RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >3dtd_A Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae} Length = 175 Score = 80.9 bits (199), Expect = 2e-16 Identities = 28/171 (16%), Positives = 54/171 (31%), Gaps = 16/171 (9%) Query: 21 MVSSVSAGYANASQP--EPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGV 78 S + A+ P +L + WS+ KK+CF V + R V Sbjct: 5 NSKSTTTKDTVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQEVNDQN----RVVV 60 Query: 79 NFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRS 138 ++ S ++ + + + V L+V A +++ Sbjct: 61 AMSVVLNADGVVSGNLT-VPFGILVSKP--VRLQVDEGKAVIE-TGIRTCVPAGCIVPIV 116 Query: 139 QDTVLIEEMKRGKELVVS---AKSKRGTNTRYIYSLIGLS---DSLADIRK 183 D + ++ GK L ++ A L G S + L ++K Sbjct: 117 FDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIALQK 167 >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 28.0 bits (62), Expect = 1.5 Identities = 4/20 (20%), Positives = 9/20 (45%), Gaps = 1/20 (5%) Query: 135 EKRSQDTVLIEEMKRGKELV 154 E + ++E G ++V Sbjct: 26 ECKVYPPKIVERFSEG-DVV 44 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.134 0.374 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,502,915 Number of extensions: 65258 Number of successful extensions: 121 Number of sequences better than 10.0: 1 Number of HSP's gapped: 119 Number of HSP's successfully gapped: 3 Length of query: 185 Length of database: 5,693,230 Length adjustment: 87 Effective length of query: 98 Effective length of database: 3,584,002 Effective search space: 351232196 Effective search space used: 351232196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.9 bits)