RPSBLAST alignment of GI: 254781122 and protein with PDBid: 1ig0

>1ig0_A Thiamin pyrophosphokinase; protein-substrate complex, compound active site, alpha-beta- alpha, beta sandwich, transferase; HET: VIB; 1.80A {Saccharomyces cerevisiae} SCOP: b.82.6.1 c.100.1.1 Length = 319
 Score = 75.1 bits (184), Expect = 1e-14
 Identities = 35/253 (13%), Positives = 73/253 (28%), Gaps = 67/253 (26%)

Query: 14  ILLNGDIRVTNRLLCAI-ESCKV-IAADGG---------ICHASQLKVVPELWIGDFDSV 62
           ++LN  I +   L   I +   + + ADG               ++K +P   IGD DS+
Sbjct: 42  LILNQKIDIPRPLFYKIWKLHDLKVCADGAANRLYDYLDDDETLRIKYLPNYIIGDLDSL 101

Query: 63  DRTLLQQWSSIK-RIFYPNDKDMADGEIAV------------------------------ 91
              + + +   K  I     +   D    V                              
Sbjct: 102 SEKVYKYYRKNKVTIIKQTTQYSTDFTKCVNLISLHFNSPEFRSLISNKDNLQSNHGIEL 161

Query: 92  --------------HKALQSGARNIILVGSISGQRFDYALQHITLATSLKKK--NINVTL 135
                             +    +++ +G I G RFD  +  IT   +L +      +  
Sbjct: 162 EKGIHTLYNTMTESLVFSKVTPISLLALGGIGG-RFDQTVHSITQLYTLSENASYFKLCY 220

Query: 136 TSGIEEVFILVPGKH------SFDLPENSVFSIVCL-EDIENITITGAKYTLSH-HSLSL 187
            +  + +F++            F         ++ + E        G K+ + +  +  +
Sbjct: 221 MTPTDLIFLIKKNGTLIEYDPQFRNTCIGNCGLLPIGEATLVKETRGLKWDVKNWPTSVV 280

Query: 188 GSSRAVSNVVTKN 200
               + SN    +
Sbjct: 281 TGRVSSSNRFVGD 293