RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >2v4n_A Multifunctional protein SUR E; hydrolase, surviVal protein, stationary phase, phosphatase, mononucleotidase, divalent metal ION; 1.7A {Salmonella typhimurium} PDB: 2v4o_A (A:1-233) Length = 233 Score = 26.8 bits (59), Expect = 1.1 Identities = 13/69 (18%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Query: 15 LLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALPIGSFPALRTWIIHH 74 L++ + D +++ N ++ D+ T A GF ++A+ + + T Sbjct: 80 LMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLNGYQHYDT-AAAV 138 Query: 75 VVGLLKKLF 83 LL+ L Sbjct: 139 TCALLRGLS 147 >1ccw_B Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold; HET: TAR CNC; 1.60A {Clostridium cochlearium} (B:1-409) Length = 409 Score = 24.3 bits (53), Expect = 5.4 Identities = 9/33 (27%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Query: 42 TTAKGFTAFIKGFISIALPIG-SFP---ALRTW 70 A G+T+ G IS +P + +L W Sbjct: 162 IHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDW 194 >2b0t_A NADP isocitrate dehydrogenase; monomeric, IDH, oxidoreductase; 1.75A {Corynebacterium glutamicum} (A:179-227,A:416-459) Length = 93 Score = 23.8 bits (52), Expect = 9.2 Identities = 4/18 (22%), Positives = 10/18 (55%) Query: 3 RVEFVEMKGEVTLLKQKV 20 +++ + G T+LK + Sbjct: 17 QIKHIAADGTETILKDSL 34 >1itw_A Isocitrate dehydrogenase; greece KEY motif, oxidoreductase; HET: ICT; 1.95A {Azotobacter vinelandii} (A:181-229,A:421-463) Length = 92 Score = 23.8 bits (52), Expect = 9.5 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 3 RVEFVEMKGEVTLLKQKV 20 ++E + G T+LK K Sbjct: 17 KIELIAKDGSSTVLKAKT 34 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.331 0.144 0.430 Gapped Lambda K H 0.267 0.0601 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 628,732 Number of extensions: 21582 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 6 Length of query: 85 Length of database: 4,956,049 Length adjustment: 48 Effective length of query: 37 Effective length of database: 3,333,409 Effective search space: 123336133 Effective search space used: 123336133 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.3 bits)