Query gi|254781111|ref|YP_003065524.1| geranyltranstransferase protein [Candidatus Liberibacter asiaticus str. psy62] Match_columns 237 No_of_seqs 116 out of 4447 Neff 7.4 Searched_HMMs 39220 Date Mon May 30 05:02:50 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781111.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK10581 geranyltranstransfera 100.0 0 0 412.2 21.0 229 4-237 2-238 (299) 2 PRK10888 octaprenyl diphosphat 100.0 0 0 375.5 19.4 213 5-236 6-225 (323) 3 COG0142 IspA Geranylgeranyl py 100.0 0 0 371.0 19.3 217 4-236 2-228 (322) 4 CHL00151 preA prenyl transfera 100.0 0 0 368.0 19.9 217 2-237 4-230 (288) 5 pfam00348 polyprenyl_synt Poly 100.0 0 0 370.1 16.3 195 39-237 1-201 (260) 6 cd00685 Trans_IPPS_HT Trans-Is 100.0 0 0 369.0 16.6 193 36-236 3-203 (298) 7 TIGR02749 prenyl_cyano solanes 100.0 0 0 350.1 16.4 219 9-236 3-231 (325) 8 TIGR02748 GerC3_HepT heptapren 100.0 0 0 342.7 14.4 215 4-236 4-226 (325) 9 KOG0776 consensus 100.0 0 0 330.8 18.1 205 27-233 82-289 (384) 10 cd00867 Trans_IPPS Trans-Isopr 100.0 2.8E-45 0 285.3 13.1 171 53-234 1-175 (236) 11 KOG0777 consensus 100.0 1.1E-36 2.9E-41 235.1 11.1 185 31-230 15-204 (322) 12 KOG0711 consensus 100.0 5.3E-34 1.3E-38 219.4 14.2 209 20-234 20-244 (347) 13 cd00385 Isoprenoid_Biosyn_C1 I 99.9 1.7E-27 4.4E-32 181.0 8.7 153 73-236 13-171 (243) 14 pfam07307 HEPPP_synt_1 Heptapr 94.5 0.26 6.6E-06 27.0 7.6 80 66-152 29-108 (212) 15 TIGR03464 HpnC squalene syntha 94.1 0.42 1.1E-05 25.8 11.9 72 157-235 89-161 (266) 16 cd00683 Trans_IPPS_HH Trans-Is 94.0 0.25 6.4E-06 27.1 6.6 73 157-235 96-169 (265) 17 TIGR03465 HpnD squalene syntha 93.9 0.32 8.1E-06 26.5 7.0 71 158-235 89-160 (266) 18 pfam00494 SQS_PSY Squalene/phy 93.6 0.28 7.1E-06 26.8 6.2 74 157-235 92-166 (262) 19 PRK13594 consensus 70.4 7.7 0.0002 18.3 7.3 44 191-234 139-183 (278) 20 KOG0018 consensus 67.7 3.2 8.3E-05 20.5 1.7 13 108-120 516-528 (1141) 21 pfam06783 UPF0239 Uncharacteri 61.8 9.4 0.00024 17.8 3.2 20 204-223 15-34 (85) 22 pfam10776 DUF2600 Protein of u 55.3 8.5 0.00022 18.1 2.1 33 201-233 205-238 (330) 23 PRK13593 consensus 54.1 16 0.0004 16.5 7.7 46 189-234 144-190 (283) 24 KOG1345 consensus 50.6 7.1 0.00018 18.5 1.1 24 73-97 128-151 (378) 25 KOG1166 consensus 45.2 16 0.0004 16.5 2.1 36 73-109 801-836 (974) 26 PRK12887 ubiA tocopherol phyty 42.5 24 0.00061 15.4 10.8 115 79-195 192-307 (309) 27 cd05105 PTKc_PDGFR_alpha Catal 36.6 10 0.00026 17.7 0.0 22 72-93 243-264 (400) 28 TIGR01957 nuoB_fam NADH-quinon 35.7 22 0.00057 15.6 1.7 33 69-105 21-55 (146) 29 cd05061 PTKc_InsR Catalytic Do 32.9 11 0.00029 17.3 -0.2 22 72-93 125-146 (288) 30 cd05038 PTKc_Jak_rpt2 Catalyti 32.9 9.6 0.00025 17.8 -0.5 22 72-93 115-136 (279) 31 cd05097 PTKc_DDR_like Catalyti 32.8 10 0.00026 17.6 -0.5 22 72-93 135-156 (295) 32 cd05049 PTKc_Trk Catalytic Dom 32.7 11 0.00028 17.4 -0.3 22 72-93 128-149 (280) 33 cd00192 PTKc Catalytic Domain 32.3 13 0.00034 16.9 0.1 22 72-93 110-131 (261) 34 cd06610 STKc_OSR1_SPAK Serine/ 32.2 13 0.00033 17.0 -0.0 21 73-93 109-129 (266) 35 cd05085 PTKc_Fer Catalytic Dom 32.1 11 0.00029 17.4 -0.3 22 72-93 99-120 (250) 36 cd05099 PTKc_FGFR4 Catalytic D 32.1 11 0.00029 17.4 -0.3 22 72-93 140-161 (314) 37 cd05055 PTKc_PDGFR Catalytic D 31.7 13 0.00034 16.9 -0.0 22 72-93 147-168 (302) 38 cd05096 PTKc_DDR1 Catalytic Do 31.6 8.1 0.00021 18.2 -1.1 22 72-93 144-165 (304) 39 pfam04703 FaeA FaeA-like prote 31.5 14 0.00037 16.7 0.2 22 89-110 39-60 (61) 40 cd05053 PTKc_FGFR Catalytic Do 31.0 14 0.00035 16.9 -0.0 22 72-93 139-160 (294) 41 cd05102 PTKc_VEGFR3 Catalytic 31.0 14 0.00035 16.8 0.0 21 73-93 181-201 (338) 42 cd05074 PTKc_Tyro3 Catalytic D 30.7 13 0.00034 17.0 -0.1 22 72-93 119-140 (273) 43 cd05107 PTKc_PDGFR_beta Cataly 30.5 13 0.00033 17.0 -0.2 22 72-93 245-266 (401) 44 cd05036 PTKc_ALK_LTK Catalytic 30.5 16 0.0004 16.5 0.2 21 73-93 123-143 (277) 45 TIGR01962 NuoD NADH dehydrogen 30.1 38 0.00097 14.3 3.8 100 119-218 69-180 (408) 46 TIGR02362 dhaK1b probable dihy 30.1 17 0.00044 16.2 0.4 43 70-113 106-161 (328) 47 PRK12883 ubiA prenyltransferas 30.0 38 0.00097 14.2 7.8 45 189-234 139-183 (275) 48 cd05035 PTKc_Axl_like Catalyti 29.9 12 0.00032 17.1 -0.4 22 72-93 119-140 (273) 49 cd05032 PTKc_InsR_like Catalyt 29.0 17 0.00043 16.3 0.2 22 72-93 125-146 (277) 50 cd05103 PTKc_VEGFR2 Catalytic 28.4 17 0.00044 16.3 0.1 21 73-93 186-206 (343) 51 cd05066 PTKc_EphR_A Catalytic 28.4 15 0.00038 16.6 -0.2 22 72-93 112-133 (267) 52 cd05087 PTKc_Aatyk1_Aatyk3 Cat 28.2 14 0.00036 16.8 -0.3 22 72-93 106-127 (269) 53 cd05075 PTKc_Axl Catalytic Dom 28.0 14 0.00036 16.8 -0.4 22 72-93 118-139 (272) 54 TIGR01982 UbiB 2-polyprenylphe 27.9 42 0.0011 14.0 2.3 32 50-81 188-220 (452) 55 cd05148 PTKc_Srm_Brk Catalytic 27.9 17 0.00042 16.4 -0.0 22 72-93 110-131 (261) 56 cd05106 PTKc_CSF-1R Catalytic 27.9 15 0.00037 16.7 -0.3 22 72-93 218-239 (374) 57 KOG0591 consensus 27.4 42 0.0011 14.0 2.1 43 73-127 131-177 (375) 58 KOG0194 consensus 27.3 14 0.00036 16.8 -0.5 23 71-93 267-289 (474) 59 cd05063 PTKc_EphR_A2 Catalytic 27.2 14 0.00036 16.8 -0.5 22 72-93 113-134 (268) 60 cd05101 PTKc_FGFR2 Catalytic D 27.0 13 0.00033 17.0 -0.7 22 72-93 143-164 (304) 61 cd05056 PTKc_FAK Catalytic Dom 26.9 17 0.00043 16.3 -0.2 22 72-93 113-134 (270) 62 cd05092 PTKc_TrkA Catalytic Do 26.8 16 0.00041 16.5 -0.3 21 73-93 129-149 (280) 63 cd05079 PTKc_Jak1_rpt2 Catalyt 26.6 9.7 0.00025 17.7 -1.4 22 72-93 115-136 (284) 64 cd05058 PTKc_Met_Ron Catalytic 26.4 14 0.00036 16.8 -0.6 22 72-93 104-125 (262) 65 cd05052 PTKc_Abl Catalytic Dom 25.6 18 0.00046 16.1 -0.2 22 72-93 110-131 (263) 66 KOG0192 consensus 25.3 11 0.00029 17.4 -1.3 23 71-93 147-170 (362) 67 cd05109 PTKc_HER2 Catalytic Do 25.2 18 0.00045 16.2 -0.3 22 72-93 115-136 (279) 68 cd05098 PTKc_FGFR1 Catalytic D 24.9 19 0.00047 16.1 -0.2 22 72-93 146-167 (307) 69 cd05034 PTKc_Src_like Catalyti 24.9 18 0.00046 16.1 -0.3 22 72-93 109-130 (261) 70 cd05067 PTKc_Lck_Blk Catalytic 24.4 18 0.00046 16.2 -0.4 22 72-93 108-129 (260) 71 cd05086 PTKc_Aatyk2 Catalytic 24.2 19 0.00048 16.1 -0.3 22 72-93 105-126 (268) 72 cd05068 PTKc_Frk_like Catalyti 23.8 20 0.0005 15.9 -0.3 28 72-100 109-136 (261) 73 cd05077 PTK_Jak1_rpt1 Pseudoki 23.4 23 0.00059 15.5 0.0 22 72-93 111-132 (262) 74 pfam01040 UbiA UbiA prenyltran 23.3 51 0.0013 13.5 9.7 46 189-234 128-174 (258) 75 cd05089 PTKc_Tie1 Catalytic Do 23.2 19 0.00048 16.1 -0.5 32 199-230 254-285 (297) 76 cd05070 PTKc_Fyn_Yrk Catalytic 23.2 21 0.00054 15.8 -0.2 22 72-93 108-129 (260) 77 cd05054 PTKc_VEGFR Catalytic D 23.1 16 0.0004 16.5 -0.9 21 73-93 180-200 (337) 78 cd05051 PTKc_DDR Catalytic Dom 22.9 23 0.00058 15.5 -0.1 22 72-93 136-157 (296) 79 cd05100 PTKc_FGFR3 Catalytic D 22.3 20 0.00052 15.8 -0.4 33 201-233 274-308 (334) 80 TIGR01437 selA_rel pyridoxal p 22.2 53 0.0014 13.4 2.2 33 159-191 124-157 (391) 81 cd05042 PTKc_Aatyk Catalytic D 22.2 20 0.00051 15.9 -0.5 22 72-93 106-127 (269) 82 PRK13852 type IV secretion sys 22.1 54 0.0014 13.4 2.7 41 1-41 1-41 (295) 83 cd05093 PTKc_TrkB Catalytic Do 22.0 24 0.0006 15.5 -0.2 22 72-93 126-147 (288) 84 cd05040 PTKc_Ack_like Catalyti 21.9 22 0.00056 15.7 -0.4 22 72-93 103-124 (257) 85 cd05041 PTKc_Fes_like Catalyti 21.8 21 0.00054 15.8 -0.4 22 72-93 99-120 (251) 86 cd05057 PTKc_EGFR_like Catalyt 21.5 25 0.00064 15.3 -0.1 22 72-93 115-136 (279) 87 cd05043 PTK_Ryk Pseudokinase D 21.5 24 0.00061 15.4 -0.2 22 72-93 123-144 (280) 88 pfam07714 Pkinase_Tyr Protein 21.2 20 0.00052 15.8 -0.6 22 72-93 108-129 (258) 89 cd05047 PTKc_Tie Catalytic Dom 21.0 21 0.00053 15.8 -0.6 22 72-93 118-139 (270) 90 cd05104 PTKc_Kit Catalytic Dom 20.7 30 0.00075 14.9 0.1 22 72-93 220-241 (375) 91 cd05610 STKc_MASTL STKc_MASTL: 20.7 28 0.00072 15.0 0.0 22 72-93 110-131 (669) 92 cd05090 PTKc_Ror1 Catalytic Do 20.6 25 0.00063 15.4 -0.3 22 72-93 130-151 (283) 93 cd05614 STKc_MSK2_N STKc_MSK2_ 20.5 33 0.00084 14.6 0.3 21 73-93 112-132 (332) 94 cd05045 PTKc_RET Catalytic Dom 20.5 29 0.00073 15.0 -0.0 21 73-93 129-149 (285) 95 cd05095 PTKc_DDR2 Catalytic Do 20.4 19 0.00049 16.0 -0.9 22 72-93 136-157 (296) 96 cd05631 STKc_GRK4 STKc_GRK4: S 20.3 40 0.001 14.1 0.7 21 73-93 109-129 (285) 97 KOG1024 consensus 20.3 34 0.00085 14.6 0.3 41 53-93 372-423 (563) 98 cd05626 STKc_LATS2 STKc_LATS2: 20.2 39 0.00099 14.2 0.6 21 73-93 108-128 (381) 99 cd05091 PTKc_Ror2 Catalytic Do 20.1 31 0.00079 14.8 0.1 22 72-93 130-151 (283) 100 cd05110 PTKc_HER4 Catalytic Do 20.1 30 0.00076 14.9 0.0 22 72-93 115-136 (303) 101 smart00219 TyrKc Tyrosine kina 20.1 26 0.00066 15.2 -0.3 22 72-93 109-130 (258) No 1 >PRK10581 geranyltranstransferase; Provisional Probab=100.00 E-value=0 Score=412.17 Aligned_cols=229 Identities=38% Similarity=0.618 Sum_probs=202.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH Q ss_conf 48999999999999999999997675302457157999998750-58600799999999996178822224024688889 Q gi|254781111|r 4 GLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIECI 82 (237) Q Consensus 4 ~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~~~~~~~AaavEll 82 (237) +|++++++..++|++.|+++++.. ...+..++++|+|.+ .||||+||.||+++++++|++.+.++++|+|||++ T Consensus 2 ~f~~~~~~~~~~~~~~l~~~~~~~-----~~~~~~l~~a~~y~~~~GGKRlRP~L~ll~~~~~g~~~~~~~~~A~AiEli 76 (299) T PRK10581 2 DFPQQLQACVKQANQALSRFIAPL-----PFQNTPVVEAMQYGALLGGKRLRPFLVYATGQMFGVSTNTLDAPAAAVECI 76 (299) T ss_pred CHHHHHHHHHHHHHHHHHHHCCCC-----CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH T ss_conf 879999999999999999863535-----789726999999898479660879999999998399867789999999999 Q ss_pred HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 9999864776544532234455665432434520133222233479999731023-412678888876532223566411 Q gi|254781111|r 83 HCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQ-LKDNIRSQLMLSLTHNIGLQGMLG 161 (237) Q Consensus 83 H~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~ 161 (237) |+||||||||||||+|++|||+||+|++||++.|||+||+|++++|+++++...+ .........+..++.+.+..+++. T Consensus 77 H~aSLIHDDIp~iD~s~~RRG~pt~h~~~G~~~AIlaGD~L~~~a~~ll~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~ 156 (299) T PRK10581 77 HAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDAPMPEVADRDRISMISELASASGIAGMCG 156 (299) T ss_pred HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99898971840125886548987724334852467730289999999997189965326889999999999988988620 Q ss_pred CCCCCCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---C Q ss_conf 332221000--000367999999986348999999999975988-8999999999999849999986765344320---6 Q gi|254781111|r 162 GQMLDIQDE--FIDETQVFMIQKMKTGALMCFACESGAIMAHAS-QNEKERLRCFGENLGIIFQLADDLLDCEEDL---P 235 (237) Q Consensus 162 GQ~~dl~~~--~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~-~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~---~ 235 (237) ||.+|+... ..+.+.|.+|+++|||+||.+||.+|++++|.+ ++..+.+.+||.++|+||||+||+||++||. | T Consensus 157 GQ~lDl~~~~~~~~~~~~~~i~~~KTa~Lf~~a~~~gai~ag~~~~~~~~~l~~~g~~lGiAFQI~DDlLD~~gd~~~~G 236 (299) T PRK10581 157 GQALDLEAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDRYAESIGLAFQVQDDILDVVGDTATLG 236 (299) T ss_pred HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHC T ss_conf 18999985237999999999999999999999999999984999899999999999998899998645777038989979 Q ss_pred CC Q ss_conf 79 Q gi|254781111|r 236 KK 237 (237) Q Consensus 236 k~ 237 (237) |. T Consensus 237 K~ 238 (299) T PRK10581 237 KR 238 (299) T ss_pred CC T ss_conf 99 No 2 >PRK10888 octaprenyl diphosphate synthase; Provisional Probab=100.00 E-value=0 Score=375.49 Aligned_cols=213 Identities=24% Similarity=0.399 Sum_probs=181.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH Q ss_conf 8999999999999999999997675302457157999998750-586007999999999961788222240246888899 Q gi|254781111|r 5 LPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIH 83 (237) Q Consensus 5 l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~~~~~~~AaavEllH 83 (237) +.+.+++..++|++.|.+. +.+ ..+.+.++.+|.+ .||||+||.|++++++++|++.