Query         gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 225
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 22:36:25 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781128.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1qjp_A Outer membrane protein  58.7     1.7 5.1E-05   23.3  -0.7   50  176-225   121-170 (171)
  2 >3lm7_A Putative 4-hydroxy-2-o  57.1     3.7 0.00011   21.3   0.8   19   99-117   184-202 (249)
  3 >2k0l_A Outer membrane protein  44.0     1.7   5E-05   23.4  -2.7  102  117-225    91-192 (216)
  4 >1p4t_A Outer membrane protein  24.2      11 0.00031   18.6  -1.3   48  176-225   108-155 (155)
  5 >1fuk_A Eukaryotic initiation   22.8      45  0.0013   14.8   1.8   49  166-214    69-117 (165)
  6 >2f1v_A Outer membrane protein  19.4     8.8 0.00026   19.1  -2.5   50  176-225   134-191 (197)
  7 >2jmm_A Outer membrane protein  17.5      36  0.0011   15.5   0.3   44  176-225   106-150 (156)
  8 >3hw5_A Polymerase acidic prot  16.7     6.4 0.00019   19.9  -3.7   53   28-91     22-74  (261)
  9 >3i5x_A ATP-dependent RNA heli  14.5      84  0.0025   13.2   1.6   45  169-213    83-127 (185)
 10 >2f1c_X OMPG, outer membrane p  14.2      19 0.00056   17.1  -1.8   47  176-225   234-280 (286)

No 1  
>>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} (A:)
Probab=58.69  E-value=1.7  Score=23.30  Aligned_cols=50  Identities=22%  Similarity=0.422  Sum_probs=37.2

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             76503326777775300353358896168765455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      -..|+|++-.+...++++.||||..-.+..-....-.....+++|+..||
T Consensus       121 ~~~g~G~~y~l~~~~~i~~e~~~~~~~~~~~~~~~~~~~~~~~~G~~y~F  170 (171)
T 1qjp_A          121 PVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF  170 (171)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEC--------------CEEEEEEEEEC
T ss_pred             EEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             58882799993599799999999972587655441112458999999988


No 2  
>>3lm7_A Putative 4-hydroxy-2-oxoglutarate aldolase / 2- dehydro-3-deoxyphosphogluconate aldolase...; structural genomics, PSI-2; 1.90A {Yersinia enterocolitica} (A:)
Probab=57.06  E-value=3.7  Score=21.31  Aligned_cols=19  Identities=53%  Similarity=0.901  Sum_probs=14.7

Q ss_pred             CCCEEEECCCCCCCCCCEE
Q ss_conf             4320232355777700012
Q gi|254781128|r   99 GVEGFHLEPRGGIDGDKVA  117 (225)
Q Consensus        99 gvegfhleprggidgdkva  117 (225)
                      .-+||-|||.||||-|...
T Consensus       184 a~~g~~lEPTGGIdl~N~~  202 (249)
T 3lm7_A          184 AATGFWLEPTGGIDLDNFE  202 (249)
T ss_dssp             HHTTCEEEECSSCCTTTHH
T ss_pred             HHCCCEECCCCCCCHHHHH
T ss_conf             9669355777884677799


No 3  
>>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} (A:)
Probab=44.02  E-value=1.7  Score=23.37  Aligned_cols=102  Identities=20%  Similarity=0.219  Sum_probs=54.8

Q ss_pred             EEEEEEEEEEEECCCCHHHEEEEEEEEECCHHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCE
Q ss_conf             23667641012207850100000113325232100011022202578899886410067765033267777753003533
Q gi|254781128|r  117 AGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEY  196 (225)
Q Consensus       117 agtllfrtgftfdnnnssilqntliygfggarirnimsvesadtakstirnivangfldkvigvgiekklasmlsirgey  196 (225)
                      .-.+....++.|..++.  +.--+.-|.+.+++++-....+......    -..++ ..-.+|+|++-.+...++++.||
T Consensus        91 ~~~~~~~~~y~~~~~~~--~~~y~~~G~~~~~~~~~~~~~~~~~~~~----~~~~~-~~~~~g~G~~y~l~~~~~l~~~~  163 (216)
T 2k0l_A           91 AQGVQLTAKLGYPITDD--LDIYTRLGGMVWRADSKGNYASTGVSRS----EHDTG-VSPVFAGGVEWAVTRDIATRLEY  163 (216)
T ss_dssp             CCEEEEEEEEEEESSSS--EEEEEEEEEEEEECCCCCSCCCSSSCCC----CCCEE-EEEEEEEEEEEECSSSCEEEEEE
T ss_pred             EEEEEEEEEEEEEEECC--CEEEEEEEEEEEEECCEEECCCCCCCCC----CCCCC-CCCEECCEEEEEECCCEEEEEEE
T ss_conf             88788999999862024--1177774478986011120145763211----34563-03135123799836997999999


