Query         gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 225
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 00:57:44 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781128.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1p4t_A Outer membrane protein   73.9     2.9 0.00012   21.0   3.8  152   54-225     4-155 (155)
  2 2k0l_A Outer membrane protein   58.1    0.52 2.2E-05   25.5  -2.7   49  177-225   144-192 (216)
  3 3m0z_A Putative aldolase; MCSG  56.0     2.8 0.00012   21.1   0.8   17   99-115   184-200 (249)
  4 3m6y_A 4-hydroxy-2-oxoglutarat  54.1     2.9 0.00012   21.1   0.6   16  101-116   209-224 (275)
  5 1qjp_A Outer membrane protein   46.1     2.3 9.7E-05   21.6  -0.9   49  177-225   122-170 (171)
  6 1orm_A Outer membrane protein   34.2     2.5  0.0001   21.5  -2.3   43  175-225   106-148 (148)
  7 2f1v_A Outer membrane protein   30.1     4.7  0.0002   19.8  -1.4   50  176-225   134-191 (197)
  8 2jtn_A LIM domain-binding prot  22.4      32  0.0013   14.9   1.7   40   38-82      1-40  (182)
  9 1a9x_B Carbamoyl phosphate syn  19.8      45  0.0019   14.0   3.0   29   87-127     8-36  (379)
 10 2jgn_A DBX, DDX3, ATP-dependen  19.4      28  0.0012   15.1   0.9   18  195-212   114-131 (185)

No 1  
>1p4t_A Outer membrane protein NSPA; beta barrel; HET: CXE; 2.55A {Neisseria meningitidis} SCOP: f.4.1.1
Probab=73.93  E-value=2.9  Score=21.04  Aligned_cols=152  Identities=17%  Similarity=0.162  Sum_probs=72.5

Q ss_pred             CEEEEEECHHHCCCCCCEEEEEEEECCEEEEECCCCCCEEEECCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEECCCCH
Q ss_conf             11477632211244486155123323247663177750786111243202323557777000123667641012207850
Q gi|254781128|r   54 KGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNS  133 (225)
Q Consensus        54 kglyvaadfskidhqspvrlqnlslngvsigldgqdgtlvygaslgvegfhleprggidgdkvagtllfrtgftfdnnns  133 (225)
                      -|.||.++....+-.+.+.-.+=-.-++++|.+=.+  +    .+++|-.+......-.++--..++....-+.|+.+. 
T Consensus         4 ~Gfyv~~~~g~~~~~~~~~~~~g~~~~~~~GY~f~~--~----~~e~~y~~~~~~~~~~~~~~~~~~~l~~~y~~~~~~-   76 (155)
T 1p4t_A            4 SGFYVQADAAHAKASSSLGSAKGFSPRISAGYRIND--L----RFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQS-   76 (155)
T ss_dssp             EEEEEEEEEEEEEEECSSCEEEEECCEEEEEEEETT--E----EEEEEEEEEEESSCCSSCCEEEEEEEEEEEECCCSS-
T ss_pred             CCEEEEEEEEEECCCCCCCCCCCEEEEEEEEEECCC--E----EEEEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCC-
T ss_conf             433896875470244677878857689999998279--9----999999982455678863578999999999843677-


Q ss_pred             HHEEEEEEEEECCHHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHH
Q ss_conf             10000011332523210001102220257889988641006776503326777775300353358896168765455543
Q gi|254781128|r  134 SILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWRE  213 (225)
Q Consensus       134 silqntliygfggarirnimsvesadtakstirnivangfldkvigvgiekklasmlsirgeyryvacydqpwdvskwre  213 (225)
                       -+.--+--|.+.+++..    ......+.      ...-.--..|+|++-.+..-++++.||||..--+...  .+.-.
T Consensus        77 -~~~py~~~G~g~~~~~~----~~~~~~~~------~~~~~~~~~g~G~~y~~~~~~~~~~ey~y~~~~~~~~--~~~~~  143 (155)
T 1p4t_A           77 -PVKPYLGARLSLNRASV----DLGGSDSF------SQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNT--VKNVR  143 (155)
T ss_dssp             -SEEEEEEEEEEEEEEEE----EETTEEEE------CCCEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEETT--EEEEE
T ss_pred             -CEEEEEEEEEEEEEEEC----CCCCCCCC------CCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCCCCC--CCCEE
T ss_conf             -57799996578999871----43330014------7850604751149997178999999999987678766--74300