++++++|+++|++| T Consensus 6 i~~~v~~dl~~v~~~l~~~-------~~~-~~~~i~~~~~~~~~~GGKRlRP~l~ll~~~~~g~~~~~~~~~AaaiEliH 77 (323) T PRK10888 6 INELTAQDMAGVNAAILEQ-------LNS-DVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQGNAHVTIAALIEFIH 77 (323) T ss_pred HHHHHHHHHHHHHHHHHHH-------HCC-CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH T ss_conf 9999999999999999998-------668-81889999999882698608599999999982998388999999999999 Q ss_pred HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 99986477654453223445566543243452013322223347999973102341267888887653222356641133 Q gi|254781111|r 84 CYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQ 163 (237) Q Consensus 84 ~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ 163 (237) +|||||||| ||+|++|||+||+|.+||++.||++||||++.+|++++..+.. +.+..++.+. ..+++|| T Consensus 78 ~asLiHDDi--iD~s~~RRG~pt~h~~~G~~~AIl~GD~l~~~a~~~l~~~~~~-------~~~~~~~~~~--~~~~eGe 146 (323) T PRK10888 78 TATLLHDDV--VDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSL-------KVLEVMSEAV--NVIAEGE 146 (323) T ss_pred HHHHHHCCC--CCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCH-------HHHHHHHHHH--HHHHHHH T ss_conf 999987465--6799888998540133044216762029998888866512766-------8999999999--9999688 Q ss_pred CCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CC Q ss_conf 222100---00003679999999863489999999999759888999999999999849999986765344320---67 Q gi|254781111|r 164 MLDIQD---EFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL---PK 236 (237) Q Consensus 164 ~~dl~~---~~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~---~k 236 (237) .+|+.+ ...++++|++|+.+|||+||++||++|++++|++++....+.+||+++|+||||+||+||++||. || T Consensus 147 ~~q~~~~~~~~~~~~~yl~~i~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~AFQI~DDlLD~~gd~~~~GK 225 (323) T PRK10888 147 VLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEQLGK 225 (323) T ss_pred HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCC T ss_conf 9999854278999999999999999999999999999870999999999999999999999999975202478788689 No 3 >COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Probab=100.00 E-value=0 Score=371.03 Aligned_cols=217 Identities=42% Similarity=0.634 Sum_probs=189.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC-CCCHHHHHHHHHHHHHCCCCCC----CCCCHHHH Q ss_conf 489999999999999999999976753024571579999987505-8600799999999996178822----22402468 Q gi|254781111|r 4 GLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALL-GGKKIRSFLVTECASLFNVNHL----TALRVGAA 78 (237) Q Consensus 4 ~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l~-gGKr~R~~l~l~~~~~~~~~~~----~~~~~Aaa 78 (237) .+...+.+...+|++.|++.+.. ..++.+.+++.|.+. ||||+||.++++++++++.+.+ +++++|++ T Consensus 2 ~~~~~~~~~~~~i~~~L~~~l~~-------~~~~~l~~a~~~~~~aGGKrlRP~l~l~~~~~~~~~~~~~~~~~~~~a~a 74 (322) T COG0142 2 DLLALLLKRLARIEELLSELLSG-------SDPELLLEAMRYLLLAGGKRLRPLLVLLAAEALGIDLETGGNDALDLAAA 74 (322) T ss_pred CHHHHHHHHHHHHHHHHHHHCCC-------CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHH T ss_conf 17899999999999999987175-------66388999999754068700889999999987698643230789999999 Q ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 88899999864776544532234455665432434520133222233479999731023412678888876532223566 Q gi|254781111|r 79 IECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQG 158 (237) Q Consensus 79 vEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 158 (237) ||++|++||||||| ||+|++|||+||+|.+||++.||++||+|++.+|+++++.... ....+..++. +..+ T Consensus 75 vEliH~~SLiHDDv--mD~s~~RRG~pt~~~~~g~~~AIlaGD~L~~~Af~~l~~~~~~-----~~~~~~~~~~--~~~~ 145 (322) T COG0142 75 IELIHTASLIHDDL--MDDDDLRRGKPTVHAKFGEATAILAGDALLAAAFELLSKLGSE-----ALEAIKALAE--AING 145 (322) T ss_pred HHHHHHHHHHHHHH--CCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCC-----HHHHHHHHHH--HHHH T ss_conf 99999999998651--1488643789756667362379999899999999999875852-----2799999999--9999 Q ss_pred HHCCCCCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--- Q ss_conf 4113322210000--00367999999986348999999999975988899999999999984999998676534432--- Q gi|254781111|r 159 MLGGQMLDIQDEF--IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED--- 233 (237) Q Consensus 159 l~~GQ~~dl~~~~--~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D--- 233 (237) +++||.+|+.+.. +|+++|++|+++|||+||++++.+|+++++++++..+.+.+||.++|+||||+|||||++|| T Consensus 146 ~~~GQ~lDl~~~~~~~t~e~y~~~i~~KTa~L~~~a~~~ga~la~~~~~~~~~l~~~g~~lGlaFQi~DDiLD~~~d~~~ 225 (322) T COG0142 146 LCGGQALDLAFENKPVTLEEYLRVIELKTAALFAAAAVLGAILAGADEELLEALEDYGRNLGLAFQIQDDILDITGDEEE 225 (322) T ss_pred HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH T ss_conf 97728999866788999999999999989999999999999981998999999999999877888867747750587276 Q ss_pred HCC Q ss_conf 067 Q gi|254781111|r 234 LPK 236 (237) Q Consensus 234 ~~k 236 (237) .|| T Consensus 226 lGK 228 (322) T COG0142 226 LGK 228 (322) T ss_pred HCC T ss_conf 289 No 4 >CHL00151 preA prenyl transferase; Reviewed Probab=100.00 E-value=0 Score=368.03 Aligned_cols=217 Identities=27% Similarity=0.387 Sum_probs=184.5 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC-CCCHHHHHHHHHHHHHCCCCCCCCC---CHHH Q ss_conf 83489999999999999999999976753024571579999987505-8600799999999996178822224---0246 Q gi|254781111|r 2 NGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALL-GGKKIRSFLVTECASLFNVNHLTAL---RVGA 77 (237) Q Consensus 2 ~~~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l~-gGKr~R~~l~l~~~~~~~~~~~~~~---~~Aa 77 (237) ++.+.+.+++..++|++.|.+.+. +. .+.+.++++|.+. ||||+||.|++++++++|++.+... .+|+ T Consensus 4 ~~~i~~~i~~~l~~ve~~l~~~l~-------s~-~~~l~~a~~y~~~~gGKRlRP~L~ll~~~~~g~~~~~~~~~~~~A~ 75 (288) T CHL00151 4 NFKLLAPVEEDLESVEKNLKKLIG-------TR-HPILSAAARHLFSAGGKRIRPAIVLLVAKATGGNQEIAPPQRRLAE 75 (288) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHC-------CC-CHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHH T ss_conf 488899999999999999998827-------99-6699999999986599728699999999981998001066899999 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 88889999986477654453223445566543243452013322223347999973102341267888887653222356 Q gi|254781111|r 78 AIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQ 157 (237) Q Consensus 78 avEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 157 (237) ++|++|+|||||||| ||+|++|||+||+|++||++.||++||+|++.+|+++++.............+ . T Consensus 76 avEliH~aSLIHDDi--~D~s~~RRG~pt~h~~~G~~~AIL~GD~L~~~a~~~la~~~~~~~~~~~~~~i---------~ 144 (288) T CHL00151 76 ITEMIHTASLVHDDV--VDEDSTRRGVPTVHKRFGTKIAVLAGDFLFAQSSWYLANLNNLEVVKLISKVI---------T 144 (288) T ss_pred HHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH---------H T ss_conf 999999999984677--89986668986532441438999998899999999976046325689999999---------9 Q ss_pred HHHCCCCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 64113322210---000003679999999863489999999999759888999999999999849999986765344320 Q gi|254781111|r 158 GMLGGQMLDIQ---DEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 158 ~l~~GQ~~dl~---~~~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) .++.||..+.. ....++++|++|+.+|||+||++||.+|++++|++++..+.+.+||+++|+||||+||+||++||. T Consensus 145 ~l~~g~~~~~~~~~~~~~~~~~y~~~~~~KTa~Lf~~a~~~gailaga~~~~~~~l~~~G~~lG~AFQI~DDlLD~~gd~ 224 (288) T CHL00151 145 DLAEGEIRQGLVQFDTTLSTLEYIEKSFYKTASLLAASCKAAALLSDADEELLNDLYLYGKHLGLAFQIIDDILDITGST 224 (288) T ss_pred HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCH T ss_conf 99988898776425888789999999985207999999999999809999999999998641311455349754035898 Q ss_pred ---CCC Q ss_conf ---679 Q gi|254781111|r 235 ---PKK 237 (237) Q Consensus 235 ---~k~ 237 (237) ||. T Consensus 225 ~~~GK~ 230 (288) T CHL00151 225 ESLGKP 230 (288) T ss_pred HHHCCC T ss_conf 997899 No 5 >pfam00348 polyprenyl_synt Polyprenyl synthetase. Probab=100.00 E-value=0 Score=370.06 Aligned_cols=195 Identities=40% Similarity=0.605 Sum_probs=172.7 Q ss_pred HHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCH Q ss_conf 999998750-5860079999999999617882222402468888999998647765445322344556654324345201 Q gi|254781111|r 39 LLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAI 117 (237) Q Consensus 39 l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AI 117 (237) ++++|+|.+ .||||+||.|++++++++|++.+.++++|+++|++|+|||||||| ||+|++|||+||+|.+||++.|| T Consensus 1 l~~am~y~~~~gGKrlRp~L~l~~~~~~g~~~~~~~~~A~avEllH~aSLIHDDI--~D~s~~RRG~pt~h~~~G~~~Ai 78 (260) T pfam00348 1 LLAAMLYYLLAGGKRIRPLLVVLAARALGVEPETLLYLACAIEMIHTASLVHDDL--MDNSDLRRGKPTCHKKFGEAGAI 78 (260) T ss_pred CHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCHHHCCHHHHH T ss_conf 9788998871893408999999999982998889999999999999999995332--46998779998602231117899 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3322223347999973102341267888887653222356641133222100--00003679999999863489999999 Q gi|254781111|r 118 IAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQD--EFIDETQVFMIQKMKTGALMCFACES 195 (237) Q Consensus 118 l~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~--~~~~~~~y~~i~~~KTa~lf~~~~~~ 195 (237) ++||+|++.+|+++++.....+ ......+...+......++. ||.+|+.. ...++++|++|+++|||+||.+||.+ T Consensus 79 l~GD~L~~~a~~~l~~~~~~~~-~~~~~~i~~~~~~~~~~g~~-gQ~~d~~~~~~~~s~~~y~~~~~~KTa~Lf~~~~~~ 156 (260) T pfam00348 79 LAGDALLSRAFQLLALLGHVRP-EPKYILISELANAVGAQGEV-GQLMDLETEGKDITLEEYLRIVSYKTAALFYASVQL 156 (260) T ss_pred HHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9758999999999986579983-99999999999999999999-999987567889999999999999759999999999 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CCC Q ss_conf 999759888999999999999849999986765344320---679 Q gi|254781111|r 196 GAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL---PKK 237 (237) Q Consensus 196 ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~---~k~ 237 (237) |++++|++++..+.+.+||.++|++|||+||+||++||. ||. T Consensus 157 gailag~~~~~~~~l~~~g~~lGiaFQi~DDiLD~~gd~~~~GK~ 201 (260) T pfam00348 157 GAIVAGADEEDEKDLYDFGRDLGLAFQIQDDILDLTGDTEELGKP 201 (260) T ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHCCCC T ss_conf 999819999999999999987368999899764144898770999 No 6 >cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-tail (HT) (1'-4) condensation reactions. This CD includes all-trans (E)-isoprenyl diphosphate synthases which synthesis various chain length (C10, C15, C20, C25, C30, C35, C40, C45, and C50) linear isoprenyl diphosphates from precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). They catalyze the successive 1'-4 condensation of the 5-carbon IPP to allylic substrates geranyl-, farnesyl-, or geranylgeranyl-diphosphate. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DDXX(XX)D) located on opposite walls. These residues mediate binding of pre Probab=100.00 E-value=0 Score=368.99 Aligned_cols=193 Identities=40% Similarity=0.594 Sum_probs=173.2 Q ss_pred CHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 157999998750-5860079999999999617882-22240246888899999864776544532234455665432434 Q gi|254781111|r 36 NDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNH-LTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDE 113 (237) Q Consensus 36 ~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~-~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~ 113 (237) .+.+.++++|.+ .||||+||.|++++++++++++ +.++++|+++|++|+|||||||| ||+|++|||+||+|.+||+ T Consensus 3 ~~~l~~~~~y~~~~gGKrlRp~l~ll~~~~~~~~~~~~~~~~A~aiEliH~asLiHDDi--iD~s~~RRG~pt~h~~~g~ 80 (298) T cd00685 3 VELLREALRYLLLAGGKRLRPLLVLLAARALGGPELEAALRLAAAIELLHTASLVHDDV--MDNSDLRRGKPTVHKVFGN 80 (298) T ss_pred CHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCCCCCCCHHHHCCC T ss_conf 38999999988638974387999999999819995688999999999999999998241--0586545899878887299 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH---HHHHHHHHHHHHHHHHHHHH Q ss_conf 520133222233479999731023412678888876532223566411332221000---00036799999998634899 Q gi|254781111|r 114 VTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDE---FIDETQVFMIQKMKTGALMC 190 (237) Q Consensus 114 ~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~---~~~~~~y~~i~~~KTa~lf~ 190 (237) +.|||+||||++.+|+++++.... ...+++..++++ ...++.||.+|+.+. .+++++|++|+.