BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 171 bits (434), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP Sbjct: 1 MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALP 60 Query: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 IGSFPALRTWIIHHVVGLLKKLFPF Sbjct: 61 IGSFPALRTWIIHHVVGLLKKLFPF 85 >gi|254781178|ref|YP_003065591.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Score = 22.7 bits (47), Expect = 1.3, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 8/45 (17%) Query: 38 FTILTTAKGFTAFIKGFISIALPIGSFPALRTWIIHHVVGLLKKL 82 F +L+ G T F+K + ++ A R W +H G++ KL Sbjct: 204 FEVLSNIAGITKFVKAY--------NWIAERRWDLHLHNGIIIKL 240 >gi|254780458|ref|YP_003064871.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 449 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Query: 2 TRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKG 53 +R+E E ++ + K+ + N+ +S++DE+ +L +AF +G Sbjct: 293 SRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLV----ISAFAEG 340 >gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] Length = 31 Score = 20.8 bits (42), Expect = 4.8, Method: Compositional matrix adjust. Identities = 6/20 (30%), Positives = 11/20 (55%) Query: 13 VTLLKQKVDCLIAQFNKQQS 32 V L +DC++ NK++ Sbjct: 7 VIYLSNSMDCILGYMNKEEE 26 >gi|254781171|ref|YP_003065584.1| hypothetical protein CLIBASIA_05390 [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Score = 20.4 bits (41), Expect = 6.5, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 50 FIKGFISIALPIGSFPAL 67 +IKGF + + G FPAL Sbjct: 243 YIKGFNPLTIVKGMFPAL 260 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 20.0 bits (40), Expect = 8.1, Method: Composition-based stats. Identities = 7/20 (35%), Positives = 15/20 (75%) Query: 15 LLKQKVDCLIAQFNKQQSVI 34 +L+ K+D ++QF + Q++I Sbjct: 516 ILENKIDIPLSQFIEDQNLI 535 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.144 0.430 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,481 Number of Sequences: 1233 Number of extensions: 1821 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 85 length of database: 328,796 effective HSP length: 54 effective length of query: 31 effective length of database: 262,214 effective search space: 8128634 effective search space used: 8128634 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 31 (16.5 bits)