RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >gnl|CDD|179427 PRK02471, PRK02471, bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional. Length = 752 Score = 27.6 bits (62), Expect = 1.8 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 10/67 (14%) Query: 94 VSELVMDYPLDEEEMVSLEVKGKN--ASGTIFKMKSYNNRAAFEK------RSQDTVLIE 145 + E + DY L ++ + ++ K N +IFK + +EK R +VL+E Sbjct: 512 LEEALADYSLFADKAIVVKPKSTNFGLGISIFKEP--ASLEDYEKALEIAFREDSSVLVE 569 Query: 146 EMKRGKE 152 E G E Sbjct: 570 EFIVGTE 576 >gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional. Length = 1021 Score = 27.8 bits (61), Expect = 1.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 131 RAAFEKRSQDTVLIEEMKRGKELVVSAKSK 160 + F K + + LI E+KRG +L + KSK Sbjct: 240 KTPFHKANNFSQLISELKRGPDLPIKGKSK 269 >gnl|CDD|182589 PRK10614, PRK10614, multidrug efflux system subunit MdtC; Provisional. Length = 1025 Score = 27.4 bits (61), Expect = 2.3 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Query: 161 RGTNTRYIYSLIGLSDSLADIRK 183 R +N Y Y+L LSD LA +R+ Sbjct: 655 RQSNASYQYTL--LSDDLAALRE 675 >gnl|CDD|169981 PRK09577, PRK09577, multidrug efflux protein; Reviewed. Length = 1032 Score = 26.4 bits (58), Expect = 5.3 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 113 VKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKR 149 V GK A+G K+ +N A EKR + T ++E+ R Sbjct: 280 VNGKTATGMGIKLAPGSNAVATEKRVRAT--MDELSR 314 >gnl|CDD|182021 PRK09662, PRK09662, GspL-like protein; Provisional. Length = 286 Score = 25.5 bits (55), Expect = 7.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 34 QPEPTLRNQFSRWSVYVYPDL 54 QP + R Q++RW V + P L Sbjct: 122 QPRVSYRKQWARWRVMILPIL 142 >gnl|CDD|182160 PRK09947, PRK09947, hypothetical protein; Provisional. Length = 215 Score = 25.5 bits (56), Expect = 8.4 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 141 TVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN 185 +VL+EE+K + A G+ Y YS +S++ A + Sbjct: 77 SVLLEELKENGDYADIA-CLTGSQDDYYYSTQAMSENYAAMSLQV 120 >gnl|CDD|184181 PRK13612, PRK13612, photosystem II reaction center protein Psb28; Provisional. Length = 113 Score = 25.3 bits (56), Expect = 9.1 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 7/34 (20%) Query: 101 YPLDEE-EMVSLEVKGKNASGT------IFKMKS 127 Y +DEE E+V+ EVK K +G + KS Sbjct: 55 YMIDEEGEIVTREVKAKFVNGKPSALEATYIWKS 88 >gnl|CDD|161661 TIGR00007, TIGR00007, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase. Examples of this enzyme in Actinobacteria have been found to be bifunctional, also possessing phosphoribosylanthranilate isomerase activity ; the trusted cutoff here has now been raised to 275.0 to exclude the bifunctional group, now represented by model TIGR01919. HisA from Lactococcus lactis was reported to be inactive (MEDLINE:93322317). Length = 230 Score = 25.2 bits (56), Expect = 9.7 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 13/70 (18%) Query: 56 KKLCFSLSVPVTVEPLEGVRH----------GVNFFIISLKKEENSAYVSELVMDYPLDE 105 KK+ VPV V G+R GV+ II EN V EL+ +Y E Sbjct: 65 KKIVRETGVPVQVG--GGIRSLEDVEKLLDLGVDRVIIGTAAVENPDLVKELLKEYG-PE 121 Query: 106 EEMVSLEVKG 115 +VSL+ +G Sbjct: 122 RIVVSLDARG 131 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.134 0.374 Gapped Lambda K H 0.267 0.0629 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,916,776 Number of extensions: 173267 Number of successful extensions: 306 Number of sequences better than 10.0: 1 Number of HSP's gapped: 306 Number of HSP's successfully gapped: 16 Length of query: 185 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 97 Effective length of database: 4,092,969 Effective search space: 397017993 Effective search space used: 397017993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.8 bits)