RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781122|ref|YP_003065535.1| putative thiamine
pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62]
         (222 letters)



>d1ig3a2 c.100.1.1 (A:10-178) Thiamin pyrophosphokinase, catalytic
           domain {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 169

 Score = 69.6 bits (170), Expect = 2e-13
 Identities = 26/140 (18%), Positives = 53/140 (37%), Gaps = 20/140 (14%)

Query: 14  ILLNGDIRVTNRLLCAI--ESCKVIAADGGICHASQL------KVVPELWIGDFDSVDRT 65
           ++LN  +   +     +  ++     ADGG  H   L        +PE   GDFDS+   
Sbjct: 33  VVLNQPL---DARFRHLWKKALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPE 89

Query: 66  LLQQWSS-IKRIFYPNDKDMADGEIAVH------KALQSGARNIILVGSISGQRFDYALQ 118
           + + ++     +    D+D  D    +       +  +     I+ +G + G RFD  + 
Sbjct: 90  VKEYYTKKGCDLISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGG-RFDQIMA 148

Query: 119 HI-TLATSLKKKNINVTLTS 137
            + TL  +     + + +  
Sbjct: 149 SVNTLFQATHITPVPIIIIQ 168


>d1ig0a2 c.100.1.1 (A:3-223) Thiamin pyrophosphokinase, catalytic
           domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId:
           4932]}
          Length = 221

 Score = 52.4 bits (125), Expect = 3e-08
 Identities = 26/158 (16%), Positives = 45/158 (28%), Gaps = 17/158 (10%)

Query: 5   HTNKFIDFA-ILLNGDIRVTNRLLCAI--ESCKVIAADGGICH---------ASQLKVVP 52
           H N+  +   ++LN  I +   L   I       + ADG               ++K +P
Sbjct: 30  HPNEDENSTLLILNQKIDIPRPLFYKIWKLHDLKVCADGAANRLYDYLDDDETLRIKYLP 89

Query: 53  ELWIGDFDSVDRTLLQQWSSIK-RIFYPNDKDMADGEIAVHKALQ----SGARNIILVGS 107
              IGD DS+   + + +   K  I     +   D    V+           R++I    
Sbjct: 90  NYIIGDLDSLSEKVYKYYRKNKVTIIKQTTQYSTDFTKCVNLISLHFNSPEFRSLISNKD 149

Query: 108 ISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFIL 145
                    L+              V        +  L
Sbjct: 150 NLQSNHGIELEKGIHTLYNTMTESLVFSKVTPISLLAL 187


>d1ig3a1 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase,
           substrate-binding domain {Mouse (Mus musculus) [TaxId:
           10090]}
          Length = 85

 Score = 48.6 bits (116), Expect = 4e-07
 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 142 VFILVPGKHSFDLPENSVFSIVCL----EDIENITITGAKYTLSHHSLSLGSSRAVSNVV 197
           +++L PGKH   +      S   L    +    +T TG K+ L++  L  G+  + SN  
Sbjct: 4   IYLLQPGKHRLHVDTGMEGSWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTY 63

Query: 198 TKNLTIMLDQGLAILIS 214
             +  + ++    +L +
Sbjct: 64  DGSGLVTVETDHPLLWT 80


>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum
           purpureum), endo-polygalacturonase I [TaxId: 58369]}
          Length = 333

 Score = 27.3 bits (60), Expect = 1.1
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 157 NSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSR-----AVSNVVTKNLTIMLDQGLAI 211
            S+ SI   + + N+ I G   T S + + + + R     +VS V     TI       +
Sbjct: 195 ISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGV 254

Query: 212 LISRPY 217
           LIS+ Y
Sbjct: 255 LISQSY 260


>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter
           freundii [TaxId: 546]}
          Length = 397

 Score = 26.2 bits (57), Expect = 2.2
 Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 67  LQQWSSIKRIFYPNDKDMADGEIAVHKALQSGAR-NIILVGSI-SGQRFDYALQHITLAT 124
           L+   SI R++YP        E+   +    G   +  + G + +G+R   +++   LA 
Sbjct: 278 LEGHPSITRVYYPGLSSHPQYELGQRQMSLPGGIISFEIAGGLEAGRRMINSVELCLLAV 337

Query: 125 SL 126
           SL
Sbjct: 338 SL 339


>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis
           [TaxId: 1773]}
          Length = 418

 Score = 26.2 bits (57), Expect = 2.3
 Identities = 9/42 (21%), Positives = 10/42 (23%), Gaps = 2/42 (4%)

