HHsearch alignment for GI: 254781111 and conserved domain: pfam07307

>pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1. This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (EC:2.5.1.30) (approximately 230 residues long). The enzyme consists of two subunits, both of which are required for catalysis of heptaprenyl diphosphate synthesis.
Probab=94.54  E-value=0.26  Score=27.00  Aligned_cols=80  Identities=10%  Similarity=0.070  Sum_probs=53.0

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             78822224024688889999986477654453223445566543243452013322223347999973102341267888
Q gi|254781111|r   66 NVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQ  145 (237)
Q Consensus        66 ~~~~~~~~~~AaavEllH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~  145 (237)
T Consensus        29 ~~~~~~~~~~i~t~mLvq~aLDTHd~V---~~~~~~~~--~~~--k~RQLtVLAGDyyS~lYY~lLa~~~~i~lIr~la~  101 (212)
T pfam07307        29 ELTPEQAERYILTAMLVQIALDTHDKV---SNANAETQ--ETK--KNRQLTVLAGDYYSGLYYYLLSESGDIALIRLLAE  101 (212)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHH---CCCCCCCC--HHH--HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             999899999999999999998778764---54231210--355--63103201102331899999983798699999999


Q ss_pred             HHHHHHH
Q ss_conf             8876532
Q gi|254781111|r  146 LMLSLTH  152 (237)
Q Consensus       146 ~~~~~~~  152 (237)
T Consensus       102 ~I~eiNe  108 (212)
T pfam07307       102 AIKEINE  108 (212)
T ss_pred             HHHHHHH
T ss_conf             9999999