BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 172 bits (436), Expect = 9e-46, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK Sbjct: 1 MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60 Query: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 ARCKYRKESKLQKLSKSKIFSIKHT Sbjct: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85 >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 63.5 bits (153), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 30/49 (61%), Positives = 38/49 (77%) Query: 18 ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66 ITR + L +++KKAFF HEKKV +LNYNA DRK NI++ Y+AR KYR Sbjct: 65 ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 >gi|254780897|ref|YP_003065310.1| trigger factor [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 24.3 bits (51), Expect = 0.46, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 37 EKKVADHL--NYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIF 80 E KV DH+ + DRK D+L+ + E L K SK + F Sbjct: 418 EDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETF 463 >gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Score = 20.4 bits (41), Expect = 5.7, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 14 LVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDR 51 L+ +I G+ + + + EKK+ L +NA R Sbjct: 622 LIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR 659 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.136 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,250 Number of Sequences: 1233 Number of extensions: 1862 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 85 length of database: 328,796 effective HSP length: 54 effective length of query: 31 effective length of database: 262,214 effective search space: 8128634 effective search space used: 8128634 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)