Query: 7   NKFIDFAILLNGDIRVTNRLLCAIESCK--VIAADGGICHAS 46
             FI       G  R  N +   I   K     AD       
Sbjct: 246 QPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETG 287


>gi|93140497|sp|P0C1A2.1|PELA_ERWCH(40-393:393) RecName:
           Full=Pectate lyase A; Flags: Precursor 
           gi|148449|gb|AAA24843.1| pectate lyase A, precursor (EC
           4.2.2.2)   gi|47168462|pdb|1OOC|A Chain A, Mutations In
           The T1.5 Loop Of Pectate Lyase A 
           gi|47168463|pdb|1OOC|B Chain B, Mutations In The T1.5
           Loop Of Pectate Lyase A   gi|47168541|pdb|1PE9|A Chain
           A, Mutations In The T1.5 Loop Of Pectate Lyase A 
           gi|47168542|pdb|1PE9|B Chain B, Mutations In The T1.5
           Loop Of Pectate Lyase A   gi|21730393|pdb|1JRG|A Chain
           A, Crystal Structure Of The R3 Form Of Pectate Lyase A,
           Erwinia Chrysanthemi   gi|21730394|pdb|1JRG|B Chain B,
           Crystal Structure Of The R3 Form Of Pectate Lyase A,
           Erwinia Chrysanthemi   gi|21730403|pdb|1JTA|A Chain A,
           Crystal Structure Of Pectate Lyase A (C2 Form)  E=1e-123
           s/c=1.25 id=65% cov=97%
          Length = 350

 Score = 26.2 bits (57), Expect = 2.4
 Identities = 9/41 (21%), Positives = 18/41 (43%), Gaps = 2/41 (4%)

Query: 165 LEDIENITI--TGAKYTLSHHSLSLGSSRAVSNVVTKNLTI 203
           +    N T+   G      + SL +  +   +NV+ +N+ I
Sbjct: 72  INIPANTTVIGLGTDAKFINGSLIIDGTDGTNNVIIRNVYI 112


>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas
           vaginalis, MGL1 [TaxId: 5722]}
          Length = 394

 Score = 25.6 bits (55), Expect = 3.3
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 73  IKRIFYPNDKDMADGEIAVHKALQSGA--RNIILVGSISGQRFDYALQHITLATSL 126
           +++++YP  +D    +IA  +    G+    I+  G    ++    L+ ITLA SL
Sbjct: 281 VEKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEGAKKLLDNLKLITLAVSL 336


>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase
           {Thermus thermophilus [TaxId: 274]}
          Length = 421

 Score = 24.4 bits (52), Expect = 7.3
 Identities = 10/59 (16%), Positives = 20/59 (33%), Gaps = 7/59 (11%)

Query: 73  IKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISG-----QRFDYALQHITLATSL 126
           +  + YP        + A       G    +L   + G     +RF   L+ I+   ++
Sbjct: 311 VAWVNYPGLPHHPHHDRAQKY--FKGKPGAVLTFGLKGGYEAAKRFISRLKLISHLANV 367


>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common
           tobacco (Nicotiana tabacum) [TaxId: 4097]}
          Length = 398

 Score = 24.4 bits (52), Expect = 7.8
 Identities = 12/62 (19%), Positives = 25/62 (40%), Gaps = 2/62 (3%)

Query: 67  LQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILV--GSISGQRFDYALQHITLAT 124
           L+    ++ ++YP  +   +  IA  +    G      V    ++  +F  AL+   +A 
Sbjct: 281 LEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAP 340

Query: 125 SL 126
           S 
Sbjct: 341 SF 342


>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B
           [TaxId: 5061]}
          Length = 359

 Score = 24.3 bits (52), Expect = 8.8
 Identities = 9/37 (24%), Positives = 16/37 (43%), Gaps = 4/37 (10%)

Query: 170 NITITG--AKYTLSHHSLSLGSSRAVSNVVTKNLTIM 204
           N +I G   K  +    L + S     NV+ +N+ + 
Sbjct: 109 NKSIVGQGTKGVIKGKGLRVVSG--AKNVIIQNIAVT 143


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.322    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0476    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 813,203
Number of extensions: 36389
Number of successful extensions: 117
Number of sequences better than 10.0: 1
Number of HSP's gapped: 112
Number of HSP's successfully gapped: 15
Length of query: 222
Length of database: 2,407,596
Length adjustment: 82
Effective length of query: 140
Effective length of database: 1,281,736
Effective search space: 179443040
Effective search space used: 179443040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.0 bits)