Query gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 86 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 04:36:38 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781109.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam07105 DUF1367 Protein of u 35.9 15 0.00037 17.9 0.8 13 56-68 43-55 (196) 2 pfam07127 Nodulin_late Late no 35.1 38 0.00097 15.6 2.8 20 66-85 5-24 (54) 3 pfam00029 Connexin Connexin. 25.2 48 0.0012 15.1 1.9 16 56-71 68-83 (107) 4 pfam06489 Orthopox_A49R Orthop 22.5 65 0.0017 14.3 2.6 28 18-45 60-87 (112) 5 pfam05756 S-antigen S-antigen 22.1 53 0.0013 14.8 1.6 12 64-75 9-20 (310) 6 KOG3645 consensus 21.3 69 0.0018 14.2 3.1 63 18-80 251-316 (449) 7 TIGR03230 lipo_lipase lipoprot 19.6 32 0.00082 16.0 0.1 20 28-47 232-251 (442) 8 cd02996 PDI_a_ERp44 PDIa famil 18.7 46 0.0012 15.1 0.8 19 28-46 28-46 (108) 9 cd02999 PDI_a_ERp44_like PDIa 18.4 40 0.001 15.5 0.4 18 28-45 28-45 (100) 10 KOG1962 consensus 18.3 62 0.0016 14.4 1.3 15 14-28 51-65 (216) No 1 >pfam07105 DUF1367 Protein of unknown function (DUF1367). This family consists of several highly conserved, hypothetical bacterial and phage proteins of around 200 resides in length. The function of this family is unknown. Probab=35.86 E-value=15 Score=17.87 Aligned_cols=13 Identities=62% Similarity=1.022 Sum_probs=9.6 Q ss_pred CCCCHHHHHHHHH Q ss_conf 6411345899999 Q gi|254781109|r 56 RPVSHRRFFALLF 68 (86) Q Consensus 56 rpvshrrffallf 68 (86) .|--||+|||||- T Consensus 43 Np~FHRKfFaLLn 55 (196) T pfam07105 43 NPAFHRKFFALLN 55 (196) T ss_pred CHHHHHHHHHHHH T ss_conf 8888999999997 No 2 >pfam07127 Nodulin_late Late nodulin protein. This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues towards the C-terminus which may be involved in metal-binding. Probab=35.06 E-value=38 Score=15.60 Aligned_cols=20 Identities=35% Similarity=0.751 Sum_probs=16.0 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999774 Q gi|254781109|r 66 LLFIYLIIIFRFMLLIVKAV 85 (86) Q Consensus 66 llfiyliiifrfmllivkav 85 (86) +-|+|.+|+|-+..|+++.+ T Consensus 5 lkFVY~~IlFlsLFlv~~n~ 24 (54) T pfam07127 5 LKFVYAMILFLSLFLVATNV 24 (54) T ss_pred HHHHHHHHHHHHHHHHHHCC T ss_conf 99999999999999999436 No 3 >pfam00029 Connexin Connexin. Probab=25.16 E-value=48 Score=15.05 Aligned_cols=16 Identities=44% Similarity=0.895 Sum_probs=12.4 Q ss_pred CCCCHHHHHHHHHHHH Q ss_conf 6411345899999999 Q gi|254781109|r 56 RPVSHRRFFALLFIYL 71 (86) Q Consensus 56 rpvshrrffallfiyl 71 (86) .|+||-||.++-.|.. T Consensus 68 ~PiShiRfW~lQii~v 83 (107) T pfam00029 68 FPISHIRFWVLQIIFV 83 (107) T ss_pred CCCHHHHHHHHHHHHH T ss_conf 7652899999999999 No 4 >pfam06489 Orthopox_A49R Orthopoxvirus A49R protein. This family consists of several Orthopoxvirus A49R proteins. The function of this family is unknown. Probab=22.49 E-value=65 Score=14.34 Aligned_cols=28 Identities=36% Similarity=0.527 Sum_probs=11.9 Q ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHH Q ss_conf 0488988999998421118999998999 Q gi|254781109|r 18 IFISFIDSIILWCQHSRHVDFVIDSLMN 45 (86) Q Consensus 18 ifisfidsiilwcqhsrhvdfvidslmn 45 (86) -||||.|.+-+.-...---.-.|.