BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] gi|254040803|gb|ACT57599.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 172 bits (436), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK Sbjct: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 Query: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 ARCKYRKESKLQKLSKSKIFSIKHT Sbjct: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] gi|254040661|gb|ACT57457.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 63.5 bits (153), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 30/49 (61%), Positives = 38/49 (77%) Query: 18 ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66 ITR + L +++KKAFF HEKKV +LNYNA DRK NI++ Y+AR KYR Sbjct: 65 ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 Searching..................................................done Results from round 2 CONVERGED! >gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] gi|254040803|gb|ACT57599.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 132 bits (331), Expect = 2e-29, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK Sbjct: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 Query: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 ARCKYRKESKLQKLSKSKIFSIKHT Sbjct: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] gi|254040661|gb|ACT57457.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 79.7 bits (195), Expect = 1e-13, Method: Composition-based stats. Identities = 30/49 (61%), Positives = 38/49 (77%) Query: 18 ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66 ITR + L +++KKAFF HEKKV +LNYNA DRK NI++ Y+AR KYR Sbjct: 65 ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 >gi|268323357|emb|CBH36945.1| probable phenylalanyl-tRNA synthetase, alpha chain [uncultured archaeon] Length = 527 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Query: 6 RDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKAR 62 +D+ RALVF+I +G A + D+ ++FF +K+ +N+ ++ S IDK+ + R Sbjct: 77 QDLPEKRALVFLIDKGRATV--DELQSFFDDDKESKIAINWLLRNKWSKIDKIGEER 131 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.319 0.137 0.370 Lambda K H 0.267 0.0434 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,505,561,824 Number of Sequences: 14124377 Number of extensions: 54020067 Number of successful extensions: 218894 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 218882 Number of HSP's gapped (non-prelim): 20 length of query: 85 length of database: 4,842,793,630 effective HSP length: 55 effective length of query: 30 effective length of database: 4,065,952,895 effective search space: 121978586850 effective search space used: 121978586850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 76 (33.8 bits)