 QVGHYFRPDMGSRINAGTPQVLLVLTDGQSQD--------EVARAAEDLRHKGVDIYSVG 1115

Query: 347  VSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
            +         L + T ++G+   V++  EL +   +I   I   
Sbjct: 1116 IG--DVDDQQLIQITGTAGKKLTVHNFDELTKVKKRIVRNICTS 1157



 Score = 66.1 bits (159), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 53/160 (33%), Gaps = 19/160 (11%)

Query: 234 LSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYNEK 292
             V+IG + ++             + NE+ + ++++      T T  A+    +     K
Sbjct: 636 DRVQIGVVQFSDVNKEEFQLNRYMSQNEISNAIDRMTHIGETTLTGSALTFVSQYFSPAK 695

Query: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVA-VSAPP 351
            +         +++F+I ITDGE                   +R  G+ IYSV    +  
Sbjct: 696 GARP------NVRRFLILITDGEAQD--------IVKDPAVALRQEGIIIYSVGVFGSNV 741

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQS 391
                L + +      F V +   L    D +   I    
Sbjct: 742 ---TQLEEISGRPEMVFYVENFDILQHIEDDLVFGICSPR 778



 Score = 65.7 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 65/174 (37%), Gaps = 15/174 (8%)

Query: 218 GNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TN 276
             +V+ ++KA  +     VR G + Y              +  EV S L K  P    T 
Sbjct: 809 DFMVDLVKKA--DVGKNQVRFGALKYADDPEVLFYLGDLGSKWEVISVLQKDQPMGGNTY 866

Query: 277 TYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMR 336
           T  A+  +          +  +     + + +I ITDGE    S   + LN     + +R
Sbjct: 867 TAEALGFSDHMFTE----ARGSRLQKGVPQVLIVITDGE----SHDADKLNAT--AKALR 916

Query: 337 NAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ 390
           + G+ + +V + A     +LL     SS ++F V     L   F  ++  +   
Sbjct: 917 DKGILVLAVGI-AGANPVELL-AMAGSSDKYFFVETFGGLKGIFSDVSASVCNS 968



 Score = 44.1 bits (102), Expect = 0.038,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 59/160 (36%), Gaps = 17/160 (10%)

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN-KLN-PYENTNTYPAMHHAYRELYNEKE 293
            R+    Y+  +          + N + + L   L     +  T  A+  A+R  ++   
Sbjct: 43  YRVAVAQYSDRLHSEFQLGTFKSRNPMLNHLKKNLGFLGGSLRTGHALREAHRTYFSAPA 102

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
              +          V+  +          Q+  +  +  + +R  G++I SV +      
Sbjct: 103 GGRDKK--QFPPILVVLAS---------AQSEDDVEEASKALREDGVRIVSVGLQ--SAS 149

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVR 393
           ++ L+    ++   F +  +R+L  +F +   +I +++ +
Sbjct: 150 EEELKAMA-TAQFHFNLRSARDL-GAFSQNMTQIIKEATQ 187


>gi|218131126|ref|ZP_03459930.1| hypothetical protein BACEGG_02731 [Bacteroides eggerthii DSM 20697]
 gi|317476996|ref|ZP_07936238.1| von Willebrand factor type A domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
 gi|217986646|gb|EEC52980.1| hypothetical protein BACEGG_02731 [Bacteroides eggerthii DSM 20697]
 gi|316906789|gb|EFV28501.1| von Willebrand factor type A domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
          Length = 327

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/252 (11%), Positives = 69/252 (27%), Gaps = 51/252 (20%)

Query: 172 NNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEK 231
               +         +          S    A      +++   + A   +          
Sbjct: 72  ARPQTTNSWQNSEIEGIDIMLAIDVSTSMLAEDLKPNRLEAAKDVAAEFI---------- 121

Query: 232 KNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENTNTYPAMHHAYREL 288
            N                    PL+ +   + + +  +      + T     + +A   L
Sbjct: 122 -NGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLIKDVKCGLIEDGTAVGMGIANAVTRL 180

Query: 289 YNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS 348
                       S    K +I +TDG N+           L   E  ++ G+++Y++ V 
Sbjct: 181 ----------KDSKAKSKVIILLTDGTNNKGDIS-----PLTAAEIAKSFGIRVYTIGVG 225

Query: 349 APP---------------------EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITD-K 386
                                   + + L +    + G +F    + +L E +++I   +
Sbjct: 226 TNGMAPYPYPVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLE 285

Query: 387 IQEQSVRIAPNR 398
             + SV+    R
Sbjct: 286 KTKLSVKEYSKR 297


>gi|316975135|gb|EFV58594.1| putative calcium binding EGF domain protein [Trichinella spiralis]
          Length = 2537

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 57/169 (33%), Gaps = 13/169 (7%)

Query: 227 AIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYEN-TNTYPAMHHAY 285
            + +      R+G I Y   +          N+++++  +  +      T T  A+    
Sbjct: 511 TLFDINEDRTRVGIIQYTGQVKPEFYLNQHKNIDQLQQAIRNIRYVGGLTKTGAALQFMT 570