+|||+||. T Consensus 81 ~~AIl~GD~l~~~a~~~l~~~~~~----~~~~~~~~~~~~--~~~~~~Gq~~d~~~~~~~~~~~~~y~~~~~~KTa~l~~ 154 (298) T cd00685 81 ATAILAGDYLLARAFELLARLGNP----YYPRALELFSEA--ILELVEGQLLDLLSEYDTDVTEEEYLRIIRLKTAALFA 154 (298) T ss_pred CCCHHHHHHHHHHHHHHHHHCCCC----CHHHHHHHHHHH--HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH T ss_conf 644148899999999999867992----209999999999--99998888999863789999999999999999999999 Q ss_pred HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CC Q ss_conf 99999999759888999999999999849999986765344320---67 Q gi|254781111|r 191 FACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL---PK 236 (237) Q Consensus 191 ~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~---~k 236 (237) ++|.+|+++++++++..+.+.+||.++|++|||+||++|++||. || T Consensus 155 ~~~~~ga~~~~~~~~~~~~l~~~g~~lG~aFQi~DD~ld~~g~~~~~GK 203 (298) T cd00685 155 AAPLLGALLAGADEEEAEALKRFGRNLGLAFQIQDDILDLFGDPETLGK 203 (298) T ss_pred HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCC T ss_conf 9999999983999999999999988768999999998742289788599 No 7 >TIGR02749 prenyl_cyano solanesyl diphosphate synthase; InterPro: IPR014120 This entry contains solanesyl diphosphate synthases from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterised by heterologous expression as a solanesyl diphosphate synthase.. Probab=100.00 E-value=0 Score=350.14 Aligned_cols=219 Identities=24% Similarity=0.301 Sum_probs=192.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCC------CCCCCHHHHHHH Q ss_conf 999999999999999997675302457157999998750-5860079999999999617882------222402468888 Q gi|254781111|r 9 LQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNH------LTALRVGAAIEC 81 (237) Q Consensus 9 l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~------~~~~~~AaavEl 81 (237) ..+....|+..|+.+-.+++...-..+| .+..+-.|.. .||||+||.+|++++++.-.+. ..-=++|-++|+ T Consensus 3 ~~~l~~pVe~dL~~l~~NLk~lvGa~HP-iL~AAAEHLF~AGGKR~RPaiVLLvSrAT~~~~GlkElt~~HRRLAEITEm 81 (325) T TIGR02749 3 ATSLFAPVEDDLELLTDNLKSLVGARHP-ILYAAAEHLFSAGGKRLRPAIVLLVSRATAEEQGLKELTARHRRLAEITEM 81 (325) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHH T ss_conf 6788899999999999877873145686-789999998715896540689999999988736663576103531336867 Q ss_pred HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999864776544532234455665432434520133222233479999731023412678888876532223566411 Q gi|254781111|r 82 IHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLG 161 (237) Q Consensus 82 lH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 161 (237) ||+|||||||| +|+|++|||.||+|..||+.+|||+|||||++|-=+|++.++...-++...+|..+++.... T Consensus 82 IHTASLVHDDV--~DEsd~RRG~~TVhs~F~trvAVLAGDFLFAQaSWYLANLenLEVVKLls~VI~DFAEGEI~----- 154 (325) T TIGR02749 82 IHTASLVHDDV--IDESDVRRGVETVHSLFGTRVAVLAGDFLFAQASWYLANLENLEVVKLLSKVITDFAEGEIK----- 154 (325) T ss_pred HHHHHHHCCCE--ECCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHH----- T ss_conf 75232220220--03543448885534568481676204067899999986167721001454787564117888----- Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCC Q ss_conf 332221000000367999999986348999999999975988899999999999984999998676534432---067 Q gi|254781111|r 162 GQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED---LPK 236 (237) Q Consensus 162 GQ~~dl~~~~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D---~~k 236 (237) |.+.-.+-..+.|+|++-..||||||.+.+|+.+|+++..+.+.++.|+.||+++|+||||.|||||++|. +|| T Consensus 155 -Qg~~~FD~d~~le~YleKSyYKTASL~AaSskaAAvLS~~~~~v~n~LY~yGkhLGLAFQvvDDiLDFTgsTe~LGK 231 (325) T TIGR02749 155 -QGLNRFDSDLSLEDYLEKSYYKTASLVAASSKAAAVLSDVDSKVANDLYEYGKHLGLAFQVVDDILDFTGSTEQLGK 231 (325) T ss_pred -HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCC T ss_conf -65552578878887665644678999999989988851143899999877656616335445545157788511567 No 8 >TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II; InterPro: IPR014119 The proteins in this entry are component II of the heterodimeric heptaprenyl diphosphate synthase. They are found proximate to the gene for component I (IPR009920 from INTERPRO). This enzyme acts in menaquinone-7 isoprenoid side chain biosynthesis.. Probab=100.00 E-value=0 Score=342.75 Aligned_cols=215 Identities=29% Similarity=0.421 Sum_probs=187.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHH Q ss_conf 48999999999999999999997675302457157999998750-586007999999999961-7882222402468888 Q gi|254781111|r 4 GLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLF-NVNHLTALRVGAAIEC 81 (237) Q Consensus 4 ~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~-~~~~~~~~~~AaavEl 81 (237) .+-+.|++....||+.|++.+. .-..+.+.|+--+.+ .||||+||.+++++++.. +.+-+..-.+|.++|| T Consensus 4 ~~Y~~l~~Di~~iE~EL~~~v~-------Ga~~~~l~eA~l~LL~AGGKRIRPVFVLLag~fGP~Ydl~~~K~vAV~LEL 76 (325) T TIGR02748 4 DIYSFLQKDIESIEKELEKAVQ-------GAEHPVLSEAALHLLKAGGKRIRPVFVLLAGKFGPDYDLDKIKHVAVALEL 76 (325) T ss_pred HHHHHHHHHHHHHHHHHHHHHH-------HCCCCCHHHHHHHHHHCCCCEEHHHHHHHHHHCCCCCCHHHHHHHHHHHHH T ss_conf 8899988769999999999985-------206873578999999818940017999867630775335546567655767 Q ss_pred HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999864776544532234455665432434520133222233479999731023412678888876532223566411 Q gi|254781111|r 82 IHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLG 161 (237) Q Consensus 82 lH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 161 (237) ||-|||||||| ||++++|||+||+..+||+..|--+|||||+.|++.+.+-..+....+.+..+.+ +|. T Consensus 77 IHMASLVHDDV--ID~A~LRRG~~Ti~skW~NRiAMYTGDYlfA~slE~~t~i~dp~~H~~LS~tivE---------vc~ 145 (325) T TIGR02748 77 IHMASLVHDDV--IDDADLRRGKPTIKSKWDNRIAMYTGDYLFAKSLETMTEIKDPRAHQILSKTIVE---------VCL 145 (325) T ss_pred HHCCCCCCCCC--CCCCCCCCCCHHHCCCCCCEEEEHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH---------HHH T ss_conf 73532025652--0587677884201210277322003358999999998516982788999999998---------862 Q ss_pred CCCCCCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HC Q ss_conf 3322210000---00367999999986348999999999975988899999999999984999998676534432---06 Q gi|254781111|r 162 GQMLDIQDEF---IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED---LP 235 (237) Q Consensus 162 GQ~~dl~~~~---~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D---~~ 235 (237) |+.-+|.+++ .+.-.|++-|++|||=|++.+|++||+.||++++..+.|..||+.+||+|||.|||||+.|- +| T Consensus 146 GEIEQIkDkYN~dQ~lR~YLRRIKRKTALLIA~SCqLGAia~Ga~~~~~~~LY~FGYYvGMSyQI~DDiLDFvgTee~LG 225 (325) T TIGR02748 146 GEIEQIKDKYNFDQNLRTYLRRIKRKTALLIAASCQLGAIASGADEAIVKKLYWFGYYVGMSYQIIDDILDFVGTEEELG 225 (325) T ss_pred CCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 21010010137888600366566688999999877652000588987877365533542014544432136646631168 Q ss_pred C Q ss_conf 7 Q gi|254781111|r 236 K 236 (237) Q Consensus 236 k 236 (237) | T Consensus 226 K 226 (325) T TIGR02748 226 K 226 (325) T ss_pred C T ss_conf 8 No 9 >KOG0776 consensus Probab=100.00 E-value=0 Score=330.81 Aligned_cols=205 Identities=30% Similarity=0.467 Sum_probs=187.8 Q ss_pred HHHHHCCC-CCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC Q ss_conf 67530245-7157999998750-5860079999999999617-8822224024688889999986477654453223445 Q gi|254781111|r 27 TASHMQTQ-HNDRLLSAIRYAL-LGGKKIRSFLVTECASLFN-VNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRG 103 (237) Q Consensus 27 ~~~~~~~~-~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~-~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG 103 (237) ....++.. .+..+.++++|.+ .+|||+||.+|+..|++.+ +......++|+++|++|++||||||+||||++++||| T Consensus 82 l~~~~~~~~~~~~i~~a~ry~~la~gKr~rP~l~~~~~e~~~~g~~~~q~~~A~i~EMIHtaSLIHDDv~~mD~~d~RRG 161 (384) T KOG0776 82 LHYAVPLANEPLLISEAMRYLLLAGGKRVRPLLCLAACELVGSGDESSQRSLAEIVEMIHTASLIHDDVPCMDDADLRRG 161 (384) T ss_pred HHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC T ss_conf 33312345665025788888887315505745654577760566507788899999999999998437544464311268 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH Q ss_conf 56654324345201332222334799997310234126788888765322235664113322210000003679999999 Q gi|254781111|r 104 KPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKM 183 (237) Q Consensus 104 ~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~~~~~~~y~~i~~~ 183 (237) +||.|++||+.+|||+||+|++.|++.++...++...+.....+.++.+..+.++...||.+|... ...++|..+..+ T Consensus 162 kpt~h~vfG~k~AvLaGD~LLa~A~~~la~l~n~~v~elm~~aI~dLv~ge~~~~~~~~~~~d~~~--~~~e~~e~~~~~ 239 (384) T KOG0776 162 KPTNHKVFGNKMAVLAGDALLALASEHLASLENPVVVELMASAIADLVRGEFTQGLVAGEGLDLDD--VGLEYLEFKTLL 239 (384) T ss_pred CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC--CCHHHHHHHHHH T ss_conf 876311203025544337899999999986168618999999999999766202445554445677--536889999999 Q ss_pred HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 86348999999999975988899999999999984999998676534432 Q gi|254781111|r 184 KTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED 233 (237) Q Consensus 184 KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D 233 (237) |||+|++.+|++|++++|.++++++.+++||+++|++||+.||++|++.. T Consensus 240 KTAsLla~Sc~~~aILgg~s~ev~e~~~~yGR~lGL~fQvvDDildftks 289 (384) T KOG0776 240 KTASLLAKSCVAAAILGGGSEEVIEAAFEYGRCLGLAFQVVDDILDFTKS 289 (384) T ss_pred HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC T ss_conf 89989999999999872899999999999988889899986214475433 No 10 >cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) of class 1 isoprenoid biosynthesis enzymes which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, diterpenes, ubiquinone, and archaeal ether linked lipids; and are widely distributed among archaea, bacteria, and eukareya. The enzymes in this family share the same 'isoprenoid synthase fold' and include the head-to-tail (HT) IPPS which catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. The head-to-head (HH) IPPS catalyze t Probab=100.00 E-value=2.8e-45 Score=285.26 Aligned_cols=171 Identities=35% Similarity=0.548 Sum_probs=154.5 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHH Q ss_conf 7999999999961788222240246888899999864776544532234455665432-434520133222233479999 Q gi|254781111|r 53 IRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQ-YDEVTAIIAGNGLLTYAFEII 131 (237) Q Consensus 53 ~R~~l~l~~~~~~~~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~-~G~~~AIl~Gd~l~~~a~~~l 131 (237) +||.+++++++++|++.+.++++|+++|++|++||||||| ||+++.|||+||+|.+ ||.+.||++||++++.+|+.+ T Consensus 1 ~Rp~l~~~~~~~~g~~~~~~~~~a~avElih~~slihDDi--~D~~~~RRg~~t~~~~~~g~~~ail~gd~l~~~a~~~l 78 (236) T cd00867 1 SRPLLVLLLARALGGDLEAALRLAAAVELLHAASLVHDDI--VDDSDLRRGKPTAHLRRFGNALAILAGDYLLARAFQLL 78 (236) T ss_pred CCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHCHHHHHHHHHHHHHHHHHHH T ss_conf 9659999999983988889999999999999999997753--36997778986568886055789997209999999998 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH Q ss_conf 731023412678888876532223566411332221000---00036799999998634899999999997598889999 Q gi|254781111|r 132 SSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDE---FIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKE 208 (237) Q Consensus 132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~---~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~ 208 (237) ++.... +.+..+.+. ...++.||.+|+.+. ..++++|++|+++|||+||.++|.+++++++.+++..+ T Consensus 79 ~~~~~~-------~~~~~~~~~--~~~l~~Gq~~Dl~~~~~~~~t~~~~~~~~~~KTa~l~~~~~~~~a~~~~~~~~~~~ 149 (236) T cd00867 79 ARLGYP-------RALELFAEA--LRELLEGQALDLEFERDTYETLDEYLEYCRYKTAGLVGLLCLLGAGLSGADDEQAE 149 (236) T ss_pred HHCCCH-------HHHHHHHHH--HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH T ss_conf 623878-------999999999--99999988999760478889999999999988699999999999998198999999 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999849999986765344320 Q gi|254781111|r 209 RLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 209 ~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) .+.+||+++|+||||.||++|++||. T Consensus 150 ~l~~~g~~lG~AfQi~DDllD~~~d~ 175 (236) T cd00867 150 ALKDYGRALGLAFQLTDDLLDVFGDA 175 (236) T ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCH T ss_conf 99999999999999999998840896 No 11 >KOG0777 consensus Probab=100.00 E-value=1.1e-36 Score=235.08 Aligned_cols=185 Identities=30% Similarity=0.360 Sum_probs=159.3 Q ss_pred HCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC Q ss_conf 02457157999998750-58600799999999996178822224024688889999986477654453223445566543 Q gi|254781111|r 31 MQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHI 109 (237) Q Consensus 31 ~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~ 109 (237) ....