BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781125|ref|YP_003065538.1| hypothetical protein CLIBASIA_05135 [Candidatus Liberibacter asiaticus str. psy62] (59 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781125|ref|YP_003065538.1| hypothetical protein CLIBASIA_05135 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 121 bits (304), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML 59 MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML Sbjct: 1 MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML 59 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 32.0 bits (71), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query: 6 EYIRCLNDPNRYRL--SAKDPHYNVIFRDEVPSFIYETLNIPADKRKM 51 E CL +RY + + P Y VI VP FI++ L+IP +KR++ Sbjct: 109 EACACLTQYDRYEVIYNFGGPMYGVI----VPDFIHDLLDIPEEKRRL 152 >gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 26.6 bits (57), Expect = 0.090, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 25 HYNVIFRDEVPSFIYETLN 43 H V+F DE+P F +TLN Sbjct: 81 HNGVLFLDEIPEFSPQTLN 99 >gi|254781208|ref|YP_003065621.1| hypothetical protein CLIBASIA_05575 [Candidatus Liberibacter asiaticus str. psy62] Length = 578 Score = 23.9 bits (50), Expect = 0.49, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 18/40 (45%) Query: 17 YRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRS 56 YR DP N +F +P Y L K ++ V+RS Sbjct: 57 YRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRS 96 >gi|254781203|ref|YP_003065616.1| hypothetical protein CLIBASIA_05550 [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 22.7 bits (47), Expect = 1.3, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 12 NDPNRYRLSAKDPH 25 + PN YR S DPH Sbjct: 59 DQPNYYRGSRTDPH 72 >gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] Length = 180 Score = 21.9 bits (45), Expect = 1.9, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 4 ILEYIRCLNDPNRY 17 I E+ CL PNRY Sbjct: 141 ISEFAACLEHPNRY 154 >gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Score = 20.4 bits (41), Expect = 5.3, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 14 PNRYRLSAKDPHYNVIFRDEVPSFIYE 40 PN + + N IFRD + + I+E Sbjct: 425 PNSFFEANSTHELNKIFRDRIGNEIFE 451 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.141 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,598 Number of Sequences: 1233 Number of extensions: 1230 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 59 length of database: 328,796 effective HSP length: 31 effective length of query: 28 effective length of database: 290,573 effective search space: 8136044 effective search space used: 8136044 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)