RPSBLAST alignment for GI: 254781108 and conserved domain: smart00327

>gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain. VWA domains in extracellular eukaryotic proteins mediate adhesion via metal ion-dependent adhesion sites (MIDAS). Intracellular VWA domains and homologues in prokaryotes have recently been identified. The proposed VWA domains in integrin beta subunits have recently been substantiated using sequence-based methods. Length = 177
 Score = 47.5 bits (113), Expect = 6e-06
 Identities = 30/178 (16%), Positives = 61/178 (34%), Gaps = 21/178 (11%)

Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265
              + +   E    LV  +     +      R+G + ++           S + + +   
Sbjct: 15  GPNRFEKAKEFVLKLVEQL-----DIGPDGDRVGLVTFSDDATVLFPLNDSRSKDALLEA 69

Query: 266 LNKLNPY--ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323
           L  L+      TN   A+ +A   L+++   S          K +I ITDGE++      
Sbjct: 70  LASLSYKLGGGTNLGAALQYALENLFSKSAGSRRGA-----PKVLILITDGESNDGGDLL 124

Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK--CTDSSGQFFAVNDSRELLES 379
                L      + +G+K++ V V    + ++ L+K          F       L++ 
Sbjct: 125 KAAKEL------KRSGVKVFVVGVGNDVD-EEELKKLASAPGGVYVFLPELFDLLIDL 175