+.+.+.+|..|.+ .|||.+|..|.+++.+|+..+.++.-.+.-+||++|++||..|||+ |+|++|||.|++|. T Consensus 15 tq~~~~~ill~Py~yilq~PGKqfR~~L~~afNhwl~~P~dkLaii~~ivemLHNsSLLIDDIE--DNs~LRRG~pvaHs 92 (322) T KOG0777 15 TQSQNESILLKPYNYILQKPGKQFRLNLIVAFNHWLNLPKDKLAIISQIVEMLHNSSLLIDDIE--DNSPLRRGQPVAHS 92 (322) T ss_pred HHHHHHHHHHCHHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEEECCCC--CCCHHHCCCCCHHH T ss_conf 3778889985528899847408899999999999982979899999999999822430211123--36422168722112 Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHH----HHHHHHHHHHHHHH Q ss_conf 24345201332222334799997310234126788888765322235664113322210000----00367999999986 Q gi|254781111|r 110 QYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEF----IDETQVFMIQKMKT 185 (237) Q Consensus 110 ~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~~----~~~~~y~~i~~~KT 185 (237) .||++..||+++|+|+++.+.+++...+ +. +..+++. +.+++.||.+|+.|+. +|++.|..|+..|| T Consensus 93 IyGvpStINtANY~yFlalekV~qLdhP--~a-----~kifteq--LleLHrGQGldIYWRD~~tcPtee~Yk~Mv~~KT 163 (322) T KOG0777 93 IYGVPSTINTANYMYFLALEKVSQLDHP--NA-----IKIFTEQ--LLELHRGQGLDIYWRDFLTCPTEEMYKNMVMNKT 163 (322) T ss_pred HCCCCCHHHHHHHHHHHHHHHHHHCCCC--HH-----HHHHHHH--HHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHC T ss_conf 0167421103579999999999723781--18-----8999999--9998527885056211375887899999988741 Q ss_pred HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 348999999999975988899999999999984999998676534 Q gi|254781111|r 186 GALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDC 230 (237) Q Consensus 186 a~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~ 230 (237) |.||+++..+.-..+. ..+.+..+-..+|+.|||+|||+.. T Consensus 164 GGLF~La~rLMqlfS~----~kedl~pl~n~LGl~fQIRDDY~NL 204 (322) T KOG0777 164 GGLFRLALRLMQLFSH----HKEDLVPLINLLGLIFQIRDDYLNL 204 (322) T ss_pred CCHHHHHHHHHHHHHH----CCHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 5679999999999876----3424788999876863004444031 No 12 >KOG0711 consensus Probab=100.00 E-value=5.3e-34 Score=219.37 Aligned_cols=209 Identities=22% Similarity=0.278 Sum_probs=157.5 Q ss_pred HHHHHHHHHHHHCCCC-CHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCC-------CCCCCHHHHHHHHHHHHHHHCC Q ss_conf 9999997675302457-1579999987505860079999999999617882-------2224024688889999986477 Q gi|254781111|r 20 LDDLLLQTASHMQTQH-NDRLLSAIRYALLGGKKIRSFLVTECASLFNVNH-------LTALRVGAAIECIHCYSLIHDD 91 (237) Q Consensus 20 l~~~l~~~~~~~~~~~-~~~l~~~~~y~l~gGKr~R~~l~l~~~~~~~~~~-------~~~~~~AaavEllH~asLihDD 91 (237) +.++.+....+....+ .+.+.+...|.+.|||..|+..++.+.+++.++. ..+..+++.||++|+.+||-|| T Consensus 20 vr~i~~~~~~~~~~~da~~~~~~~L~yN~~GGK~nRgl~vv~s~~~L~~~~~l~~~~~~~a~~lGw~vElLQaffLiaDD 99 (347) T KOG0711 20 VRVLTEDLMAHGESGDATEWLKEVLDYNVIGGKLNRGLSVVDSFKALVEPRKLDEEELQLALILGWCVELLQAFFLVADD 99 (347) T ss_pred HHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999875206897679999999876027675224540489999986577677889999999998999999988987545 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH Q ss_conf 65445322344556654324345-20133222233479999731023412678888876532223566411332221000 Q gi|254781111|r 92 LPSMDNGYIRRGKPTVHIQYDEV-TAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDE 170 (237) Q Consensus 92 I~~~D~s~~RRG~pt~h~~~G~~-~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~ 170 (237) | ||+|.+|||+|||+.+.|++ .|||-+-.|-+-...+|.+.....+- +.+ +.++.+.+.... +.||.++...- T Consensus 100 I--MDnS~tRRGqpCWy~~~gVG~~AINDA~lLea~Iy~lLkk~fr~~~~--y~~-l~elf~ev~f~T-~lGdllt~~~~ 173 (347) T KOG0711 100 I--MDNSKTRRGQPCWYQKPGVGLDAINDAFLLEAAIYKLLKKHFRNIYC--YVD-LVELFHEVTFQT-ELGDLLTTPEG 173 (347) T ss_pred H--HCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCH--HHH-HHHHHHHHHHHH-HHHCCCCCCCC T ss_conf 3--20100237884346668863666508999999999999986268860--788-999887888887-63010147543 Q ss_pred -----HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf -----000367999999986348-9999999999759-888999999999999849999986765344320 Q gi|254781111|r 171 -----FIDETQVFMIQKMKTGAL-MCFACESGAIMAH-ASQNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 171 -----~~~~~~y~~i~~~KTa~l-f~~~~~~ga~lag-~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) ..|++.|..|+++|||.| |.+|..++-++|| .+.+.......+...+|..||++||||||+||- T Consensus 174 ~~~ls~fsl~~y~~Iv~~KTa~YsFYLPialAl~~ag~~~~k~~~~~k~v~~~lg~~FQvQDDYLd~fgDp 244 (347) T KOG0711 174 NKDLSKFSLEKYVFIVEYKTAYYSFYLPVALALLLAGIANLKEHACEKKVLLLLGEYFQVQDDYLDCFGDP 244 (347) T ss_pred CHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCH T ss_conf 30376641777778863131202330189999998423058877568899999988983106777742882 No 13 >cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1; Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, and diterpenes; and are widely distributed among archaea, bacteria, and eukaryota.The enzymes in this superfamily share the same 'isoprenoid synthase fold' and include several subgroups. The head-to-tail (HT) IPPS catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. Cyclic monoter Probab=99.94 E-value=1.7e-27 Score=181.04 Aligned_cols=153 Identities=35% Similarity=0.496 Sum_probs=132.6 Q ss_pred CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH Q ss_conf 40246888899999864776544532234455665432---434520133222233479999731023412678888876 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQ---YDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLS 149 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~---~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~ 149 (237) ...++++|++|++++||||| +|++.+|||+|++|.. ||.+.+++.|+++++.+++.+..... . ..... T Consensus 13 ~~~~~~~~~~~~~~~i~DDi--~D~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~----~~~~~ 83 (243) T cd00385 13 SRLRAAVEKLHAASLVHDDI--VDDSGTRRGLPTAHLAVAIDGLPEAILAGDLLLADAFEELAREGS---P----EALEI 83 (243) T ss_pred HHHHHHHHHHHHHHHHHHCC--CCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC---H----HHHHH T ss_conf 99999999999999999715--669999886385999987048399999999999999999986478---9----99999 Q ss_pred HHHHHHHHHHHCCCCCCCCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 532223566411332221000---00036799999998634899999999997598889999999999998499999867 Q gi|254781111|r 150 LTHNIGLQGMLGGQMLDIQDE---FIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADD 226 (237) Q Consensus 150 ~~~~~~~~~l~~GQ~~dl~~~---~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD 226 (237) +.++ ...++.||.+|+.+. .++.++|.++++.|||.++...+..++..++.+.+....+.++|..+|++||+.|| T Consensus 84 ~~~~--~~~~~~g~~~d~~~~~~~~~s~~~y~~~~~~kta~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~a~ql~nD 161 (243) T cd00385 84 LAEA--LLDLLEGQLLDLKWRREYVPTLEEYLEYCRYKTAGLVGALCLLGAGLSGGEAELLEALRKLGRALGLAFQLTND 161 (243) T ss_pred HHHH--HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999--99999999999986579999999999974228999999999999998099999999999999999999999995 Q ss_pred HHHHHHHHCC Q ss_conf 6534432067 Q gi|254781111|r 227 LLDCEEDLPK 236 (237) Q Consensus 227 ~lD~~~D~~k 236 (237) ++|+++|..+ T Consensus 162 l~d~~~d~~~ 171 (243) T cd00385 162 LLDYEGDAER 171 (243) T ss_pred CCCCCCCCCC T ss_conf 6246848024 No 14 >pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1. This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (EC:2.5.1.30) (approximately 230 residues long). The enzyme consists of two subunits, both of which are required for catalysis of heptaprenyl diphosphate synthesis. Probab=94.54 E-value=0.26 Score=27.00 Aligned_cols=80 Identities=10% Similarity=0.070 Sum_probs=53.0 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHH Q ss_conf 78822224024688889999986477654453223445566543243452013322223347999973102341267888 Q gi|254781111|r 66 NVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQ 145 (237) Q Consensus 66 ~~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~ 145 (237) ..+++.+.....++=|+|.|-..||-| |+....+. ..+ =...-.|++|||.-++-+.+|+..+...--+..+. T Consensus 29 ~~~~~~~~~~i~t~mLvq~aLDTHd~V---~~~~~~~~--~~~--k~RQLtVLAGDyyS~lYY~lLa~~~~i~lIr~la~ 101 (212) T pfam07307 29 ELTPEQAERYILTAMLVQIALDTHDKV---SNANAETQ--ETK--KNRQLTVLAGDYYSGLYYYLLSESGDIALIRLLAE 101 (212) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHH---CCCCCCCC--HHH--HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH T ss_conf 999899999999999999998778764---54231210--355--63103201102331899999983798699999999 Q ss_pred HHHHHHH Q ss_conf 8876532 Q gi|254781111|r 146 LMLSLTH 152 (237) Q Consensus 146 ~~~~~~~ 152 (237) .+..+++ T Consensus 102 ~I~eiNe 108 (212) T pfam07307 102 AIKEINE 108 (212) T ss_pred HHHHHHH T ss_conf 9999999 No 15 >TIGR03464 HpnC squalene synthase HpnC. This family of genes are members of a superfamily (pfam00494) of phytoene and squalene synthases which catalyze the head-t0-head condensation of polyisoprene pyrophosphates. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. In the organisms Zymomonas mobilis and Bradyrhizobium japonicum these genes have been characterized as squalene synthases (farnesyl-pyrophosphate ligases). Often, these genes appear in tandem with the HpnD gene which appears to have resulted from an ancient gene duplication event. Presumably these proteins form a heteromeric complex, but this has not yet been experimentally demonstrated. Probab=94.08 E-value=0.42 Score=25.76 Aligned_cols=72 Identities=10% Similarity=0.082 Sum_probs=47.6 Q ss_pred HHHHCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 664113322210000-0036799999998634899999999997598889999999999998499999867653443206 Q gi|254781111|r 157 QGMLGGQMLDIQDEF-IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLP 235 (237) Q Consensus 157 ~~l~~GQ~~dl~~~~-~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~~ 235 (237) ..++.|+..|+.... .|.+++..-+..--|+...+.+. +++..+++ ...++..+|+|+|+.|=+-|+-.|.. T Consensus 89 ~~li~g~~~Dl~~~~~~t~~dL~~Yc~~vAg~VG~~~~~---i~g~~~~~----~~~~a~~lG~AlQltNilRDi~eD~~ 161 (266) T TIGR03464 89 LDLLDAFRQDVVVTRYATWAELLDYCRRSANPVGRLVLD---LYGASDPE----NVALSDAICTALQLINFWQDVGKDLR 161 (266) T ss_pred HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH---HHCCCCHH----HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999884146799999999999999963899999999---82789888----99999999799999999998587998 No 16 >cd00683 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-head (HH) (1'-1) condensation reaction. This CD includes squalene and phytoene synthases which catalyze the 1'-1 condensation of two 15-carbon (farnesyl) and 20-carbon (geranylgeranyl) isoprenyl diphosphates, respectively. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DXXXD) located on opposite walls. These residues mediate binding of prenyl phosphates. A two-step reaction has been proposed for squalene synthase (farnesyl-diphosphate farnesyltransferase) in which, two molecules of FPP react to form a stable cyclopropylcarbinyl diphosphate intermediate, and then the intermediate undergoes heterolysis, isomerization, and reduction with NADPH to form squalene, a precursor of cholestrol. The carotenoid biosynthesis enzyme, phytoene synthase (CrtB), catalyzes the condensation reaction of two molecules of geranylgeranyl diphosp Probab=94.03 E-value=0.25 Score=27.09 Aligned_cols=73 Identities=19% Similarity=0.188 Sum_probs=48.1 Q ss_pred HHHHCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 664113322210000-0036799999998634899999999997598889999999999998499999867653443206 Q gi|254781111|r 157 QGMLGGQMLDIQDEF-IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLP 235 (237) Q Consensus 157 ~~l~~GQ~~dl~~~~-~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~~ 235 (237) ..++.|+..|+.... .|++++..-+.+-.|+.-.+.+.+ ++..+ .+....++..+|+|+|+.|=+-|+-.|.. T Consensus 96 ~~li~g~~~Dl~~~~~~t~~eL~~Yc~~vAg~VG~l~~~i---~g~~~---~~~~~~~A~~lG~AlQltNilRDi~eD~~ 169 (265) T cd00683 96 RDLLAGMAMDLDKRRYETLDELDEYCYYVAGVVGLMLLRV---FGASS---DEAALERARALGLALQLTNILRDVGEDAR 169 (265) T ss_pred HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH---HCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999987567899999999999997117999999999---58788---18899999998899999989987999995 No 17 >TIGR03465 HpnD squalene synthase HpnD. