RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|177550 PHA03173, PHA03173, UL37 tegument protein; Provisional. Length = 1028 Score = 25.4 bits (56), Expect = 3.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 59 EGYRLHICALIKLLE 73 +GYR + ALI LLE Sbjct: 638 DGYRTKLTALIALLE 652 >gnl|CDD|177874 PLN02229, PLN02229, alpha-galactosidase. Length = 427 Score = 25.3 bits (55), Expect = 4.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Query: 43 DPLIEPVEIGKEGMVDEGYRLH--ICALIK 70 DP + +E+G GM E YR H I AL+K Sbjct: 267 DP--DMLEVGNGGMTYEEYRGHFSIWALMK 294 >gnl|CDD|130805 TIGR01744, XPRTase, xanthine phosphoribosyltransferase. This model represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria. The adjacent gene is a xanthine transporter; B. subtilis can import xanthine for the purine salvage pathway or for catabolism to obtain nitrogen. Length = 191 Score = 24.4 bits (53), Expect = 6.3 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 11/41 (26%) Query: 34 IEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLEN 74 IEK+ + G++ +V+ GYR+ A I+ LE Sbjct: 154 IEKSFQN-----------GRQELVELGYRVESLARIQSLEE 183 >gnl|CDD|163198 TIGR03272, methan_mark_6, putative methanogenesis marker protein 6. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. Length = 132 Score = 24.3 bits (53), Expect = 7.3 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Query: 9 APKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDE 59 P+ G + L EV ++L I +ALE P VE ++ VDE Sbjct: 80 GPRPG--FHQLEAEV-----ELLDRIGEALEKLEKPKEVEVEEPEKISVDE 123 >gnl|CDD|177774 PLN00179, PLN00179, acyl- [acyl-carrier protein] desaturase. Length = 390 Score = 23.9 bits (52), Expect = 8.8 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query: 17 RPLRKEVRNAFPKILKSIEKALEPYVD----PLIEPVE 50 R + +V ++ P I K+LE + + PL++PVE Sbjct: 47 REVHVQVTHSMPPEKLEIFKSLEGWAEENLLPLLKPVE 84 >gnl|CDD|161900 TIGR00487, IF-2, translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU. Length = 587 Score = 24.0 bits (52), Expect = 8.8 Identities = 8/32 (25%), Positives = 15/32 (46%) Query: 22 EVRNAFPKILKSIEKALEPYVDPLIEPVEIGK 53 + K++ I A++ +DP E IG+ Sbjct: 463 RYYSVIYKLIDEIRAAMKGMLDPEYEEEIIGQ 494 >gnl|CDD|179229 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional. Length = 679 Score = 24.0 bits (53), Expect = 9.8 Identities = 9/14 (64%), Positives = 11/14 (78%), Gaps = 2/14 (14%) Query: 43 DP--LIEPVEIGKE 54 +P LIE VEIGK+ Sbjct: 551 NPTKLIEVVEIGKQ 564 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.137 0.398 Gapped Lambda K H 0.267 0.0679 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,622,406 Number of extensions: 90087 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's gapped: 149 Number of HSP's successfully gapped: 21 Length of query: 101 Length of database: 5,994,473 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,525,129 Effective search space: 149329257 Effective search space used: 149329257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.1 bits)