BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 378 bits (970), Expect = e-107, Method: Compositional matrix adjust. Identities = 185/185 (100%), Positives = 185/185 (100%) Query: 1 MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCF 60 MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCF Sbjct: 1 MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCF 60 Query: 61 SLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASG 120 SLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASG Sbjct: 61 SLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASG 120 Query: 121 TIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLAD 180 TIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLAD Sbjct: 121 TIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLAD 180 Query: 181 IRKCN 185 IRKCN Sbjct: 181 IRKCN 185 >gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 26.6 bits (57), Expect = 0.25, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Query: 39 LRNQFS---RWSVYVYPDLNKKLCFSLSVPVTVEPLEGVR-----HGVNFFIISLKKEE 89 L+N +S +W Y Y +N L SLS+ +V +E +R +G+ F+ L KEE Sbjct: 163 LQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEE 221 >gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Query: 111 LEVKGKNASGTIFKMKS--YNNRAAFEKRSQ----DTVLIEEMKRGKELVVSAKSKRGTN 164 LEVK +GT F+ +R +KR + TV I+E++ K +VS+ + R Sbjct: 116 LEVK-TVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTAL 174 Query: 165 TR 166 T+ Sbjct: 175 TK 176 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 22.7 bits (47), Expect = 4.0, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 14 IRFLIVLMVSSVSAGYANASQPEPTLRNQF 43 +R IVLM + + AS+ E T+R++ Sbjct: 200 VRKEIVLMTEEIDRAISRASELEKTVRSEI 229 >537021.9.peg.753_1 Length = 1033 Score = 22.7 bits (47), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 136 KRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLAD 180 +R+ + EEM + KE +S SK G + ++ L AD Sbjct: 714 RRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFAD 758 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.134 0.374 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,465 Number of Sequences: 1233 Number of extensions: 4315 Number of successful extensions: 13 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 8 length of query: 185 length of database: 328,796 effective HSP length: 69 effective length of query: 116 effective length of database: 243,719 effective search space: 28271404 effective search space used: 28271404 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)