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. In the organisms Zymomonas mobilis and Bradyrhizobium japonicum these genes have been characterized as squalene synthases (farnesyl-pyrophosphate ligases). Often, these genes appear in tandem with the HpnC gene which appears to have resulted from an ancient gene duplication event. Presumably these proteins form a heteromeric complex, but this has not yet been experimentally demonstrated. Probab=93.93 E-value=0.32 Score=26.48 Aligned_cols=71 Identities=20% Similarity=0.262 Sum_probs=47.6 Q ss_pred HHHCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 64113322210000-0036799999998634899999999997598889999999999998499999867653443206 Q gi|254781111|r 158 GMLGGQMLDIQDEF-IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLP 235 (237) Q Consensus 158 ~l~~GQ~~dl~~~~-~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~~ 235 (237) .++.|+..|+.... .|.+++..-+..--|+...+++. +++..+++ ...++..+|+|+|+.+=+-|+-.|.. T Consensus 89 ~li~g~~~Dl~~~~~~t~~~L~~Y~~~vA~~vg~m~~~---ilg~~~~~----~~~~A~~lG~A~QltNilRDv~eD~~ 160 (266) T TIGR03465 89 EVIDGMEMDLEQTRYPDFAELDLYCDRVAGAVGRLSAR---IFGATDAR----TLEYAHHLGRALQLTNILRDVGEDAR 160 (266) T ss_pred HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH---HCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999985578999999999999999863699999998---80899757----89999999999999999997188997 No 18 >pfam00494 SQS_PSY Squalene/phytoene synthase. Probab=93.61 E-value=0.28 Score=26.83 Aligned_cols=74 Identities=16% Similarity=0.214 Sum_probs=49.2 Q ss_pred HHHHCCCCCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 66411332221000-00036799999998634899999999997598889999999999998499999867653443206 Q gi|254781111|r 157 QGMLGGQMLDIQDE-FIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLP 235 (237) Q Consensus 157 ~~l~~GQ~~dl~~~-~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~~ 235 (237) ..++.|+..|+... ..|.+++..-+.+--|+...+.+.+ ++..+ .......++..+|+|+|+.+=+-|+-.|.. T Consensus 92 ~~li~g~~~Dl~~~~~~t~~dL~~Y~~~vAg~Vg~l~~~i---~g~~~--~~~~~~~~A~~lG~AlQltNilRDi~eD~~ 166 (262) T pfam00494 92 LELIDGMEMDLEKDRYETLAELEEYCYRVAGVVGLLLLRL---LGVRD--DAEAADEAARHLGLALQLTNILRDVGEDAR 166 (262) T ss_pred HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH---HCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 9999999987367999999999999988168999999999---57789--458899999999999999999974699983 No 19 >PRK13594 consensus Probab=70.41 E-value=7.7 Score=18.31 Aligned_cols=44 Identities=16% Similarity=-0.031 Sum_probs=24.4 Q ss_pred HHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999975988-8999999999999849999986765344320 Q gi|254781111|r 191 FACESGAIMAHAS-QNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 191 ~~~~~ga~lag~~-~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) .+.-.|+...+.. ....-.+.-+.-.+.++=.|.-|+.|.+||. T Consensus 139 ~~~~fg~~~~~~~~~~~~~~l~~~aFl~~l~REIvKDieDieGD~ 183 (278) T PRK13594 139 SIFLFGGAIAGTEGLLSMLPIAAITFLAMLARELLKDAEDIEGDR 183 (278) T ss_pred HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH T ss_conf 999999999745641899999999999999999994553012388 No 20 >KOG0018 consensus Probab=67.66 E-value=3.2 Score=20.55 Aligned_cols=13 Identities=15% Similarity=0.531 Sum_probs=4.7 Q ss_pred CCCCCCCCCHHHH Q ss_conf 4324345201332 Q gi|254781111|r 108 HIQYDEVTAIIAG 120 (237) Q Consensus 108 h~~~G~~~AIl~G 120 (237) |.+|+.+.++..| T Consensus 516 ~kkYeiAvt~~Lg 528 (1141) T KOG0018 516 QKKYEIAVTVVLG 528 (1141) T ss_pred HHHHHHHHHHHHH T ss_conf 8888999999975 No 21 >pfam06783 UPF0239 Uncharacterized protein family (UPF0239). Probab=61.83 E-value=9.4 Score=17.81 Aligned_cols=20 Identities=40% Similarity=0.481 Sum_probs=10.1 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 89999999999998499999 Q gi|254781111|r 204 QNEKERLRCFGENLGIIFQL 223 (237) Q Consensus 204 ~~~~~~l~~~g~~lGiafQi 223 (237) ++..+.+-+||..+|-.||+ T Consensus 15 ED~~~~~~rygl~~gaifq~ 34 (85) T pfam06783 15 EDFFELLIRYGLFLGAIFQF 34 (85) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 89999999999999999999 No 22 >pfam10776 DUF2600 Protein of unknown function (DUF2600). This is a bacterial family of proteins. Some members in the family are annotated as YtpB however currently no function is known. Probab=55.32 E-value=8.5 Score=18.07 Aligned_cols=33 Identities=21% Similarity=0.371 Sum_probs=16.9 Q ss_pred CCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 98889999999-9999984999998676534432 Q gi|254781111|r 201 HASQNEKERLR-CFGENLGIIFQLADDLLDCEED 233 (237) Q Consensus 201 g~~~~~~~~l~-~~g~~lGiafQi~DD~lD~~~D 233 (237) +.+++....+. .|--.+.-.-=+.|=++|...| T Consensus 205 ~~t~~~a~~i~~aYFPwi~gLHiLLDyfIDqeED 238 (330) T pfam10776 205 DLTEEDADKIRDAYFPWIQGLHILLDYFIDQEED 238 (330) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHH T ss_conf 9999999999983318997999999987356766 No 23 >PRK13593 consensus Probab=54.07 E-value=16 Score=16.52 Aligned_cols=46 Identities=13% Similarity=-0.054 Sum_probs=26.7 Q ss_pred HHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999975988-8999999999999849999986765344320 Q gi|254781111|r 189 MCFACESGAIMAHAS-QNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 189 f~~~~~~ga~lag~~-~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) ...+...|+...+.. ....--+.-+.--.....-+.-|+.|.+||. T Consensus 144 ~g~~~l~G~~av~~~~~~~~~~l~~~~fl~t~~reiikdi~DieGD~ 190 (283) T PRK13593 144 TGSTFLFGAAAVGRILAFGVVVLFALAALATAAREIIKDVEDLDGDR 190 (283) T ss_pred HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999758887389999999999999999999998642198 No 24 >KOG1345 consensus Probab=50.64 E-value=7.1 Score=18.54 Aligned_cols=24 Identities=38% Similarity=0.585 Sum_probs=19.8 Q ss_pred CCHHHHHHHHHHHHHHHCCCCCCCC Q ss_conf 4024688889999986477654453 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLPSMDN 97 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~~~D~ 97 (237) -+++.|+|++|.--|||.||. +|| T Consensus 128 ~ql~SAi~fMHsknlVHRdlK-~eN 151 (378) T KOG1345 128 AQLLSAIEFMHSKNLVHRDLK-AEN 151 (378) T ss_pred HHHHHHHHHHHCCCHHHCCCC-CCE T ss_conf 999989877630012202123-110 No 25 >KOG1166 consensus Probab=45.18 E-value=16 Score=16.49 Aligned_cols=36 Identities=25% Similarity=0.291 Sum_probs=29.7 Q ss_pred CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC Q ss_conf 4024688889999986477654453223445566543 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHI 109 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~ 109 (237) ..+.-+||-+|..-.||-||- -||--+||+.+.-|- T Consensus 801 ~qml~ive~lH~~~IIHgDiK-PDNfll~~~~~~~~~ 836 (974) T KOG1166 801 CQMLRIVEHLHAMGIIHGDIK-PDNFLLRREICADSD 836 (974) T ss_pred HHHHHHHHHHHHCCEECCCCC-CCEEEEECCCCCCCC T ss_conf 999999999875163104678-651475146678886 No 26 >PRK12887 ubiA tocopherol phytyltransferase; Reviewed Probab=42.46 E-value=24 Score=15.44 Aligned_cols=115 Identities=14% Similarity=0.063 Sum_probs=59.4 Q ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 88899999864776544532234455665432434520133222233479999731023412678888876532223566 Q gi|254781111|r 79 IECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQG 158 (237) Q Consensus 79 vEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 158 (237) +-+.-.+-=+..|+|++++| .+.|-.|.-.++|...+-..+-+++..++-...-.+.. .............++....- T Consensus 192 ~~~fa~~Iai~KDipDIEGD-r~~GI~Tl~V~LG~k~v~~l~~~ll~~~Y~~~i~~g~~-~~~~~~~~~~~~~H~~l~~~ 269 (309) T PRK12887 192 VLVFTFAIAIFKDIPDMEGD-RQYNITTFTLRLGKQRVFKLSCWVLTACYLGMIAVGLL-FLPSINSAFLIVSHLLLLAL 269 (309) T ss_pred HHHHHHHHHHHCCCCCCCCC-HHCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999998157423432-75197654347538999999999999999999999997-24668889999999999999 Q ss_pred -HHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf -4113322210000003679999999863489999999 Q gi|254781111|r 159 -MLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACES 195 (237) Q Consensus 159 -l~~GQ~~dl~~~~~~~~~y~~i~~~KTa~lf~~~~~~ 195 (237) .-..|..|++++.--.+-|.-|.+.=-+.||-.|..| T Consensus 270 l~~~~~~vdl~~k~~i~sfY~fIWkLFy~EY~l~P~~~ 307 (309) T PRK12887 270 LWWRSQRVDLEDKSAIAQFYQFIWKLFFLEYLLFPIAC 307 (309) T ss_pred HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99997307853468999999999999999999999998 No 27 >cd05105 PTKc_PDGFR_alpha Catalytic Domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF- Probab=36.57 E-value=10 Score=17.65 Aligned_cols=22 Identities=23% Similarity=0.431 Sum_probs=19.5 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.++|++|.-..||-|+. T Consensus 243 a~qIA~GM~YL~s~~iIHRDLa 264 (400) T cd05105 243 TYQVARGMEFLASKNCVHRDLA 264 (400) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999987784646577 No 28 >TIGR01957 nuoB_fam NADH-quinone oxidoreductase, B subunit; InterPro: IPR006138 Respiratory-chain NADH dehydrogenase (1.6.5.3 from EC) (also known as complex I or NADH-ubiquinone oxidoreductase) is an oligomeric enzymatic complex located in the inner mitochondrial membrane which also seems to exist in the chloroplast and in cyanobacteria (as a NADH-plastoquinone oxidoreductase). Among the 25 to 30 polypeptide subunits of this bioenergetic enzyme complex there is one with a molecular weight of 20 kDa (in mammals) , which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 4Fe-4S iron-sulphur cluster. The 20 kDa subunit has been found to be nuclear encoded, as a precursor form with a transit peptide in mammals, and in Neurospora crassa. It is mitochondrial encoded in Paramecium (gene psbG) and chloroplast encoded in various higher plants (gene ndhK or psbG).; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0006120 mitochondrial electron transport NADH to ubiquinone. Probab=35.65 E-value=22 Score=15.62 Aligned_cols=33 Identities=27% Similarity=0.209 Sum_probs=22.4 Q ss_pred CCCCCCHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCC Q ss_conf 2222402468888999998647765445--322344556 Q gi|254781111|r 69 HLTALRVGAAIECIHCYSLIHDDLPSMD--NGYIRRGKP 105 (237) Q Consensus 69 ~~~~~~~AaavEllH~asLihDDI~~~D--~s~~RRG~p 105 (237) +..-=-++||||++|+++=-|| +| ++..+|.-| T Consensus 21 P~tFGlACCaIEMm~t~~s~yD----ldRFG~~~fR~SP 55 (146) T TIGR01957 21 PLTFGLACCAIEMMATGASRYD----LDRFGSVVFRASP 55 (146) T ss_pred HHHHHHHHHHHHHHHHHHHHCC----HHHCCCCCCCCCC T ss_conf 1122365589999997554126----3133721587787 No 29 >cd05061 PTKc_InsR Catalytic Domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta Probab=32.93 E-value=11 Score=17.31 Aligned_cols=22 Identities=18% Similarity=0.451 Sum_probs=18.5 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||- T Consensus 125 ~~qia~gl~yLH~~~IiHRDLK 146 (288) T cd05061 125 AAEIADGMAYLNAKKFVHRDLA 146 (288) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999861995547668 No 30 >cd05038 PTKc_Jak_rpt2 Catalytic (Repeat 2) Domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut Probab=32.88 E-value=9.6 Score=17.76 Aligned_cols=22 Identities=32% Similarity=0.579 Sum_probs=19.3 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 115 ~~qia~gL~yLH~~~iiHrDlK 136 (279) T cd05038 115 ALQIAKGMDYLGSKRLIHRDLA 136 (279) T ss_pred HHHHHHHHHHHHHCCEEECCCC T ss_conf 9999999998875897655256 No 31 >cd05097 PTKc_DDR_like Catalytic Domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin domain receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including Probab=32.78 E-value=10 Score=17.65 Aligned_cols=22 Identities=18% Similarity=0.560 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 135 a~qia~gl~yLh~~~iiHrDLK 156 (295) T cd05097 135 AVQIASGMKYLASLNFVHRDLA 156 (295) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999854985526667 No 32 >cd05049 PTKc_Trk Catalytic Domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin related kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt Probab=32.70 E-value=11 Score=17.45 Aligned_cols=22 Identities=18% Similarity=0.471 Sum_probs=19.3 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 128 ~~qia~gl~yLH~~~ivHrDlK 149 (280) T cd05049 128 AVQIASGMVYLASQHFVHRDLA 149 (280) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999998866893426657 No 33 >cd00192 PTKc Catalytic Domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan Probab=32.30 E-value=13 Score=16.94 Aligned_cols=22 Identities=23% Similarity=0.537 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|...