Q ss_pred             EEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             58896168765455543067000057849
Q gi|254781128|r  197 RYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       197 ryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      ||..-.+.......--....+++|+..||
T Consensus       164 ~y~~~~~~~~~~~~~~~~~~~~~Gl~Y~F  192 (216)
T 2k0l_A          164 QWVNNIGDAGTVGTRPDNGMLSLGVSYRF  192 (216)
T ss_dssp             SSCSSCCCCSCCCCSSCSCCCEEEEEEEC
T ss_pred             EEEECCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             99953686555553233678999999999


No 4  
>>1p4t_A Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} (A:)
Probab=24.21  E-value=11  Score=18.60  Aligned_cols=48  Identities=19%  Similarity=0.284  Sum_probs=36.8

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             76503326777775300353358896168765455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      -.+|+|++-.+..-++++.||||.---+...+..  -+-..++.|+..||
T Consensus       108 ~~~g~G~~y~i~~~~~~~~~y~y~~~~~~~~~~~--~~~~~~~lGv~Y~F  155 (155)
T 1p4t_A          108 LGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKN--VRSGELSAGVRVKF  155 (155)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEEEEEETTEEE--EEEEEEEEEEEEEC
T ss_pred             EEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCC--EEEEEEEEEEEEEC
T ss_conf             1473179999458999999999997667665752--00228999999999


No 5  
>>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} (A:)
Probab=22.82  E-value=45  Score=14.84  Aligned_cols=49  Identities=16%  Similarity=0.167  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHC
Q ss_conf             9886410067765033267777753003533588961687654555430
Q gi|254781128|r  166 RNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREK  214 (225)
Q Consensus       166 rnivangfldkvigvgiekklasmlsirgeyryvacydqpwdvskwrek  214 (225)
                      |.-..+-|.+....+=+-...+|+----..-++|..||.||+.+.+-..
T Consensus        69 R~~~~~~f~~g~~~iLv~Td~~~rGid~~~v~~VInyd~P~~~~~yi~R  117 (165)
T 1fuk_A           69 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHR  117 (165)
T ss_dssp             HHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGS
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCEEEEEECCCCCHHHHHHH
T ss_conf             9999999970898689861200146647773488872699999997057


No 6  
>>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A (A:)
Probab=19.42  E-value=8.8  Score=19.07  Aligned_cols=50  Identities=14%  Similarity=0.008  Sum_probs=34.2

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEECCCCC--------HHHHHHCCCCCEEEEEEC
Q ss_conf             76503326777775300353358896168765--------455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACYDQPWD--------VSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacydqpwd--------vskwrekgdftagvvlrf  225 (225)
                      -..|+|.+-+|..-++++.||||..-.+....        ....-.-..+++|+..||
T Consensus       134 ~~~g~G~~y~l~~~~~l~~eyry~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~Y~F  191 (197)
T 2f1v_A          134 AAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF  191 (197)
T ss_dssp             EEEEEEEEEECSSSEEEEEEEEEECCEEEEEEEESSCCCCEEEECCCEEEEEEEEEEE
T ss_pred             EEEECCEEEECCCCEEEEEEEEEEECCCCEEEECCCCCCCEEEEECCEEEEEEEEEEE
T ss_conf             8997348999079839999999997455157842886311048727138999999996


No 7  
>>2jmm_A Outer membrane protein A; NMR {Escherichia coli} (A:)
Probab=17.50  E-value=36  Score=15.46  Aligned_cols=44  Identities=23%  Similarity=0.288  Sum_probs=31.7

