RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781114|ref|YP_003065527.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] (263 letters) >gnl|CDD|110732 pfam01755, Glyco_transf_25, Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyse the transfer of various sugars onto the growing LPS chain during its biosynthesis. Length = 200 Score = 99.8 bits (249), Expect = 6e-22 Identities = 55/200 (27%), Positives = 79/200 (39%), Gaps = 23/200 (11%) Query: 3 IPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYG---ENNPICNRIFSHQKRQCQFK 59 I +YVISL + RRE ++++ F FFDAI G N+ + + + + Sbjct: 2 IKIYVISLKRATERREHIQKEFGKLNIPFQFFDAIDGKELPNHLLFKLYNFLLRSKYAGR 61 Query: 60 RLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIK 119 L+L EIGC++SH LW++ IILEDD S+ F +L L K ++ Sbjct: 62 P-LTLGEIGCFLSHYSLWQKCVELNLEYIIILEDDVILSENFKAILQFLLKEINELEFLR 120 Query: 120 FDALRKKPKKDS-----YLCTLP--------GNFDIHQPRILSP------RTTGYFIGKE 160 K + L T + R T GY I + Sbjct: 121 LGEWLKTRFDPNDKFIVRLETFLMDSKKFKRTPIADYGNRAFYLLKSGHAGTAGYLITPK 180 Query: 161 AAIHLLNVRKNIYRPIDMDM 180 AA LL KN P+D M Sbjct: 181 AAKKLLKYSKNWPLPVDDLM 200 >gnl|CDD|133474 cd06532, Glyco_transf_25, Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis. Length = 128 Score = 95.4 bits (238), Expect = 1e-20 Identities = 43/178 (24%), Positives = 68/178 (38%), Gaps = 51/178 (28%) Query: 4 PVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRI-FSHQKRQCQFKRLL 62 ++VI+L S RRE+ + A + L F FFDA+ G++ ++ R L Sbjct: 1 KIFVINLDRSTDRRERMEAQLAALGLDFEFFDAVDGKDLSEEELAALYDALFLPRYGRPL 60 Query: 63 SLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDA 122 + EIGC++SH LW++I S A+ILEDDA + Sbjct: 61 TPGEIGCFLSHYKLWQKIVESNLEYALILEDDAILDPD---------------------- 98 Query: 123 LRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDM 180 T GY + ++ A LL + I P+D+ + Sbjct: 99 ----------------------------GTAGYLVSRKGAKKLLAALEPIDLPVDVFL 128 >gnl|CDD|33115 COG3306, COG3306, Glycosyltransferase involved in LPS biosynthesis [Cell envelope biogenesis, outer membrane]. Length = 255 Score = 78.9 bits (194), Expect = 1e-15 Identities = 60/240 (25%), Positives = 96/240 (40%), Gaps = 16/240 (6%) Query: 1 MPIPVYVISLPFSHARREKFCHRAARI-HLQFSFFDAIYGENNPICNRIFSHQKRQCQFK 59 +P++VISL S R E + L F FDA+ G++ + I ++ Sbjct: 1 SLMPIHVISLKSSQERLEHVAETFEALGGLPFQRFDAVNGKSEDEKDLIAELDAGHLLYE 60 Query: 60 -RLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLP----HLSKCDIN 114 R LS EIGCY+SH+ LWK+ +ILEDD ++F + L + + Sbjct: 61 GRRLSPGEIGCYLSHLKLWKKALEENLPYILILEDDVVLGEDFEEFLEDDLKLPVRFLGD 120 Query: 115 NILIKFDALRKKPKKDSYLCTLPG-NFDIHQPRILSPRTTGYFIGKEAAIHLLNV--RKN 171 +I I P ++ G NF + L T GY I ++AA L + Sbjct: 121 DIDIHRLETFLSPNPLAFNAVFIGRNFPLLNSYHLG--TAGYIISRKAAKKFLELTESFK 178 Query: 172 IYRPIDMDMKHWWEHNIPSLVTEP----GAVYEAIDTNDSTIEESRLVRKPTFSPLYFYR 227 + P+D M + H + + V +P A A+ + + + RK L Sbjct: 179 VVLPVDWFMFLEFLHGVGNKVYQPFPAICAQGSALSSILENERDGKSRRKKLV-KLLLSH 237 >gnl|CDD|39381 KOG4179, KOG4179, KOG4179, Lysyl hydrolase/glycosyltransferase family 25 [Posttranslational modification, protein turnover, chaperones]. Length = 568 Score = 40.4 bits (94), Expect = 6e-04 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 13/171 (7%) Query: 5 VYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGEN-NPICNRIFSHQ----KRQCQFK 59 +++I+L RRE+ + +++S +A+ G+ N Q R Sbjct: 294 IFMINLKRRPERRERMLRIFDELGIEYSLVEAVDGKKLNTSQLEALGVQMLPGYRDPYSG 353 Query: 60 RLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQ----LLPHLSKCDINN 115 R L+ EIGC++SH ++WK + ++ EDD F +F L+ + ++ Sbjct: 354 RPLTKGEIGCFLSHYNIWKEVVDRGLEKVLVFEDDLRFEHDFRTRLMRLMQDVDAEHLDW 413 Query: 116 ILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLL 166 LI R + +++ + + + S T GY I + A LL Sbjct: 414 DLIYLGRKRMQEEEEKAVENVRNLVEAG----YSYWTLGYVISLQGARKLL 