RPSBLAST alignment of GI: 254781108 and protein with PDBid: 1ijb

>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202
 Score = 44.1 bits (103), Expect = 5e-05
 Identities = 18/176 (10%), Positives = 51/176 (28%), Gaps = 13/176 (7%)

Query: 214 IESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE 273
            E     V  + + ++  +   VR+  + Y+          +     +  S L ++    
Sbjct: 31  FEVLKAFVVDMMERLRVSQK-WVRVAVVEYH----DGSHAYIGLKDRKRPSELRRIASQV 85

Query: 274 NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICE 333
                     +    Y   +           +  ++ +   E    S      N ++  +
Sbjct: 86  KYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSR-----NFVRYVQ 140

Query: 334 YMRNAGMKIYSVAVSAPPEGQDLLRKCTD--SSGQFFAVNDSRELLESFDKITDKI 387
            ++   + +  V +         +R         + F ++   EL +  D+I   +
Sbjct: 141 GLKKKKVIVIPVGIGPHAN-LKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYL 195