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEE-CCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             765033267777753003533588961-68765455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACY-DQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacy-dqpwdvskwrekgdftagvvlrf  225 (225)
                      -..|+|++-.+..-++++.||||..-. |..+|.      ..+++|+..||
T Consensus       106 ~~~g~G~~y~l~~~~~l~~e~~~~~~~~d~~~~~------~~~~~Gl~Y~F  150 (156)
T 2jmm_A          106 PVFAGGVEYVIRRRITPEIATRLEYQWTNNASDN------GMLSLGVSYRF  150 (156)
T ss_dssp             EEEEEEEEEECSSSCSSSEEEEEEEEEESSSSCE------EEEEEEEEEES
T ss_pred             EEEEEEEEEEECCCCCCCEEEEEEEEEECCCCCC------CEEEEEEEEEC
T ss_conf             7799899998642647343799999982688877------77999899998


No 8  
>>3hw5_A Polymerase acidic protein; avian influenza virus, PA_N, AMP, phosphoprotein, hydrolase; HET: AMP; 1.81A {Influenza a virus} PDB: 3hw3_A* 3hw6_A 3ebj_A 2w69_A (A:)
Probab=16.72  E-value=6.4  Score=19.92  Aligned_cols=53  Identities=23%  Similarity=0.408  Sum_probs=34.6

Q ss_pred             HHHHHHCCCCCCCCCEEEEEECCHHHCEEEEEECHHHCCCCCCEEEEEEEECCEEEEECCCCCC
Q ss_conf             0012201476875311487513011011477632211244486155123323247663177750
Q gi|254781128|r   28 SSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGT   91 (225)
Q Consensus        28 ssaamadygyspqfqptimvsnfakfkglyvaadfskidhqspvrlqnlslngvsigldgqdgt   91 (225)
                      ...+|+.||-.|..||.....--..+.--|+-.||.-||.           +|-|+-+++||-.
T Consensus        22 Ak~tm~Eygedp~~~~~k~~~Ic~HleVC~m~sD~~fl~e-----------~G~s~~iE~~d~n   74 (261)
T 3hw5_A           22 AEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDE-----------RGESTIIESGDPN   74 (261)
T ss_dssp             HHHHHHHTTCCTTTSHHHHHHHHHHHHHHHHHC-------------------------------
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHEEEEEEECCHHHCC-----------CCCEEEECCCCCC
T ss_conf             9999998377833016789998756313466502100134-----------7852230378810


No 9  
>>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, helicase, hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* (A:302-486)
Probab=14.49  E-value=84  Score=13.24  Aligned_cols=45  Identities=9%  Similarity=0.042  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHH
Q ss_conf             641006776503326777775300353358896168765455543
Q gi|254781128|r  169 VANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWRE  213 (225)
Q Consensus       169 vangfldkvigvgiekklasmlsirgeyryvacydqpwdvskwre  213 (225)
                      +-+.|-..-+.+-+-...+++----..-++|.+||.||..+.+..
T Consensus        83 ~~~~f~~g~~~ilv~t~~~~~Gid~~~~~~Vi~~~~p~~~~~~~Q  127 (185)
T 3i5x_A           83 LVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIH  127 (185)
T ss_dssp             HHHHHHHCSSEEEEECGGGTSSCCCTTCCEEEEESCCSSTTHHHH
T ss_pred             HHHHHHHCCEEEEEEEEHHCCCCCCCCCCEEEEECCCCCHHHHHH
T ss_conf             776532010001577421004657677888999699999999871


No 10 
>>2f1c_X OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2jqy_A 2iwv_A* 2iww_A* (X:)
Probab=14.19  E-value=19  Score=17.11  Aligned_cols=47  Identities=19%  Similarity=0.126  Sum_probs=31.3

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             76503326777775300353358896168765455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      ..+++|+|-++...+++|++|.|--.   |.+...-..-.-|+.|+-.+|
T Consensus       234 ~~~~~G~ey~~~~~~~lr~gy~y~~~---~~~~~~~~~~~~~~lG~~y~f  280 (286)
T 2f1c_X          234 NRVGLFYGYDFQNGLSVSLEYAFEWQ---DHDEGDSDKFHYAGVGVNYSF  280 (286)
T ss_dssp             EEEEEEEEEECSSSEEEEEEEEEEEC---C------CCEEEEEEEEEEEE
T ss_pred             EEEEEEEEEEECCCEEEEEEEEEEEC---CCCCCCCCEEEEEEEEEEEEE
T ss_conf             49999996340796699999999972---554788857894788678998


Done!