BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] Length = 86 Score = 164 bits (414), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSH 60 MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSH Sbjct: 1 MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSH 60 Query: 61 RRFFALLFIYLIIIFRFMLLIVKAVF 86 RRFFALLFIYLIIIFRFMLLIVKAVF Sbjct: 61 RRFFALLFIYLIIIFRFMLLIVKAVF 86 >gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Score = 21.9 bits (45), Expect = 1.8, Method: Compositional matrix adjust. Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 9/66 (13%) Query: 29 WCQHSRHVDFV------IDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIII---FRFML 79 WC +S H + I S ++ L M++VL +S F L + R ML Sbjct: 144 WCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREML 203 Query: 80 LIVKAV 85 I+K++ Sbjct: 204 DIIKSI 209 >gi|254780897|ref|YP_003065310.1| trigger factor [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 20.4 bits (41), Expect = 6.7, Method: Composition-based stats. Identities = 7/20 (35%), Positives = 14/20 (70%) Query: 23 IDSIILWCQHSRHVDFVIDS 42 +D++IL Q ++V F++ S Sbjct: 181 VDNVILEDQSKKNVQFIVGS 200 >gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Score = 20.0 bits (40), Expect = 7.0, Method: Composition-based stats. Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 16 IVIFISFIDSIILWCQ 31 I + F+ + I+WCQ Sbjct: 880 IKVLSRFVQAEIVWCQ 895 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.347 0.155 0.474 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,164 Number of Sequences: 1233 Number of extensions: 1627 Number of successful extensions: 7 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 6 length of query: 86 length of database: 328,796 effective HSP length: 55 effective length of query: 31 effective length of database: 260,981 effective search space: 8090411 effective search space used: 8090411 T: 11 A: 40 X1: 14 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.7 bits) S2: 31 (16.5 bits)