Query: 286 RELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSV 345
           +  +  +  +        + K  + ITDG            N     +  R   + +Y+V
Sbjct: 571 KNTFTAQMGARTR--DPNVYKIGVVITDGRAQD--------NVKIPADEARRHNISLYAV 620

Query: 346 AVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFD-KITDKIQEQSVR 393
            V      +  L +   S  ++F V    EL      KI  ++ +  V+
Sbjct: 621 GV-TNHVLESELEQIAGSKDRYFIVGTFAELNTRLRAKIQKEMCKGIVK 668


>gi|19031199|gb|AAL17973.1| proximal thread matrix protein 1b [Mytilus edulis]
          Length = 444

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/236 (11%), Positives = 72/236 (30%), Gaps = 18/236 (7%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           +   +              +     +                +  +   A       ++ 
Sbjct: 209 NYVLTTNSFSELSTLLKLVIDLACEVCVVDCAGHADIAFVFDASSSIN-ANNPNNYGLMK 267

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-- 272
           +   ++V+   K   +    +V    + +             ++  E+K  ++K+ P   
Sbjct: 268 DFMKDIVDRFNKTGPDGTQFAV----VTFADRATKQFGLKDYSSKAEIKGAIDKVTPSII 323

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T     + +A  E++  +           ++K VI +TDG+N+G  + ++        
Sbjct: 324 GQTAIGDGLENARLEVFPNRNGGGR----EEVQKVVILLTDGQNNGHKSPEHES------ 373

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
             +R  G+ I ++ V      +  L     S    F  +   +L +  + +     
Sbjct: 374 SLLRKEGVVIVAIGVGTG-FLKSELINIASSEEYVFTTSSFNKLSKIMENVVKLAC 428



 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/216 (12%), Positives = 59/216 (27%), Gaps = 14/216 (6%)

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                   +           ++      LV+S        +N S
Sbjct: 30  PGNTGKDAEECDVQADIIVLFDDSSSIQYDNKENYQMMKNFVKELVDSFTTVGVNGRNGS 89

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE 293
            + G + ++ G+             ++K  +  + P     T     + H     ++  E
Sbjct: 90  -QFGVVQFSQGVKTAFPLNKFKTKEDIKKGIQDMVPRNGGQTEIGTGLQHVRENSFSGAE 148

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
                 G+   +K VI +TDG+++                 ++  G+ + ++ +      
Sbjct: 149 GG----GNPDKQKIVILMTDGKSNAG------APPQHEAHKLKAEGVTVIAIGIGQG-FV 197

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +  L +           N   EL      + D   E
Sbjct: 198 KTELEQIATMKNYVLTTNSFSELSTLLKLVIDLACE 233


>gi|319902109|ref|YP_004161837.1| von Willebrand factor type A [Bacteroides helcogenes P 36-108]
 gi|319417140|gb|ADV44251.1| von Willebrand factor type A [Bacteroides helcogenes P 36-108]
          Length = 327

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 64/205 (31%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   + + L  +      + T
Sbjct: 108 NRLEAAKDVATEFINGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGFIEDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           L   E  
Sbjct: 168 AIGMGLANAVTRL----------KDSKAKSKVIILLTDGVNNKGDIS-----PLTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP---------------------EGQDLLRKCTDSSGQFFAVNDSR 374
           ++ G+++Y++ V                         + + L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|160882770|ref|ZP_02063773.1| hypothetical protein BACOVA_00731 [Bacteroides ovatus ATCC 8483]
 gi|237720676|ref|ZP_04551157.1| BatA [Bacteroides sp. 2_2_4]
 gi|260170239|ref|ZP_05756651.1| aerotolerance protein BatA [Bacteroides sp. D2]
 gi|293373990|ref|ZP_06620331.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CMC 3f]
 gi|299145608|ref|ZP_07038676.1| BatA protein [Bacteroides sp. 3_1_23]
 gi|315918602|ref|ZP_07914842.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111794|gb|EDO13539.1| hypothetical protein BACOVA_00731 [Bacteroides ovatus ATCC 8483]
 gi|229449511|gb|EEO55302.1| BatA [Bacteroides sp. 2_2_4]
 gi|292631066|gb|EFF49703.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CMC 3f]
 gi|298516099|gb|EFI39980.1| BatA protein [Bacteroides sp. 3_1_23]
 gi|313692477|gb|EFS29312.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 327

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 63/205 (30%), Gaps = 40/205 (19%)

Query: 219 NLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY---ENT 275
           N + + +    E  N                    PL+ +   +   ++ +      + T
Sbjct: 108 NRLEAAKDVAAEFINGRPNDNIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLITDGT 167

Query: 276 NTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYM 335
                + +A   L            S    K +I +TDG N+           +   E  
Sbjct: 168 AVGMGIANAVTRL----------KDSKAKSKVIILLTDGTNNKGDIS-----PMTAAEIA 212

Query: 336 RNAGMKIYSVAVSAPP--------------------EGQDLLRKCT-DSSGQFFAVNDSR 374
           ++ G+++Y++ V                          +  L +    + G +F    + 
Sbjct: 213 KSFGIRVYTIGVGTNGMAPYPYPVGNTVQYVSMPVEIDEKTLTEIAGTTDGNYFRATSNS 272

