RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >d2r6gf1 e.70.1.1 (F:13-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Length = 248 Score = 22.9 bits (49), Expect = 8.0 Identities = 7/44 (15%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 46 LALIMLIVLCRP---VSHRRFFALLFIYLIIIFRFMLLIVKAVF 86 A+ LI+ ++R+ +A ++Y + + ++ V Sbjct: 30 FAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVC 73 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.347 0.155 0.474 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 311,192 Number of extensions: 11447 Number of successful extensions: 72 Number of sequences better than 10.0: 1 Number of HSP's gapped: 72 Number of HSP's successfully gapped: 10 Length of query: 86 Length of database: 2,407,596 Length adjustment: 51 Effective length of query: 35 Effective length of database: 1,707,366 Effective search space: 59757810 Effective search space used: 59757810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 14 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.7 bits) S2: 47 (22.0 bits)