+||-||. T Consensus 110 ~~qia~gl~yLH~~~iiHrDiK 131 (261) T cd00192 110 AYQIASGMEYLASKNFVHRDLA 131 (261) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999976995578776 No 34 >cd06610 STKc_OSR1_SPAK Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 and SPAK contain a conserved C-terminal (CCT) domain, which recognizes a unique motif ([RK]FX[VI]) present in their activating kinases (WN Probab=32.23 E-value=13 Score=17.04 Aligned_cols=21 Identities=29% Similarity=0.371 Sum_probs=18.3 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) .+++.|++.+|.--.||-||. T Consensus 109 ~qi~~al~ylH~~~iiHRDiK 129 (266) T cd06610 109 KEVLKGLEYLHKNGQIHRDIK 129 (266) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999997893226666 No 35 >cd05085 PTKc_Fer Catalytic Domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c Probab=32.09 E-value=11 Score=17.36 Aligned_cols=22 Identities=32% Similarity=0.469 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 99 ~~~ia~gl~yLH~~~iiHrDlK 120 (250) T cd05085 99 ALDAAAGMAYLESKNCIHRDLA 120 (250) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999842996447537 No 36 >cd05099 PTKc_FGFR4 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to Probab=32.06 E-value=11 Score=17.36 Aligned_cols=22 Identities=32% Similarity=0.483 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||. T Consensus 140 a~qia~gl~yLH~~~iiHRDLK 161 (314) T cd05099 140 AYQVARGMEYLESRRCIHRDLA 161 (314) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999984899688767 No 37 >cd05055 PTKc_PDGFR Catalytic Domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept Probab=31.67 E-value=13 Score=16.95 Aligned_cols=22 Identities=23% Similarity=0.401 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.+++.+|.-.+||-||- T Consensus 147 ~~qia~gl~yLH~~~iiHRDLK 168 (302) T cd05055 147 SYQVAKGMAFLASKNCIHRDLA 168 (302) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999976894777465 No 38 >cd05096 PTKc_DDR1 Catalytic Domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin domain receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k Probab=31.61 E-value=8.1 Score=18.19 Aligned_cols=22 Identities=23% Similarity=0.602 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 144 a~qia~gl~yLh~~~iiHrDLK 165 (304) T cd05096 144 ALQIASGMKYLSSLNFVHRDLA 165 (304) T ss_pred HHHHHHHHHHHHCCCEEECCCC T ss_conf 9999998789872998827566 No 39 >pfam04703 FaeA FaeA-like protein. This family represents a number of fimbrial protein transcription regulators found in Gram-negative bacteria. These proteins are thought to facilitate binding of the leucine-rich regulatory protein to regulatory elements, possibly by inhibiting deoxyadenosine methylation of these elements by deoxyadenosine methylase. Probab=31.51 E-value=14 Score=16.73 Aligned_cols=22 Identities=23% Similarity=0.385 Sum_probs=16.1 Q ss_pred HCCCCCCCCCCCCCCCCCCCCC Q ss_conf 4776544532234455665432 Q gi|254781111|r 89 HDDLPSMDNGYIRRGKPTVHIQ 110 (237) Q Consensus 89 hDDI~~~D~s~~RRG~pt~h~~ 110 (237) .+|--.+..++.|||.|+.|.. T Consensus 39 Lek~g~i~rsp~rrG~~tlW~l 60 (61) T pfam04703 39 LEKEGKIERSPLRRGAPTLWRL 60 (61) T ss_pred HHHCCCEECCCCCCCCHHHHHC T ss_conf 9870752305534672146650 No 40 >cd05053 PTKc_FGFR Catalytic Domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, Probab=31.05 E-value=14 Score=16.86 Aligned_cols=22 Identities=32% Similarity=0.465 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|...+||-||- T Consensus 139 ~~qia~gl~yLH~~~IvHRDlK 160 (294) T cd05053 139 AYQVARGMEYLASKKCIHRDLA 160 (294) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999984899677677 No 41 >cd05102 PTKc_VEGFR3 Catalytic Domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V Probab=31.05 E-value=14 Score=16.82 Aligned_cols=21 Identities=29% Similarity=0.480 Sum_probs=18.8 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) .++|.+++.+|..-.||-||. T Consensus 181 ~qia~gm~yLh~~~iiHRDLK 201 (338) T cd05102 181 FQVARGMEFLASRKCIHRDLA 201 (338) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999985892346688 No 42 >cd05074 PTKc_Tyro3 Catalytic Domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac Probab=30.75 E-value=13 Score=16.95 Aligned_cols=22 Identities=23% Similarity=0.528 Sum_probs=18.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||- T Consensus 119 ~~qia~gl~yLH~~~iiHRDlK 140 (273) T cd05074 119 MIDIASGMEYLSSKNFIHRDLA 140 (273) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999985893625565 No 43 >cd05107 PTKc_PDGFR_beta Catalytic Domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D Probab=30.55 E-value=13 Score=17.00 Aligned_cols=22 Identities=23% Similarity=0.443 Sum_probs=19.5 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|..+|++|.--.||-|+. T Consensus 245 a~qIA~GM~yL~s~~iiHRDLa 266 (401) T cd05107 245 SYQVANGMEFLASKNCVHRDLA 266 (401) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999989988976787254466 No 44 >cd05036 PTKc_ALK_LTK Catalytic Domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic lymphoma kinase (ALK) and Leukocyte tyrosine (tyr) kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well Probab=30.50 E-value=16 Score=16.54 Aligned_cols=21 Identities=19% Similarity=0.306 Sum_probs=18.1 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) ..+|.+++.+|....||-||. T Consensus 123 ~~ia~gl~yLH~~~ivHrDlK 143 (277) T cd05036 123 RDVAKGCKYLEENHFIHRDIA 143 (277) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999987991568775 No 45 >TIGR01962 NuoD NADH dehydrogenase I, D subunit; InterPro: IPR010219 This entry recognises specifically the D subunit of NADH dehydrogenase I complex. It excludes the related chain of NAD(P)H-quinone oxidoreductases from chloroplast and Synechocystis, where the quinone may be plastoquinone rather than ubiquinone. This subunit often appears as a subunit C/D fusion.; GO: 0016651 oxidoreductase activity acting on NADH or NADPH, 0006118 electron transport. Probab=30.13 E-value=38 Score=14.25 Aligned_cols=100 Identities=16% Similarity=0.179 Sum_probs=64.4 Q ss_pred HHHHHHHHHHHHHHH--HHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHH------HHHHHHHHHHHHHHHH-HH Q ss_conf 322223347999973--10234126788888765322235664113322210000------0036799999998634-89 Q gi|254781111|r 119 AGNGLLTYAFEIISS--PKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEF------IDETQVFMIQKMKTGA-LM 189 (237) Q Consensus 119 ~Gd~l~~~a~~~l~~--~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~~dl~~~~------~~~~~y~~i~~~KTa~-lf 189 (237) +=++-|++|.|-|+. ..-+.-....=.++.+++|-..+.-.+.-+.+|+..-+ .+.|..++..+.=||+ +- T Consensus 69 ~ne~AY~LAVEKLlGit~evP~RA~vIRV~l~EL~RI~sHLl~igt~~lD~GAmTp~lyaFr~RE~~~DL~E~~~G~RM~ 148 (408) T TIGR01962 69 SNELAYALAVEKLLGITIEVPRRAQVIRVILLELNRISSHLLFIGTHALDLGAMTPFLYAFREREKILDLFEAITGARMH 148 (408) T ss_pred HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 10048888878770761246731589999999988998899999998777877769999888799999999876300246 Q ss_pred HHHHHHHHHHCCCC---HHHHHHHHHHHHHHH Q ss_conf 99999999975988---899999999999984 Q gi|254781111|r 190 CFACESGAIMAHAS---QNEKERLRCFGENLG 218 (237) Q Consensus 190 ~~~~~~ga~lag~~---~~~~~~l~~~g~~lG 218 (237) ...++.|++.-+-+ +...+.+++|-..+= T Consensus 149 ~~y~R~GGV~~DLPdf~~n~l~~i~~Fl~~~p 180 (408) T TIGR01962 149 SAYFRIGGVAEDLPDFMENWLEEIREFLEQFP 180 (408) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 67634587132103454338999999998614 No 46 >TIGR02362 dhaK1b probable dihydroxyacetone kinase DhaK1b subunit; InterPro: IPR012735 Two types of dihydroxyacetone kinase (glycerone kinase) are described. In yeast and a few bacteria, e.g. Citrobacter freundii, the enzyme is a single chain that uses ATP as phosphoryl donor and is designated 2.7.1.29 from EC. By contract, Escherichia coli and many other bacterial species have a multisubunit form with a phosphoprotein donor related to PTS transport proteins. This family represents a protein, unique to the firmicutes (low GC Gram-positives), that appears to be a divergent second copy of the K subunit of that complex; its gene is always found in operons with the other three proteins of the complex.. Probab=30.08 E-value=17 Score=16.24 Aligned_cols=43 Identities=33% Similarity=0.434 Sum_probs=22.0 Q ss_pred CCCCCHHHHHHHHH------HHHHHHCCCCCCCCCC----CCCCCC-C--CCCCCCC Q ss_conf 22240246888899------9998647765445322----344556-6--5432434 Q gi|254781111|r 70 LTALRVGAAIECIH------CYSLIHDDLPSMDNGY----IRRGKP-T--VHIQYDE 113 (237) Q Consensus 70 ~~~~~~AaavEllH------~asLihDDI~~~D~s~----~RRG~p-t--~h~~~G~ 113 (237) .++-....|.+... .+-.+|||| ++|.+. .|||-- | +|+..|- T Consensus 106 AD~~~F~~A~~qar~EG~~~~~~iv~DDi-SVe~~~~f~~R~RGvAGtvLvHKIlGa 161 (328) T TIGR02362 106 ADLSEFSQAIEQARQEGRDIKYIIVHDDI-SVESESSFKKRRRGVAGTVLVHKILGA 161 (328) T ss_pred HHHHHHHHHHHHHHHCCCCEEEEEECCCC-CCCCHHHHHHCCCCCHHHHHHHHHHHH T ss_conf 77899999999998638950379972753-317645563303563257799899999 No 47 >PRK12883 ubiA prenyltransferase UbiA-like protein; Reviewed Probab=29.96 E-value=38 Score=14.23 Aligned_cols=45 Identities=16% Similarity=0.063 Sum_probs=25.9 Q ss_pred HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999759888999999999999849999986765344320 Q gi|254781111|r 189 MCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 189 f~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) ...+...|+...+. ....-.+.-++-.+.+++-|.-|+.|.+||. T Consensus 139 ~g~~~l~g~~a~g~-~~~~~~l~~~afl~~l~reivkdieD~egD~ 183 (275) T PRK12883 139 TAATPIYGAVGVGR-IGLAGYLAICAFLVNVSREIMKDIEDIEGDM 183 (275) T ss_pred HHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999575-4099999999999999999999999861098 No 48 >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu Probab=29.88 E-value=12 Score=17.12 Aligned_cols=22 Identities=23% Similarity=0.454 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||. T Consensus 119 ~~~ia~gl~yLH~~~ivHrDlK 140 (273) T cd05035 119 MVDIALGMEYLSNRNFIHRDLA 140 (273) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999998820992767676 No 49 >cd05032 PTKc_InsR_like Catalytic Domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological Probab=29.00 E-value=17 Score=16.33 Aligned_cols=22 Identities=18% Similarity=0.421 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 125 ~~qia~gl~yLH~~~IiHrDlK 146 (277) T cd05032 125 AAEIADGMAYLAAKKFVHRDLA 146 (277) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999986895447788 No 50 >cd05103 PTKc_VEGFR2 Catalytic Domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp Probab=28.42 E-value=17 Score=16.26 Aligned_cols=21 Identities=29% Similarity=0.483 Sum_probs=18.6 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) .++|.+++++|..-.||-||. T Consensus 186 ~qia~gl~yLh~~~ivHRDLK 206 (343) T cd05103 186 FQVAKGMEFLASRKCIHRDLA 206 (343) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999987886667478 No 51 >cd05066 PTKc_EphR_A Catalytic Domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul Probab=28.40 E-value=15 Score=16.65 Aligned_cols=22 Identities=14% Similarity=0.326 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 112 ~~~ia~gl~yLh~~~iiHRDlK 133 (267) T cd05066 112 LRGIASGMKYLSDMGYVHRDLA 133 (267) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999966985546676 No 52 >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic Domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells Probab=28.21 E-value=14 Score=16.77 Aligned_cols=22 Identities=23% Similarity=0.433 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 106 ~~qia~gl~yLH~~~iiHrDLK 127 (269) T cd05087 106 ACEIASGLLHLHKHNYVHSDLA 127 (269) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999952995646455 No 53 >cd05075 PTKc_Axl Catalytic Domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor Probab=28.02 E-value=14 Score=16.81 Aligned_cols=22 Identities=27% Similarity=0.486 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||- T Consensus 118 ~~~ia~gL~yLH~~~ivHrDLK 139 (272) T cd05075 118 MTDIASGMEYLSSKSFIHRDLA 139 (272) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999998710983647676 No 54 >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase; InterPro: IPR010232 This entry represents the enzyme (UbiB) which catalyses the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria , . The gene is also known as AarF in certain species. It is believed that the reaction converts 2-polyprenylphenol to 6-hydroxy-2-polyprenylphenol. Members are mainly proteobacteria.; GO: 0006744 ubiquinone biosynthetic process. Probab=27.94 E-value=42 Score=14.02 Aligned_cols=32 Identities=13% Similarity=0.015 Sum_probs=12.0 Q ss_pred CCHHHHHHHHHHH-HHCCCCCCCCCCHHHHHHH Q ss_conf 6007999999999-9617882222402468888 Q gi|254781111|r 50 GKKIRSFLVTECA-SLFNVNHLTALRVGAAIEC 81 (237) Q Consensus 50 GKr~R~~l~l~~~-~~~~~~~~~~~~~AaavEl 81 (237) +||+||.