RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781121|ref|YP_003065534.1| hypothetical protein
CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62]
         (185 letters)



>gnl|CDD|179427 PRK02471, PRK02471, bifunctional glutamate--cysteine
           ligase/glutathione synthetase; Provisional.
          Length = 752

 Score = 27.6 bits (62), Expect = 1.8
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 10/67 (14%)

Query: 94  VSELVMDYPLDEEEMVSLEVKGKN--ASGTIFKMKSYNNRAAFEK------RSQDTVLIE 145
           + E + DY L  ++ + ++ K  N     +IFK     +   +EK      R   +VL+E
Sbjct: 512 LEEALADYSLFADKAIVVKPKSTNFGLGISIFKEP--ASLEDYEKALEIAFREDSSVLVE 569

Query: 146 EMKRGKE 152
           E   G E
Sbjct: 570 EFIVGTE 576


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 27.8 bits (61), Expect = 1.8
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 131 RAAFEKRSQDTVLIEEMKRGKELVVSAKSK 160
           +  F K +  + LI E+KRG +L +  KSK
Sbjct: 240 KTPFHKANNFSQLISELKRGPDLPIKGKSK 269


>gnl|CDD|182589 PRK10614, PRK10614, multidrug efflux system subunit MdtC;
           Provisional.
          Length = 1025

 Score = 27.4 bits (61), Expect = 2.3
 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%)

Query: 161 RGTNTRYIYSLIGLSDSLADIRK 183
           R +N  Y Y+L  LSD LA +R+
Sbjct: 655 RQSNASYQYTL--LSDDLAALRE 675


>gnl|CDD|169981 PRK09577, PRK09577, multidrug efflux protein; Reviewed.
          Length = 1032

 Score = 26.4 bits (58), Expect = 5.3
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 113 VKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKR 149
           V GK A+G   K+   +N  A EKR + T  ++E+ R
Sbjct: 280 VNGKTATGMGIKLAPGSNAVATEKRVRAT--MDELSR 314


>gnl|CDD|182021 PRK09662, PRK09662, GspL-like protein; Provisional.
          Length = 286

 Score = 25.5 bits (55), Expect = 7.9
 Identities = 9/21 (42%), Positives = 13/21 (61%)

Query: 34  QPEPTLRNQFSRWSVYVYPDL 54
           QP  + R Q++RW V + P L
Sbjct: 122 QPRVSYRKQWARWRVMILPIL 142


>gnl|CDD|182160 PRK09947, PRK09947, hypothetical protein; Provisional.
          Length = 215

 Score = 25.5 bits (56), Expect = 8.4
 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 141 TVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN 185
           +VL+EE+K   +    A    G+   Y YS   +S++ A +    
Sbjct: 77  SVLLEELKENGDYADIA-CLTGSQDDYYYSTQAMSENYAAMSLQV 120


>gnl|CDD|184181 PRK13612, PRK13612, photosystem II reaction center protein Psb28;
           Provisional.
          Length = 113

 Score = 25.3 bits (56), Expect = 9.1
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 7/34 (20%)

Query: 101 YPLDEE-EMVSLEVKGKNASGT------IFKMKS 127
           Y +DEE E+V+ EVK K  +G        +  KS
Sbjct: 55  YMIDEEGEIVTREVKAKFVNGKPSALEATYIWKS 88


>gnl|CDD|161661 TIGR00007, TIGR00007, phosphoribosylformimino-5-aminoimidazole
           carboxamide ribotide isomerase.  Examples of this enzyme
           in Actinobacteria have been found to be bifunctional,
           also possessing phosphoribosylanthranilate isomerase
           activity ; the trusted cutoff here has now been raised
           to 275.0 to exclude the bifunctional group, now
           represented by model TIGR01919. HisA from Lactococcus
           lactis was reported to be inactive (MEDLINE:93322317).
          Length = 230

 Score = 25.2 bits (56), Expect = 9.7
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 13/70 (18%)

Query: 56  KKLCFSLSVPVTVEPLEGVRH----------GVNFFIISLKKEENSAYVSELVMDYPLDE 105
           KK+     VPV V    G+R           GV+  II     EN   V EL+ +Y   E
Sbjct: 65  KKIVRETGVPVQVG--GGIRSLEDVEKLLDLGVDRVIIGTAAVENPDLVKELLKEYG-PE 121

Query: 106 EEMVSLEVKG 115
             +VSL+ +G
Sbjct: 122 RIVVSLDARG 131


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.319    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0629    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 2,916,776
Number of extensions: 173267
Number of successful extensions: 306
Number of sequences better than 10.0: 1
Number of HSP's gapped: 306
Number of HSP's successfully gapped: 16
Length of query: 185
Length of database: 5,994,473
Length adjustment: 88
Effective length of query: 97
Effective length of database: 4,092,969
Effective search space: 397017993
Effective search space used: 397017993
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (24.8 bits)