RPSBLAST alignment for GI: 254781108 and conserved domain: pfam00092

>gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain. Length = 177
 Score = 46.2 bits (110), Expect = 1e-05
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 14/131 (10%)

Query: 256 SNNLNEVKSRLNKLNPY--ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITD 313
             + +++ S + +   Y    TNT  A+ +A   L+    S  N        K VI +TD
Sbjct: 58  YKSKDDLLSAVLRNIYYLGGGTNTGKALKYALENLFRSAGSRPNA------PKVVILLTD 111

Query: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQ-DLLRKCTDSSGQFFAVND 372
           G+++           L+     R  G+ ++ V V    E +  L+     S G  F V D
Sbjct: 112 GKSNDGGLVPAAAAALR-----RKVGIIVFGVGVGDVDEEELRLIASEPCSEGHVFYVTD 166

Query: 373 SRELLESFDKI 383
              L +  +++
Sbjct: 167 FDALSDIQEEL 177