RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >gnl|CDD|112412 pfam03594, BenE, Benzoate membrane transport protein. Length = 378 Score = 29.2 bits (66), Expect = 0.71 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Query: 10 FVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTV 68 F PR L VL+V +A P P L + +R ++ P+ + + SL++P+ + Sbjct: 161 FAPRYAVLAVLLVGVAAAALLGQVHPAP-LPLELAR-PQWITPEFSWQATLSLALPLYL 217 >gnl|CDD|36707 KOG1494, KOG1494, KOG1494, NAD-dependent malate dehydrogenase [Energy production and conversion]. Length = 345 Score = 28.3 bits (63), Expect = 1.3 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 18/124 (14%) Query: 64 VPVTVEPLEGVRHGVN-----FFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNA 118 VP+ E L+ + GV F + +L + +V+E++ LD E V + V G +A Sbjct: 152 VPIAAEVLK--KAGVYDPKKLFGVTTLDVVRANTFVAEVLN---LDPAEDVDVPVIGGHA 206 Query: 119 SGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSL 178 TI + S + L ++ G VV AK+ G+ T LS + Sbjct: 207 GITIIPLLSQCKPPFRFTDDEIEALTHRIQNGGTEVVKAKAGAGSAT--------LSMAY 258 Query: 179 ADIR 182 A + Sbjct: 259 AGAK 262 >gnl|CDD|38842 KOG3636, KOG3636, KOG3636, Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only]. Length = 669 Score = 27.4 bits (60), Expect = 2.5 Identities = 17/68 (25%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Query: 53 DLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEE--NSAYVS---ELVMDYPLDEEE 107 +++ LC +SV E V FFI+ + E N+ ++S L L E E Sbjct: 300 QMSQALCLPISVIELTSHDEISSGSVRFFIVDCRPAEQYNAGHLSTAFHLDCVLMLQEPE 359 Query: 108 MVSLEVKG 115 ++ V Sbjct: 360 KFAIAVNS 367 >gnl|CDD|107367 cd06372, PBP1_GC_G_like, Ligand-binding domain of membrane guanylyl cyclase G. This group includes the ligand-binding domain of membrane guanylyl cyclase G (GC-G) which is a sperm surface receptor and might function, similar to its sea urchin counterpart, in the early signaling event that regulates the Ca2+ influx/efflux and subsequent motility response in sperm. GC-G appears to be a pseudogene in human. Furthermore, in contrast to the other orphan receptor GCs, GC-G has a broad tissue distribution in rat, including lung, intestine, kidney, and skeletal muscle. Length = 391 Score = 26.4 bits (58), Expect = 4.4 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 5/92 (5%) Query: 81 FIISLKKEEN----SAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEK 136 F SL EE SAY+ + V+ Y L +EM+ +N + ++ N+ + Sbjct: 288 FQSSLSSEEQVSPYSAYLHDAVLLYALAVKEMLKAGKDFRNGRQLVSTLRGA-NQVELQG 346 Query: 137 RSQDTVLIEEMKRGKELVVSAKSKRGTNTRYI 168 + +L E+ KR + V A K G ++ ++ Sbjct: 347 ITGLVLLDEQGKRQMDYSVYALQKSGNSSLFL 378 >gnl|CDD|36012 KOG0793, KOG0793, KOG0793, Protein tyrosine phosphatase [Signal transduction mechanisms]. Length = 1004 Score = 26.2 bits (57), Expect = 6.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 22 VSSVSAGYANASQPEPTLRNQFSRWS 47 +SSVS+ +++ P P+ R+ S WS Sbjct: 679 ISSVSSQFSDGPIPSPSSRSSTSSWS 704 >gnl|CDD|30089 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward.. Length = 322 Score = 25.6 bits (56), Expect = 8.2 Identities = 9/36 (25%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 5 VLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLR 40 VL+D F+ + +M++++S ++ TLR Sbjct: 284 VLRDSFIGNSK---TVMIATISPSASSCEHTLNTLR 316 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.134 0.374 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,129,281 Number of extensions: 103750 Number of successful extensions: 231 Number of sequences better than 10.0: 1 Number of HSP's gapped: 231 Number of HSP's successfully gapped: 9 Length of query: 185 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 97 Effective length of database: 4,362,145 Effective search space: 423128065 Effective search space used: 423128065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.6 bits)