>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes. It is responsible for the attachment of glycine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP binding and hydrolysis. This alignment contains only sequences from the GlyRS form which homodimerizes. The heterotetramer glyQ is in a different family of class II aaRS. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. This domain is also found at the N-terminus of the accessory subunit of mitochondrial polymerase gamma (Pol gamma b). Pol gamma b stimulates processive DNA synthesis and is functional as a homodimer, which can associate with the catalytic subunit Pol gamma alpha to form a heterotrimer. Despite significant both structural and sequence similarity with Gly

Probab=98.34 E-value=4.8e-07 Score=64.56 Aligned_cols=108 Identities=22% Similarity=0.265 Sum_probs=68.6 Q ss_pred HHHHHHHHHHHHHHHHH--HHHHHHCCCCCCCCCCCCCCCEEEEECCC---CCCCCCCCHHHH--HHH--HHHHCCCC-- Q ss_conf 78899999999873855--34543115653235666554203641222---225432100122--344--44210243-- Q gi|254781118|r 176 FQQRSLLISQIRHFMEK--KGFMEVETPILQPIYGGATADPFKTHHNI---LKADMYLRIAPE--LYL--KRVLISGL-- 244 (502) Q Consensus 176 l~~Rs~i~~~iR~~l~~--~gF~EveTP~L~~~~~g~~~~~F~~~~~~---~~~~~yL~qSpq--l~~--k~l~~~G~-- 244 (502) T Consensus 32 ~~LK~Ni~~~W~~~fv~~~~~~~~id~~ii~p~------LmF~T~iG~~~~~~~~~yLRPETAQGifvnFk~~~~~~r~k 105 (254) T cd00774 32 VELKNNIKSAWRKSFVLEEEDMLEIDSPIITPE------LMFKTSIGPVESGGNLGYLRPETAQGIFVNFKNLLEFNRRK 105 (254) T ss_pred HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC------CCEECCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHCCCC T ss_conf 999999999999998743798799541003663------22001215655898603536345347798789999964888 Q ss_pred --CHHHHHHHHHHCCCCC-CC--CCCCCCCCCCCCCCCCCHHHHHHHHHHHH Q ss_conf --0245434532025423-44--32452100010011000111245678999 Q gi|254781118|r 245 --TDQVFELNRNFRNEGV-SS--RHNPEFTMIEAYWAYTDYRDMMKLVEDLC 291 (502) Q Consensus 245 --~drvfeI~~~FR~E~~-~~--~H~pEFt~lE~e~a~~d~~dim~l~E~li 291 (502) T Consensus 106 LPF-GiaQIGk~FRNEIsPr~~l~R~REF~q~EiE~-F~~P~~~~~~~~~w~ 155 (254) T cd00774 106 LPF-GVAQIGKSFRNEISPRNGLFRVREFTQAEIEF-FVDPEKSHPWFDYWA 155 (254) T ss_pred CCE-EEEEEEECCCCCCCCCCCCCCHHCHHHHEEEE-EECCCCCHHHHHHHH T ss_conf 884-45654202267347776754000002125788-857986425789999

HHsearch alignment for GI: 254781118 and conserved domain: cd00774