RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Score = 24.4 bits (53), Expect = 2.4 Identities = 11/54 (20%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 7 MYAPKEGNQYRPLRKEVRNAFPKILKSI--EKALEPYVDPLIEPVEIGKEGMVD 58 YA + G++Y+ + E++ K L + + E + + ++ K+ VD Sbjct: 17 EYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVD 70 >d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 235 Score = 24.1 bits (52), Expect = 3.2 Identities = 5/16 (31%), Positives = 10/16 (62%) Query: 2 NPHGLMYAPKEGNQYR 17 +P+G +YA + Y+ Sbjct: 95 DPNGYLYAVSKDKLYK 110 >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Score = 23.7 bits (51), Expect = 4.2 Identities = 12/52 (23%), Positives = 27/52 (51%) Query: 7 MYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVD 58 Y+ +EG+++ +KE++ K L K + + L+E ++ K+ V+ Sbjct: 17 KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVN 68 >d1ewfa1 d.83.1.1 (A:1-217) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Score = 23.4 bits (50), Expect = 5.0 Identities = 9/43 (20%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Query: 17 RPLRKEVRNAF-PKILKSIEKALEPYVDPLIEPVEIGKEGMVD 58 LR ++ + K+ S+ L+PY L +I ++ Sbjct: 164 SALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGIN 206 >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Score = 23.2 bits (49), Expect = 5.6 Identities = 6/25 (24%), Positives = 9/25 (36%) Query: 10 PKEGNQYRPLRKEVRNAFPKILKSI 34 N L E + A P L ++ Sbjct: 142 TPSNNAAARLAYETKQAMPNKLVTV 166 >d1afra_ a.25.1.2 (A:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 345 Score = 22.9 bits (49), Expect = 8.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 30 ILKSIEKALEPYVDPLIEPVE 50 I KS++ E + ++PVE Sbjct: 21 IFKSLDNWAEENILVHLKPVE 41 >d1qbaa4 d.92.2.1 (A:201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens [TaxId: 615]} Length = 137 Score = 22.4 bits (47), Expect = 9.9 Identities = 14/69 (20%), Positives = 19/69 (27%), Gaps = 14/69 (20%) Query: 11 KEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPL--------------IEPVEIGKEGM 56 K Q LRK V ++K + L I+P + Sbjct: 25 KVHAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKGAMA 84 Query: 57 VDEGYRLHI 65 V Y L I Sbjct: 85 VSGAYELKI 93 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.137 0.398 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 373,014 Number of extensions: 16005 Number of successful extensions: 32 Number of sequences better than 10.0: 1 Number of HSP's gapped: 32 Number of HSP's successfully gapped: 12 Length of query: 101 Length of database: 2,407,596 Length adjustment: 62 Effective length of query: 39 Effective length of database: 1,556,336 Effective search space: 60697104 Effective search space used: 60697104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.4 bits)