460 >gnl|CDD|145066 pfam01717, Meth_synt_2, Cobalamin-independent synthase, Catalytic domain. This is a family of vitamin-B12 independent methionine synthases or 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferases, EC:2.1.1.14 from bacteria and plants. Plants are the only higher eukaryotes that have the required enzymes for methionine synthesis. This enzyme catalyses the last step in the production of methionine by transferring a methyl group from 5-methyltetrahydrofolate to homocysteine. The aligned region makes up the carboxy region of the approximately 750 amino acid protein except in some hypothetical archaeal proteins present in the family, where this region corresponds to the entire length. This domain contains the catalytic residues of the enzyme. Length = 324 Score = 28.5 bits (64), Expect = 1.9 Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 18/79 (22%) Query: 85 AIGAIILEDDADFS-----DEFSQLLPHLSKCDINNILIKF--------DALRKKPKKDS 131 + I+ D +F+ +L + D++ + I+F +AL + Sbjct: 201 RLDTIVAALDTQVHTHVCYSDFNDILDAIDALDVDVLTIEFARSDMENLEALEEWG---- 256 Query: 132 YLCTL-PGNFDIHQPRILS 149 Y + G DIH PR+ S Sbjct: 257 YGKGVGFGVVDIHSPRVPS 275 >gnl|CDD|37918 KOG2707, KOG2707, KOG2707, Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones]. Length = 405 Score = 28.4 bits (63), Expect = 2.1 Identities = 12/59 (20%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 73 HIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIK---FDALRKKPK 128 H + AI + AD +F L ++ KC+ + +K + K K Sbjct: 207 LGHPEDARSGGKAIEHLANRASADLHLKFPIPLKNVKKCNFSFSGLKTSYRRIIEKLEK 265 >gnl|CDD|145351 pfam02146, SIR2, Sir2 family. This region is characteristic of Silent information regulator 2 (Sir2) proteins, or sirtuins. These are protein deacetylases that depend on nicotine adenine dinucleotide (NAD). They are found in many subcellular locations, including the nucleus, cytoplasm and mitochondria. Eukaryotic forms play in important role in the regulation of transcriptional repression. Moreover, they are involved in microtubule organisation and DNA damage repair processes. Length = 177 Score = 28.4 bits (64), Expect = 2.3 Identities = 12/51 (23%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 212 SRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPSSSSSLIK 262 ++L ++ SP F+ N W+ YN ++L P + P+ + I Sbjct: 21 AKLAKEELASPEAFFSNPYLVWDPFYN-IARELLP---GQAQPNPAHYFIA 67 >gnl|CDD|38470 KOG3260, KOG3260, KOG3260, Calcyclin-binding protein CacyBP [Signal transduction mechanisms]. Length = 224 Score = 27.7 bits (61), Expect = 3.0 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 9/81 (11%) Query: 110 KCDINNIL--IKFDALRKKPKKDSYLCTLP------GNF-DIHQPRILSPRTTGYFIGKE 160 + +NN+L I + KK K D+ L ++ + + Sbjct: 122 RMIVNNLLKPISVEKSSKKVKTDTVLILCKKVENTRWDYLTQVEKECKEKEKPSLDKETD 181 Query: 161 AAIHLLNVRKNIYRPIDMDMK 181 + L+NV K IY D DMK Sbjct: 182 PSEGLMNVMKKIYEDGDDDMK 202 >gnl|CDD|176997 CHL00057, rpl14, ribosomal protein L14. Length = 122 Score = 27.2 bits (61), Expect = 5.2 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Query: 40 ENNPICNRIF---SHQKRQCQFKRLLSL-PEI 67 E NP R+F + + R+ F +++SL PE+ Sbjct: 90 EGNPKGTRVFGPIARELREKNFTKIVSLAPEV 121 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.267 0.0770 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,551,480 Number of extensions: 190969 Number of successful extensions: 479 Number of sequences better than 10.0: 1 Number of HSP's gapped: 472 Number of HSP's successfully gapped: 13 Length of query: 263 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 171 Effective length of database: 4,275,709 Effective search space: 731146239 Effective search space used: 731146239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.3 bits)