Query: 375 ELLESFDKITD-KIQEQSVRIAPNR 398
           +L E +++I   +  + +V+    R
Sbjct: 273 KLKEVYEEIDKLEKTKLNVKEYSKR 297


>gi|19033105|gb|AAL83537.1|AF414454_1 proximal thread matrix protein 1 variant a [Mytilus edulis]
          Length = 441

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/236 (11%), Positives = 72/236 (30%), Gaps = 18/236 (7%)

Query: 155 DVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLI 214
           +   +              +     +                +  +   A       ++ 
Sbjct: 206 NYVLTTNSFSELSTLLKLVIDLACEVCVVDCAGHADIAFVFDASSSIN-ANNPNNYGLMK 264

Query: 215 ESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-- 272
           +   ++V+   K   +    +V    + +             ++  E+K  ++K+ P   
Sbjct: 265 DFMKDIVDRFNKTGPDGTQFAV----VTFADRATKQFGLKDYSSKAEIKGAIDKVTPSII 320

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T     + +A  E++  +           ++K VI +TDG+N+G  + ++        
Sbjct: 321 GQTAIGDGLENARLEVFPNRNGGGR----EEVQKVVILLTDGQNNGHKSPEHES------ 370

Query: 333 EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ 388
             +R  G+ I ++ V      +  L     S    F  +   +L +  + +     
Sbjct: 371 SLLRKEGVVIVAIGVGTG-FLKSELINIASSEEYVFTTSSFNKLSKIMENVVKLAC 425



 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/216 (12%), Positives = 59/216 (27%), Gaps = 14/216 (6%)

Query: 176 SNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLS 235
                                   +           ++      LV+S        +N S
Sbjct: 27  PGNTGKDAEECDVQADIIVLFDDSSSIQYDNKENYQMMKNFVKELVDSFTTVGVNGRNGS 86

Query: 236 VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP--YENTNTYPAMHHAYRELYNEKE 293
            + G + ++ G+             ++K  +  + P     T     + H     ++  E
Sbjct: 87  -QFGVVQFSQGVKTAFPLNKFKTKEDIKKGIQDMVPRNGGQTEIGTGLQHVRENSFSGAE 145

Query: 294 SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEG 353
                 G+   +K VI +TDG+++                 ++  G+ + ++ +      
Sbjct: 146 GG----GNPDKQKIVILMTDGKSNAG------APPQHEAHKLKAEGVTVIAIGIGQG-FV 194

Query: 354 QDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQE 389
           +  L +           N   EL      + D   E
Sbjct: 195 KTELEQIATMKNYVLTTNSFSELSTLLKLVIDLACE 230


>gi|262371960|ref|ZP_06065239.1| von Willebrand factor type A domain-containing protein
           [Acinetobacter junii SH205]
 gi|262311985|gb|EEY93070.1| von Willebrand factor type A domain-containing protein
           [Acinetobacter junii SH205]
          Length = 537

 Score = 82.3 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/359 (10%), Positives = 100/359 (27%), Gaps = 29/359 (8%)

Query: 40  GCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNN 99
              S      +     +K  T +           +     E            + +   +
Sbjct: 30  VAMSPPPTAHMSSEMARKMVTPSYIAAIPAPERVKLEANTEKYQKNEVNPVHRVAERAVS 89

Query: 100 PLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS 159
                 +    Y      L    L P     +         +  + + I    V   +  
Sbjct: 90  TFSIDVD-TGSYTNTRRFLNDGRLPPVDAIRVEEMINYFDYQYPQPVGIHPFSVTTETVD 148

Query: 160 MEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGN 219
                  K         +  +   P     +  + + S   P       K+ ++ ++   
Sbjct: 149 SPWKENAKLIKIGIQAKDLSVKQLPAANLVFLVDVSGSMDDP------DKLPLVKQTLRI 202

Query: 220 LVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYP 279
           L   ++           ++  I Y  G          +  +++   +++L     T+   
Sbjct: 203 LTEQLRPQD--------KVTIITYASGEKLVLEPTSGDQKDKILRVIDELRAGGATSGEQ 254

Query: 280 AMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAG 339
           A+  AY++       +            ++  TDG+ +      +TL    +    R +G
Sbjct: 255 AIQLAYKQAEKAFIKNGINR--------ILLATDGDFNVGITDFSTL--KGMVAEKRKSG 304

Query: 340 MKIYSVAVSAPPEGQDLLRKCTDSS-GQFFAVNDSRELLESFDKITDKIQEQSVRIAPN 397
           + + ++        ++L+ +  D+  G +  +++  E  +       ++      +A +
Sbjct: 305 VSLTALGYGTGNYNEELMEQIADAGDGNYSYIDNKNEAKKVVQ---RQLSSTLATVAQD 360


>gi|197336671|ref|YP_002158318.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
 gi|197313923|gb|ACH63372.1| von Willebrand factor, type A [Vibrio fischeri MJ1