BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] gi|254040796|gb|ACT57592.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 171 bits (434), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP Sbjct: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 Query: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 IGSFPALRTWIIHHVVGLLKKLFPF Sbjct: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 >gi|315122887|ref|YP_004063376.1| hypothetical protein CKC_05715 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496289|gb|ADR52888.1| hypothetical protein CKC_05715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 85 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 11/80 (13%) Query: 3 RVEFVEMKGEVTLLKQKVDCLIAQ-------FNKQQSVIDEFFTILTTAKGFTAFIK--G 53 R E K E L KVDCLI +N+QQ+ I IL T+KG +FIK G Sbjct: 4 RQEQYVTKQEFNELNAKVDCLITHCKVFERHYNEQQNDIKSILQILNTSKGLASFIKTSG 63 Query: 54 FISIALP--IGSFPALRTWI 71 I+ +L I + L+ W+ Sbjct: 64 AITASLSAIIYALYNLKAWL 83 Searching..................................................done Results from round 2 CONVERGED! >gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] gi|254040796|gb|ACT57592.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 152 bits (383), Expect = 2e-35, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP Sbjct: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 Query: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 IGSFPALRTWIIHHVVGLLKKLFPF Sbjct: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 >gi|315122887|ref|YP_004063376.1| hypothetical protein CKC_05715 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496289|gb|ADR52888.1| hypothetical protein CKC_05715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 85 Score = 38.0 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 11/80 (13%) Query: 3 RVEFVEMKGEVTLLKQKVDCLIAQ-------FNKQQSVIDEFFTILTTAKGFTAFIK--G 53 R E K E L KVDCLI +N+QQ+ I IL T+KG +FIK G Sbjct: 4 RQEQYVTKQEFNELNAKVDCLITHCKVFERHYNEQQNDIKSILQILNTSKGLASFIKTSG 63 Query: 54 FISIALP--IGSFPALRTWI 71 I+ +L I + L+ W+ Sbjct: 64 AITASLSAIIYALYNLKAWL 83 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.331 0.144 0.430 Lambda K H 0.267 0.0462 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,750,846,584 Number of Sequences: 14124377 Number of extensions: 66356410 Number of successful extensions: 195884 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 195869 Number of HSP's gapped (non-prelim): 19 length of query: 85 length of database: 4,842,793,630 effective HSP length: 55 effective length of query: 30 effective length of database: 4,065,952,895 effective search space: 121978586850 effective search space used: 121978586850 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 76 (33.7 bits)