RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] (398 letters) >gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain. VWA domains in extracellular eukaryotic proteins mediate adhesion via metal ion-dependent adhesion sites (MIDAS). Intracellular VWA domains and homologues in prokaryotes have recently been identified. The proposed VWA domains in integrin beta subunits have recently been substantiated using sequence-based methods. Length = 177 Score = 47.5 bits (113), Expect = 6e-06 Identities = 30/178 (16%), Positives = 61/178 (34%), Gaps = 21/178 (11%) Query: 206 ANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSR 265 + + E LV + + R+G + ++ S + + + Sbjct: 15 GPNRFEKAKEFVLKLVEQL-----DIGPDGDRVGLVTFSDDATVLFPLNDSRSKDALLEA 69 Query: 266 LNKLNPY--ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQ 323 L L+ TN A+ +A L+++ S K +I ITDGE++ Sbjct: 70 LASLSYKLGGGTNLGAALQYALENLFSKSAGSRRGA-----PKVLILITDGESNDGGDLL 124 Query: 324 NTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK--CTDSSGQFFAVNDSRELLES 379 L + +G+K++ V V + ++ L+K F L++ Sbjct: 125 KAAKEL------KRSGVKVFVVGVGNDVD-EEELKKLASAPGGVYVFLPELFDLLIDL 175 >gnl|CDD|149078 pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues. Length = 43 Score = 32.7 bits (76), Expect = 0.15 Identities = 9/36 (25%), Positives = 18/36 (50%) Query: 2 TAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAV 37 A+++ V L + ++L + Y R +Q+A A Sbjct: 7 FALVLPVLLLLLFGIVELGRLFYARQVLQNAAREAA 42 >gnl|CDD|179783 PRK04203, rpl1P, 50S ribosomal protein L1P; Reviewed. Length = 215 Score = 31.0 bits (71), Expect = 0.58 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 20/75 (26%) Query: 201 PAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT-------IAYNIGIVGNQCT 253 P P P N I L+E L N+++ +++ VR+GT +A NI V Sbjct: 132 PTPLPPNADIKPLVE---RLKNTVRIRTKDQPTFHVRVGTEDMSPEELAENIDAV----- 183 Query: 254 PLSNNLNEVKSRLNK 268 LN ++S+L K Sbjct: 184 -----LNRIESKLEK 193 >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively. Length = 418 Score = 30.0 bits (68), Expect = 1.3 Identities = 11/42 (26%), Positives = 17/42 (40%) Query: 298 TIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAG 339 +G LK+ V+ + + S Q I EY R+ G Sbjct: 188 DLGEEGLKRSVVVVATSDESPLMRRQAAYTATAIAEYFRDQG 229 >gnl|CDD|181279 PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated. Length = 466 Score = 29.5 bits (67), Expect = 1.7 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 14/38 (36%) Query: 16 AIDLAHIM--------------YIRNQMQSALDAAVLS 39 AIDLAH + + +M S LDAA L Sbjct: 319 AIDLAHALGVEEPKVAILSAVETVNPKMPSTLDAAALC 356 >gnl|CDD|178687 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional. Length = 1033 Score = 27.1 bits (60), Expect = 8.0 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Query: 230 EKKNLS--VRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNP 271 E LS +R+ + Y + I G TPL NNL+E+ + LN L P Sbjct: 306 ENSLLSKTMRLFSTNYRLLITG---TPLQNNLHELWALLNFLLP 346 >gnl|CDD|162203 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase. Built to distinquish between the highly similar genes galU and galF. Length = 260 Score = 27.3 bits (61), Expect = 8.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Query: 17 IDLAHIMYIRNQMQSALDAAVLSG 40 LA I Y+R + Q L AVL Sbjct: 90 SPLATIFYVRQKEQKGLGHAVLCA 113 >gnl|CDD|148693 pfam07236, Phytoreo_S7, Phytoreovirus S7 protein. This family consists of several Phytoreovirus S7 proteins which are thought to be viral core proteins. Length = 506 Score = 27.1 bits (60), Expect = 9.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 55 TKKDQTSTIFKKQIKKHLKQGSY 77 T+ D+ +F K + KH+ G Y Sbjct: 306 TESDKWEEMFNKCVCKHIIAGDY 328 >gnl|CDD|161817 TIGR00321, dhys, deoxyhypusine synthase. This family of apparent orthologs has an unusual UPGMA difference tree, in which the members from the archaea M. jannaschii and P. horikoshii cluster with the known eukaryotic deoxyhypusine synthases. Separated by a fairly deep branch, although still strongly related, is a small cluster of proteins from Methanobacterium thermoautotrophicum and Archeoglobus fulgidus, the latter of which has two. Length = 301 Score = 27.0 bits (60), Expect = 9.1 Identities = 6/22 (27%), Positives = 13/22 (59%) Query: 207 NRKIDVLIESAGNLVNSIQKAI 228 + ID L+ + NL + + +A+ Sbjct: 71 HGMIDALVTTGANLEHDLIEAL 92 >gnl|CDD|151809 pfam11369, DUF3160, Protein of unknown function (DUF3160). This family of proteins has no known function. Length = 637 Score = 27.0 bits (60), Expect = 9.5 Identities = 10/51 (19%), Positives = 16/51 (31%) Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD 362 G + +++ N E + KIY + E D K T Sbjct: 262 VFGGDRKPASFDNETLAELKAELAKYESPKIYGGTIPFTSEQADECLKDTK 312 >gnl|CDD|184711 PRK14499, PRK14499, molybdenum cofactor biosynthesis protein MoaC/MOSC-domain-containing protein; Provisional. Length = 308 Score = 26.7 bits (59), Expect = 9.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 73 KQGSYIRENAGDIAQKAQINITKDKNNPLQYIAES 107 K G YI E A+ INI++ K P + + E+ Sbjct: 150 KSGHYIFERRNKTAKVVSINISRQKGTPKEPVEEA 184 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.129 0.359 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,053,282 Number of extensions: 367526 Number of successful extensions: 588 Number of sequences better than 10.0: 1 Number of HSP's gapped: 586 Number of HSP's successfully gapped: 27 Length of query: 398 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 303 Effective length of database: 3,941,713 Effective search space: 1194339039 Effective search space used: 1194339039 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.2 bits)