>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop. The enzymes in this fungal group are homodimeric class2b aminoacyl-tRNA synthetases (aaRSs). aaRSs catalyze the specific attachment of amino acids (AAs) to their cognate tRNAs during protein biosynthesis. This 2-step reaction involves i) the activation of the AA by ATP in the presence of magnesium ions, followed by ii) the transfer of the activated AA to the terminal ribose of tRNA. In the case of the class2b aaRSs, the activated AA is attached to the 3'OH of the terminal ribose. Eukaryotes contain 2 sets of aaRSs, both of which are encoded by the nuclear genome. One set concerns with cytoplasmic protein synthesis, whereas the other exclusively with mitochondrial protein synthesis. Mutations in the gene for

Probab=99.51 E-value=8.2e-14 Score=108.19 Aligned_cols=75 Identities=23% Similarity=0.372 Sum_probs=65.2 Q ss_pred EEEEEEEECCCCC-CC--CEEEEECCCC-EEEEEEECCCCCHHHHHHHHHCCCCEEEEEEEEEECC------CCCCCCCC Q ss_conf 8999868811148-77--2189977993-5999980542796788887423743168996576305------66553421 Q gi|254781118|r 62 MITVAGRVYSSRN-SG--MFMDIHDASG-KIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRT------KRGELTVN 131 (502) Q Consensus 62 ~V~i~Grv~~~R~-~G--~Fi~LrD~~g-~iQv~~~~~~~~~~~~~~~~~l~~gd~i~v~G~v~~~------~~gelei~ 131 (502) T Consensus 1 kVtL~GWv~~rrd~~g~l~FidLRD~~G~~vQiV~~~~---~~~~~~~~~~~~E~vV~V~G~V~~R~~~~~~~tgeiEi~ 77 (86) T cd04321 1 KVTLNGWIDRKPRIVKKLSFADLRDPNGDIIQLVSTAK---KDAFSLLKSITAESPVQVRGKLQLKEAKSSEKNDEWELV 77 (86) T ss_pred CEEEEEEEEEEECCCCCEEEEEEECCCCCEEEEEECCC---HHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCEEEE T ss_conf 99999738745136898699999839999999994897---778899974899668999999997898899998789999 Q ss_pred CCEEEEEC Q ss_conf 22012211 Q gi|254781118|r 132 AQKIIMLS 139 (502) Q Consensus 132 ~~~~~~l~ 139 (502) T Consensus 78 v~~i~iLN 85 (86) T cd04321 78 VDDIQTLN 85 (86) T ss_pred EEEEEEEC T ss_conf 83999816

HHsearch alignment for GI: 254781118 and conserved domain: cd04321