||-. T Consensus 60 pfisfldt~y~~idq~iyqnelinsldd 87 (112) T pfam06489 60 PFISFLDTIYLFIDQCIYQNELINSLDD 87 (112) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 2699999999999999999998722364 No 5 >pfam05756 S-antigen S-antigen protein. S-antigens are heat stable proteins that are found in the blood of individuals infected with malaria. Probab=22.06 E-value=53 Score=14.84 Aligned_cols=12 Identities=58% Similarity=0.913 Sum_probs=6.7 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254781109|r 64 FALLFIYLIIIF 75 (86) Q Consensus 64 fallfiyliiif 75 (86) |-|.||||.|.- T Consensus 9 fyLFFiYLYIYk 20 (310) T pfam05756 9 FYLFFIYLYIYK 20 (310) T ss_pred HHHHHHHHHHHH T ss_conf 789999999987 No 6 >KOG3645 consensus Probab=21.34 E-value=69 Score=14.20 Aligned_cols=63 Identities=19% Similarity=0.353 Sum_probs=42.4 Q ss_pred HHHHHHHHHHHHHH-CCC--HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 04889889999984-211--1899999899999999999706411345899999999999999999 Q gi|254781109|r 18 IFISFIDSIILWCQ-HSR--HVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLL 80 (86) Q Consensus 18 ifisfidsiilwcq-hsr--hvdfvidslmnlalimlivlcrpvshrrffallfiyliiifrfmll 80 (86) .+|+++..+..|-. .+| .+.+-+..|+.++.+++.+-..--+.-..-.|+-.|++..+-++.+ T Consensus 251 ~lis~l~il~fflp~~~~~eki~L~it~Ll~~tv~ll~vs~~~P~ts~~iPLig~y~~~~m~~~~~ 316 (449) T KOG3645 251 FLISFLSILGFFLPSDSGTEKVTLGITVLLAMTVFLLLVSDKMPPTSSVIPLIGKYLLFTMVLVTI 316 (449) T ss_pred HHHHHHHHHHEECCCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH T ss_conf 999999987356778899847998099999999999999715689889862699999999999999 No 7 >TIGR03230 lipo_lipase lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity. Probab=19.56 E-value=32 Score=16.00 Aligned_cols=20 Identities=40% Similarity=0.750 Sum_probs=16.8 Q ss_pred HHHHCCCHHHHHHHHHHHHH Q ss_conf 99842111899999899999 Q gi|254781109|r 28 LWCQHSRHVDFVIDSLMNLA 47 (86) Q Consensus 28 lwcqhsrhvdfvidslmnla 47 (86) .-|.|.|-+.+-+||+.|-. T Consensus 232 ~~C~H~Rs~~~f~eSi~n~~ 251 (442) T TIGR03230 232 VKCSHERSIHLFIDSLLNEE 251 (442) T ss_pred CCCCCHHHHHHHHHHCCCCC T ss_conf 22260889999997534889 No 8 >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Probab=18.74 E-value=46 Score=15.14 Aligned_cols=19 Identities=16% Similarity=0.468 Sum_probs=14.5 Q ss_pred HHHHCCCHHHHHHHHHHHH Q ss_conf 9984211189999989999 Q gi|254781109|r 28 LWCQHSRHVDFVIDSLMNL 46 (86) Q Consensus 28 lwcqhsrhvdfvidslmnl 46 (86) -||.|++...-+.+.+... T Consensus 28 ~WC~~Ck~~~P~~~~~a~~ 46 (108) T cd02996 28 DWCRFSQMLHPIFEEAAAK 46 (108) T ss_pred CCCHHHHHHHHHHHHHHHH T ss_conf 9998899864599999999 No 9 >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER. Probab=18.45 E-value=40 Score=15.50 Aligned_cols=18 Identities=22% Similarity=0.492 Sum_probs=14.1 Q ss_pred HHHHCCCHHHHHHHHHHH Q ss_conf 998421118999998999 Q gi|254781109|r 28 LWCQHSRHVDFVIDSLMN 45 (86) Q Consensus 28 lwcqhsrhvdfvidslmn 45 (86) -||.|++...=+.+.+.. T Consensus 28 pWC~hCk~l~P~~~~la~ 45 (100) T cd02999 28 SWCPFSASFRPHFNALSS 45 (100) T ss_pred CCCHHHHHHHHHHHHHHH T ss_conf 888888987189999998 No 10 >KOG1962 consensus Probab=18.27 E-value=62 Score=14.44 Aligned_cols=15 Identities=47% Similarity=0.625 Sum_probs=11.5 Q ss_pred CCCHHHHHHHHHHHH Q ss_conf 711204889889999 Q gi|254781109|r 14 RNIVIFISFIDSIIL 28 (86) Q Consensus 14 rnivifisfidsiil 28 (86) --++|+++|+||+.- T Consensus 51 ~~~villlfiDsvr~ 65 (216) T KOG1962 51 TMIVILLLFIDSVRR 65 (216) T ss_pred HHHHHHHHHHHHHHH T ss_conf 999999999999999 Done!