-++... +.+...-+=....|.|-|| T Consensus 188 ~~RlrP~evV~~f~~~l~~ELDl~~Eaa~A~~L 220 (452) T TIGR01982 188 SRRLRPTEVVKEFEKTLRNELDLRREAANASEL 220 (452) T ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 255460367889999999876499999999999 No 55 >cd05148 PTKc_Srm_Brk Catalytic Domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom Probab=27.88 E-value=17 Score=16.38 Aligned_cols=22 Identities=27% Similarity=0.377 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|..-.||-||. T Consensus 110 ~~qia~gl~yLH~~~iiHrDLK 131 (261) T cd05148 110 ACQVAEGMAYLEEQNSIHRDLA 131 (261) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999986996667566 No 56 >cd05106 PTKc_CSF-1R Catalytic Domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-stimulating factor-1 receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti Probab=27.85 E-value=15 Score=16.69 Aligned_cols=22 Identities=18% Similarity=0.380 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.++|++|.--.||-||. T Consensus 218 a~qIA~GM~YL~s~~iIHRDLa 239 (374) T cd05106 218 SSQVAQGMDFLASKNCIHRDVA 239 (374) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999987892327677 No 57 >KOG0591 consensus Probab=27.38 E-value=42 Score=13.96 Aligned_cols=43 Identities=21% Similarity=0.252 Sum_probs=25.1 Q ss_pred CCHHHHHHHHHH----HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 402468888999----9986477654453223445566543243452013322223347 Q gi|254781111|r 73 LRVGAAIECIHC----YSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYA 127 (237) Q Consensus 73 ~~~AaavEllH~----asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a 127 (237) .+++.|++-.|+ .+.+|-|| ||+ +.-...+..+-.||+-++.. T Consensus 131 ~QL~~AL~~cH~~~~r~~VmHRDI-----------KPa-NIFl~~~gvvKLGDfGL~r~ 177 (375) T KOG0591 131 VQLCRALYHCHSKIPRGTVMHRDI-----------KPA-NIFLTANGVVKLGDFGLGRF 177 (375) T ss_pred HHHHHHHHHHHCCCCCCCEEECCC-----------CCH-HEEECCCCCEEECCCHHHHH T ss_conf 999999999841166555234357-----------601-06871788566434115767 No 58 >KOG0194 consensus Probab=27.29 E-value=14 Score=16.77 Aligned_cols=23 Identities=22% Similarity=0.408 Sum_probs=20.0 Q ss_pred CCCCHHHHHHHHHHHHHHHCCCC Q ss_conf 22402468888999998647765 Q gi|254781111|r 71 TALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 71 ~~~~~AaavEllH~asLihDDI~ 93 (237) -.+.+|+.+|.||.-.+||-||. T Consensus 267 ~~~~AA~Gl~YLh~k~~IHRDIA 289 (474) T KOG0194 267 FCYDAARGLEYLHSKNCIHRDIA 289 (474) T ss_pred HHHHHHHHHHHHHHCCCCCHHHH T ss_conf 99999867999987798536576 No 59 >cd05063 PTKc_EphR_A2 Catalytic Domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored Probab=27.18 E-value=14 Score=16.81 Aligned_cols=22 Identities=18% Similarity=0.353 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 113 ~~~ia~gL~yLH~~~iiHrDlK 134 (268) T cd05063 113 LRGIAAGMKYLSDMNYVHRDLA 134 (268) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999832998755347 No 60 >cd05101 PTKc_FGFR2 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to Probab=27.00 E-value=13 Score=17.02 Aligned_cols=22 Identities=27% Similarity=0.443 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 143 ~~qia~gl~yLH~~~iiHRDLK 164 (304) T cd05101 143 TYQVARGMEYLASQKCIHRDLA 164 (304) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999974886578777 No 61 >cd05056 PTKc_FAK Catalytic Domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions Probab=26.90 E-value=17 Score=16.34 Aligned_cols=22 Identities=14% Similarity=0.451 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 113 ~~qia~gl~ylH~~~iiHrDlK 134 (270) T cd05056 113 SYQLSTALAYLESKRFVHRDIA 134 (270) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999974996357578 No 62 >cd05092 PTKc_TrkA Catalytic Domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin related kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory Probab=26.77 E-value=16 Score=16.47 Aligned_cols=21 Identities=14% Similarity=0.434 Sum_probs=18.5 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) .++|.+++.+|....||-||. T Consensus 129 ~qia~gl~yLHs~~iiHRDlK 149 (280) T cd05092 129 AQIASGMVYLASLHFVHRDLA 149 (280) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999840997368667 No 63 >cd05079 PTKc_Jak1_rpt2 Catalytic (Repeat 2) Domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a Probab=26.59 E-value=9.7 Score=17.74 Aligned_cols=22 Identities=18% Similarity=0.445 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.+++.+|.-..||-||. T Consensus 115 ~~qia~gl~yLH~~~ivHrDlK 136 (284) T cd05079 115 AVQICKGMDYLGSRQYVHRDLA 136 (284) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999998703983647776 No 64 >cd05058 PTKc_Met_Ron Catalytic Domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca Probab=26.40 E-value=14 Score=16.79 Aligned_cols=22 Identities=27% Similarity=0.539 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|..-.||-||- T Consensus 104 ~~qia~gl~yLH~~~ivHrDlK 125 (262) T cd05058 104 GLQVAKGMEYLASKKFVHRDLA 125 (262) T ss_pred HHHHHHHHHHHCCCCCCCCCCC T ss_conf 9999999999801994757578 No 65 >cd05052 PTKc_Abl Catalytic Domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays Probab=25.61 E-value=18 Score=16.15 Aligned_cols=22 Identities=32% Similarity=0.533 Sum_probs=19.3 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 110 a~qia~gl~yLH~~~iiHrDLK 131 (263) T cd05052 110 ATQISSAMEYLEKKNFIHRDLA 131 (263) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999965895357566 No 66 >KOG0192 consensus Probab=25.26 E-value=11 Score=17.37 Aligned_cols=23 Identities=35% Similarity=0.606 Sum_probs=20.2 Q ss_pred CCCCHHHHHHHHHHHH-HHHCCCC Q ss_conf 2240246888899999-8647765 Q gi|254781111|r 71 TALRVGAAIECIHCYS-LIHDDLP 93 (237) Q Consensus 71 ~~~~~AaavEllH~as-LihDDI~ 93 (237) -++++|.++|++|.-. +||-|+- T Consensus 147 ~aldiArGm~YLH~~~~iIHrDLK 170 (362) T KOG0192 147 IALDIARGMEYLHSEGPIIHRDLK 170 (362) T ss_pred HHHHHHHHHHHHCCCCCEEEEECC T ss_conf 999999888765058977874358 No 67 >cd05109 PTKc_HER2 Catalytic Domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve Probab=25.22 E-value=18 Score=16.21 Aligned_cols=22 Identities=18% Similarity=0.462 Sum_probs=19.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 115 ~~qia~gl~yLH~~~IiHrDlK 136 (279) T cd05109 115 CVQIAKGMSYLEEVRLVHRDLA 136 (279) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999985990137657 No 68 >cd05098 PTKc_FGFR1 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to Probab=24.93 E-value=19 Score=16.08 Aligned_cols=22 Identities=32% Similarity=0.465 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 146 ~~qia~gl~yLH~~~iiHRDLK 167 (307) T cd05098 146 AYQVARGMEYLASKKCIHRDLA 167 (307) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999984899678667 No 69 >cd05034 PTKc_Src_like Catalytic Domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t Probab=24.92 E-value=18 Score=16.13 Aligned_cols=22 Identities=23% Similarity=0.454 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 109 ~~qia~gl~yLH~~~iiHrDlK 130 (261) T cd05034 109 AAQIAEGMAYLESRNYIHRDLA 130 (261) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999986995754327 No 70 >cd05067 PTKc_Lck_Blk Catalytic Domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr Probab=24.38 E-value=18 Score=16.16 Aligned_cols=22 Identities=27% Similarity=0.415 Sum_probs=19.5 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 108 ~~qia~gl~yLH~~~ivHrDlK 129 (260) T cd05067 108 AAQIAEGMAYIERKNYIHRDLR 129 (260) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999974897605466 No 71 >cd05086 PTKc_Aatyk2 Catalytic Domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage Probab=24.19 E-value=19 Score=16.07 Aligned_cols=22 Identities=27% Similarity=0.519 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 105 ~~qia~gl~yLH~~~ivHrDLK 126 (268) T cd05086 105 ACEIAAGVTHMHKHNFLHSDLA 126 (268) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999986897167777 No 72 >cd05068 PTKc_Frk_like Catalytic Domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a Probab=23.82 E-value=20 Score=15.95 Aligned_cols=28 Identities=25% Similarity=0.411 Sum_probs=21.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCCCCCCCCC Q ss_conf 24024688889999986477654453223 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLPSMDNGYI 100 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~~~D~s~~ 100 (237) +.++|.+++.+|.--.||-||- -+|=-+ T Consensus 109 ~~qia~gl~yLH~~~iiHrDLK-p~NILl 136 (261) T cd05068 109 AAQVASGMAYLEAQNYIHRDLA-ARNVLV 136 (261) T ss_pred HHHHHHHHHHHHHCCEECCCCC-CCEEEE T ss_conf 9999999999986797206566-155898 No 73 >cd05077 PTK_Jak1_rpt1 Pseudokinase (Repeat 1) Domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom Probab=23.41 E-value=23 Score=15.52 Aligned_cols=22 Identities=18% Similarity=0.344 Sum_probs=19.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--+||-||. T Consensus 111 a~~ia~gl~yLH~~~iiHrDlk 132 (262) T cd05077 111 AKQLASALSYLEDKDLVHGNVC 132 (262) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999983994377434 No 74 >pfam01040 UbiA UbiA prenyltransferase family. Probab=23.26 E-value=51 Score=13.50 Aligned_cols=46 Identities=24% Similarity=0.129 Sum_probs=26.7 Q ss_pred HHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999975988-8999999999999849999986765344320 Q gi|254781111|r 189 MCFACESGAIMAHAS-QNEKERLRCFGENLGIIFQLADDLLDCEEDL 234 (237) Q Consensus 189 f~~~~~~ga~lag~~-~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~ 234 (237) +..+...|+...+.+ +...-.+.-...-++..+.+.+|+.|.++|. T Consensus 128 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~e~D~ 174 (258) T pfam01040 128 FGLLILLGAYAVGGDIPSPLLLLALPLFLLGLAILLANDIRDVEGDR 174 (258) T ss_pred HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH T ss_conf 88999999999808886999999999999999999999703578799 No 75 >cd05089 PTKc_Tie1 Catalytic Domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations. Probab=23.24 E-value=19 Score=16.06 Aligned_cols=32 Identities=6% Similarity=0.083 Sum_probs=26.7 Q ss_pred HCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 75988899999999999984999998676534 Q gi|254781111|r 199 MAHASQNEKERLRCFGENLGIIFQLADDLLDC 230 (237) Q Consensus 199 lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~ 230 (237) +=..+|+....+.+....|.-..|-+-+|.+. T Consensus 254 Cw~~~P~~RPtf~eI~~~L~~il~~~k~~~~~ 285 (297) T cd05089 254 CWRDRPYERPPFAQISVQLSRMLEARKAYVNM 285 (297) T ss_pred HCCCCHHHCCCHHHHHHHHHHHHHHHHHHCCC T ss_conf 81899668909899999999999731423431 No 76 >cd05070 PTKc_Fyn_Yrk Catalytic Domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r Probab=23.21 E-value=21 Score=15.75 Aligned_cols=22 Identities=36% Similarity=0.484 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.++..+|..-.||-||. T Consensus 108 ~~qia~gL~yLH~~~iiHrDlK 129 (260) T cd05070 108 AAQVAAGMAYIERMNYIHRDLR 129 (260) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999855892345046 No 77 >cd05054 PTKc_VEGFR Catalytic Domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto Probab=23.13 E-value=16 Score=16.52 Aligned_cols=21 Identities=29% Similarity=0.480 Sum_probs=18.7 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) +++|.+++.+|.--.||-||. T Consensus 180 ~qia~gl~yLH~~~iiHRDLK 200 (337) T cd05054 180 FQVARGMEFLASRKCIHRDLA 200 (337) T ss_pred HHHHHHHHHHHHCCEECCCCC T ss_conf 999999998976891346365 No 78 >cd05051 PTKc_DDR Catalytic Domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin domain receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke Probab=22.88 E-value=23 Score=15.55 Aligned_cols=22 Identities=18% Similarity=0.531 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||- T Consensus 136 ~~qia~gl~yLh~~~iiHrDlK 157 (296) T cd05051 136 ATQIASGMKYLESLNFVHRDLA 157 (296) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999977993447567 No 79 >cd05100 PTKc_FGFR3 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to Probab=22.31 E-value=20 Score=15.83 Aligned_cols=33 Identities=21% Similarity=0.366 Sum_probs=25.9 Q ss_pred CCCHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHH Q ss_conf 9888999999999999849999--98676534432 Q gi|254781111|r 201 HASQNEKERLRCFGENLGIIFQ--LADDLLDCEED 233 (237) Q Consensus 201 g~~~~~~~~l~~~g~~lGiafQ--i~DD~lD~~~D 233 (237) ..+|+....+.++-+.|.-+.+ ..|.|||+.-+ T Consensus 274 ~~~P~~RPtf~eiv~~L~~il~~~~~~~~~~~~~~ 308 (334) T cd05100 274 HAVPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVP 308 (334) T ss_pred CCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 78854690989999999999874265663557880 No 80 >TIGR01437 selA_rel pyridoxal phosphate-dependent enzyme, putative; InterPro: IPR006337 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy . PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic . This entry represents a group of proteins that are related to a number of pyridoxal phosphate-dependent enzymes, and in particular to selenocysteine synthase (SelA), which converts Ser to selenocysteine on its tRNA. While resembling SelA, this protein is found only in species that have a better candidate SelA or else lack the other genes (selB, selC, and selD) required for selenocysteine incorporation. . Probab=22.20 E-value=53 Score=13.38 Aligned_cols=33 Identities=27% Similarity=0.436 Sum_probs=26.2 Q ss_pred HHCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHH Q ss_conf 4113322210000-00367999999986348999 Q gi|254781111|r 159 MLGGQMLDIQDEF-IDETQVFMIQKMKTGALMCF 191 (237) Q Consensus 159 l~~GQ~~dl~~~~-~~~~~y~~i~~~KTa~lf~~ 191 (237) +..||..+..... .|+++...++..||+.++.. T Consensus 124 ~gGg~ivE~G~~n~~s~~~lE~~I~~kt~aiLyv 157 (391) T TIGR01437 124 LGGGRIVEVGDENLVSEESLEETIKEKTAAILYV 157 (391) T ss_pred CCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 1899489977888756789999997734675556 No 81 >cd05042 PTKc_Aatyk Catalytic Domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina Probab=22.19 E-value=20 Score=15.89 Aligned_cols=22 Identities=32% Similarity=0.486 Sum_probs=18.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 106 a~~ia~gl~yLH~~~ivHrDlK 127 (269) T cd05042 106 ACEVASGLLWLHQADFIHSDLA 127 (269) T ss_pred HHHHHHHHHHHHHCCEEECCCC T ss_conf 9999999999975895426765 No 82 >PRK13852 type IV secretion system protein VirB6; Provisional Probab=22.09 E-value=54 Score=13.36 Aligned_cols=41 Identities=20% Similarity=0.233 Sum_probs=31.1 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH Q ss_conf 98348999999999999999999997675302457157999 Q gi|254781111|r 1 MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLS 41 (237) Q Consensus 1 m~~~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~ 41 (237) ||.++|+.+.....++|+.++.++.+..+...+...+.+.- T Consensus 1 m~f~~~~~Ft~I~~~~d~~l~~~v~~~~s~I~s~vs~pL~a 41 (295) T PRK13852 1 MNFSIPAPFTAIHTIFDTAFTTSLDSDLGSIQSAVSAPLVA 41 (295) T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 98787886599999999999999985389999986199999 No 83 >cd05093 PTKc_TrkB Catalytic Domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin related kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly Probab=21.96 E-value=24 Score=15.46 Aligned_cols=22 Identities=23% Similarity=0.439 Sum_probs=18.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 126 ~~qia~gl~yLH~~~iiHRDLK 147 (288) T cd05093 126 AQQIAAGMVYLASQHFVHRDLA 147 (288) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999844894678777 No 84 >cd05040 PTKc_Ack_like Catalytic Domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and Probab=21.85 E-value=22 Score=15.66 Aligned_cols=22 Identities=23% Similarity=0.510 Sum_probs=19.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.++..+|.--.||-||. T Consensus 103 ~~qia~aL~yLH~~~ivHrDlK 124 (257) T cd05040 103 AVQIANGMRYLESKRFIHRDLA 124 (257) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999852896457457 No 85 >cd05041 PTKc_Fes_like Catalytic Domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k Probab=21.85 E-value=21 Score=15.76 Aligned_cols=22 Identities=32% Similarity=0.504 Sum_probs=18.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 99 ~~~ia~gl~yLH~~~ivHrDlK 120 (251) T cd05041 99 SLDAAAGMEYLESKNCIHRDLA 120 (251) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999998832895278615 No 86 >cd05057 PTKc_EGFR_like Catalytic Domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea Probab=21.53 E-value=25 Score=15.32 Aligned_cols=22 Identities=18% Similarity=0.451 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 115 ~~qia~gl~yLH~~~iiHRDlK 136 (279) T cd05057 115 CVQIAKGMSYLEERRLVHRDLA 136 (279) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999976896346576 No 87 >cd05043 PTK_Ryk Pseudokinase Domain of the Receptor related to tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It ac Probab=21.51 E-value=24 Score=15.45 Aligned_cols=22 Identities=23% Similarity=0.579 Sum_probs=19.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||. T Consensus 123 ~~qia~gl~yLH~~~ivHRDLK 144 (280) T cd05043 123 AIQIACGMSYLHKRGVIHKDIA 144 (280) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999975993545125 No 88 >pfam07714 Pkinase_Tyr Protein tyrosine kinase. Probab=21.20 E-value=20 Score=15.85 Aligned_cols=22 Identities=27% Similarity=0.593 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..++.+++.+|..-.||-||- T Consensus 108 ~~qi~~gl~yLH~~~iiHrDiK 129 (258) T pfam07714 108 ALQIAKGMEYLESKNFVHRDLA 129 (258) T ss_pred HHHHHHHHHHHHHCCEEECCCC T ss_conf 9999999999985997516676 No 89 >cd05047 PTKc_Tie Catalytic Domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l Probab=20.97 E-value=21 Score=15.80 Aligned_cols=22 Identities=27% Similarity=0.431 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||. T Consensus 118 ~~~ia~gl~yLH~~~iiHRDlK 139 (270) T cd05047 118 AADVARGMDYLSQKQFIHRDLA 139 (270) T ss_pred HHHHHHHHHHHHCCCCCCCCCC T ss_conf 9999999998710992537677 No 90 >cd05104 PTKc_Kit Catalytic Domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce Probab=20.71 E-value=30 Score=14.89 Aligned_cols=22 Identities=23% Similarity=0.404 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.+++++|.--.||-|+. T Consensus 220 a~qIA~Gm~yL~~~~~iHrDLa 241 (375) T cd05104 220 SYQVAKGMSFLASKNCIHRDLA 241 (375) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999998986890436157 No 91 >cd05610 STKc_MASTL STKc_MASTL: Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ14813 is associated with autosomal dominant thrombocytopenia. To date, the function of MASTL is unknow Probab=20.70 E-value=28 Score=15.02 Aligned_cols=22 Identities=32% Similarity=0.501 Sum_probs=18.8 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) ...++.|++.+|..-.||-||- T Consensus 110 ~~qi~~aL~~lH~~gIiHRDiK 131 (669) T cd05610 110 ISEVALALDYLHRHGIIHRDLK 131 (669) T ss_pred HHHHHHHHHHHHHCCCEECCCC T ss_conf 9999999999997887622578 No 92 >cd05090 PTKc_Ror1 Catalytic Domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like orphan receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly Probab=20.56 E-value=25 Score=15.37 Aligned_cols=22 Identities=27% Similarity=0.563 Sum_probs=19.1 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|....||-||. T Consensus 130 ~~qia~gl~yLH~~~iiHrDlK 151 (283) T cd05090 130 AIQIAAGMEYLSSHFFVHKDLA 151 (283) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999844985645048 No 93 >cd05614 STKc_MSK2_N STKc_MSK2_N: Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydrophobic motif (HM) of NTD, which facilitates the phosphorylation of the A-loop and activates the Probab=20.47 E-value=33 Score=14.61 Aligned_cols=21 Identities=19% Similarity=0.281 Sum_probs=18.1 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) ..++.|++.+|..-.||-||- T Consensus 112 ~qi~~aL~yLH~~gIiHRDlK 132 (332) T cd05614 112 GEIILALEHLHKLGIVYRDIK 132 (332) T ss_pred HHHHHHHHHHHHCCCEECCCC T ss_conf 999999999987886525676 No 94 >cd05045 PTKc_RET Catalytic Domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (rearranged during transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi Probab=20.45 E-value=29 Score=14.98 Aligned_cols=21 Identities=19% Similarity=0.455 Sum_probs=18.3 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) ..+|.+++.+|..-+||-||- T Consensus 129 ~qia~gl~yLH~~~iiHRDlK 149 (285) T cd05045 129 WQISRGMQYLAEMKLVHRDLA 149 (285) T ss_pred HHHHHHHHHHHHCCCEECCCC T ss_conf 999999999874890605677 No 95 >cd05095 PTKc_DDR2 Catalytic Domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin domain receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit Probab=20.35 E-value=19 Score=16.00 Aligned_cols=22 Identities=18% Similarity=0.510 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-..||-||. T Consensus 136 ~~qia~gl~yLh~~~ivHrDlK 157 (296) T cd05095 136 ASQIASGMKYLSSLNFVHRDLA 157 (296) T ss_pred HHHHHHHHHHHHCCCEECCCCC T ss_conf 9999999998711987757566 No 96 >cd05631 STKc_GRK4 STKc_GRK4: Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found in the testis, but is also present in the cerebellum and kidney. It is expressed as Probab=20.30 E-value=40 Score=14.12 Aligned_cols=21 Identities=14% Similarity=0.218 Sum_probs=18.4 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) .+++.|++.+|.--.||-||- T Consensus 109 ~qi~~al~ylH~~~IiHRDlK 129 (285) T cd05631 109 AELCCGLEDLQRERIVYRDLK 129 (285) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999997797577668 No 97 >KOG1024 consensus Probab=20.29 E-value=34 Score=14.57 Aligned_cols=41 Identities=17% Similarity=0.178 Sum_probs=27.9 Q ss_pred HHH-HHHHHHHHHCCCCCC----------CCCCHHHHHHHHHHHHHHHCCCC Q ss_conf 799-999999996178822----------22402468888999998647765 Q gi|254781111|r 53 IRS-FLVTECASLFNVNHL----------TALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 53 ~R~-~l~l~~~~~~~~~~~----------~~~~~AaavEllH~asLihDDI~ 93 (237) +|- ...+..|+.-..+.. .+.++|.|+|-+|+.-.||.||. T Consensus 372 ~gNLK~FL~~Cr~~~~~~aqtvtt~qlV~masQla~am~hlh~~~ViHkDiA 423 (563) T KOG1024 372 VGNLKSFLQICRGDDPSYAQTVTTIQLVLMASQLAMAMEHLHNHGVIHKDIA 423 (563) T ss_pred CCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHH T ss_conf 3339999998606887655210488999999999999999986473000024 No 98 >cd05626 STKc_LATS2 STKc_LATS2: Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with poor prognosis in acute lymphoblastic leukemia and breast cancer. Probab=20.22 E-value=39 Score=14.19 Aligned_cols=21 Identities=33% Similarity=0.539 Sum_probs=18.1 Q ss_pred CCHHHHHHHHHHHHHHHCCCC Q ss_conf 402468888999998647765 Q gi|254781111|r 73 LRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 73 ~~~AaavEllH~asLihDDI~ 93 (237) ..++.|++.+|..-.||-||- T Consensus 108 ~qi~~aL~ylH~~gIiHRDLK 128 (381) T cd05626 108 AELTLAIESVHKMGFIHRDIK 128 (381) T ss_pred HHHHHHHHHHHHCCCCCCCCC T ss_conf 999999999986667302154 No 99 >cd05091 PTKc_Ror2 Catalytic Domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like orphan receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly Probab=20.15 E-value=31 Score=14.78 Aligned_cols=22 Identities=23% Similarity=0.498 Sum_probs=19.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.-.+||-||- T Consensus 130 ~~qia~gl~yLH~~~ivHrDlK 151 (283) T cd05091 130 VTQIAAGMEFLSSHHVVHKDLA 151 (283) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999976992678676 No 100 >cd05110 PTKc_HER4 Catalytic Domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin Probab=20.13 E-value=30 Score=14.86 Aligned_cols=22 Identities=18% Similarity=0.418 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +..+|.+++.+|.--.||-||. T Consensus 115 ~~qia~gl~yLH~~~IiHRDLK 136 (303) T cd05110 115 CVQIAKGMMYLEERRLVHRDLA 136 (303) T ss_pred HHHHHHHHHHHHHCCCCCCCCC T ss_conf 9999999999966895346653 No 101 >smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily. Probab=20.11 E-value=26 Score=15.21 Aligned_cols=22 Identities=32% Similarity=0.603 Sum_probs=19.0 Q ss_pred CCCHHHHHHHHHHHHHHHCCCC Q ss_conf 2402468888999998647765 Q gi|254781111|r 72 ALRVGAAIECIHCYSLIHDDLP 93 (237) Q Consensus 72 ~~~~AaavEllH~asLihDDI~ 93 (237) +.++|.+++.+|..-.||-||- T Consensus 109 ~~qi~~gl~yLH~~~ivHrDiK 130 (258) T smart00219 109 ALQIARGMEYLESKNFIHRDLA 130 (258) T ss_pred HHHHHHHHHHHHHCCEECCCCC T ss_conf 9999999999986998506175 Done!