Q ss_pred             CCCCCEEEEEEC
Q ss_conf             067000057849
Q gi|254781128|r  214 KGDFTAGVVLRF  225 (225)
Q Consensus       214 kgdftagvvlrf  225 (225)
                      -..++.|+--+|
T Consensus       144 ~~~~~~Gl~Y~F  155 (155)
T 1p4t_A          144 SGELSAGVRVKF  155 (155)
T ss_dssp             EEEEEEEEEEEC
T ss_pred             EEEEEEEEEEEC
T ss_conf             369999999999


No 2  
>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae}
Probab=58.12  E-value=0.52  Score=25.51  Aligned_cols=49  Identities=27%  Similarity=0.411  Sum_probs=35.2

Q ss_pred             HHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             6503326777775300353358896168765455543067000057849
Q gi|254781128|r  177 VIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       177 vigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      -.|+|++-++..-+++|.||||..-.+..+....-.+-..++.||..||
T Consensus       144 ~~G~G~~y~l~~~~s~~~ey~y~~~~~~~~~~~~~~d~~~~~~Gv~Y~F  192 (216)
T 2k0l_A          144 VFAGGVEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRF  192 (216)
T ss_dssp             EEEEEEEEECSSSCEEEEEESSCSSCCCCSCCCCSSCSCCCEEEEEEEC
T ss_pred             EECCEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             0422279970799799999999964687655452222678999999999


No 3  
>3m0z_A Putative aldolase; MCSG, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, lyase; HET: MSE; 1.20A {Klebsiella pneumoniae subsp} PDB: 3nzr_A 3lm7_A
Probab=56.01  E-value=2.8  Score=21.13  Aligned_cols=17  Identities=47%  Similarity=0.849  Sum_probs=13.3

Q ss_pred             CCCEEEECCCCCCCCCC
Q ss_conf             43202323557777000
Q gi|254781128|r   99 GVEGFHLEPRGGIDGDK  115 (225)
Q Consensus        99 gvegfhleprggidgdk  115 (225)
                      .-+||-|||.||||-|.
T Consensus       184 a~~g~~lEPTGGId~~N  200 (249)
T 3m0z_A          184 AAHDFWLEPTGGIDLEN  200 (249)
T ss_dssp             HHTTCEEEEBSSCCTTT
T ss_pred             HHCCCEECCCCCCCHHH
T ss_conf             97691676679857888


No 4  
>3m6y_A 4-hydroxy-2-oxoglutarate aldolase; structural genomics, MCSG, lyase, PSI-2, protein structure initiative; HET: MSE; 1.45A {Bacillus cereus} PDB: 3n73_A 3mux_A
Probab=54.13  E-value=2.9  Score=21.06  Aligned_cols=16  Identities=63%  Similarity=1.161  Sum_probs=9.6

Q ss_pred             CEEEECCCCCCCCCCE
Q ss_conf             2023235577770001
Q gi|254781128|r  101 EGFHLEPRGGIDGDKV  116 (225)
Q Consensus       101 egfhleprggidgdkv  116 (225)
                      +||-|||.||||-|..
T Consensus       209 ~gf~lEPTGGIdl~Nf  224 (275)
T 3m6y_A          209 EGFALEPTGGIDKENF  224 (275)
T ss_dssp             HTCEEEEBSSCCTTTH
T ss_pred             CCCEECCCCCCCHHHH
T ss_conf             5950366788467779


No 5  
>1qjp_A Outer membrane protein A; HET: C8E; 1.65A {Escherichia coli} SCOP: f.4.1.1 PDB: 1bxw_A* 1g90_A 2ge4_A
Probab=46.05  E-value=2.3  Score=21.63  Aligned_cols=49  Identities=22%  Similarity=0.435  Sum_probs=34.0

Q ss_pred             HHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             6503326777775300353358896168765455543067000057849
Q gi|254781128|r  177 VIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       177 vigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      ..|+|++-.+..-+++|.||||..-.+.......-.+-..+++|+-.||
T Consensus       122 ~~g~G~~y~~~~~~~l~~~y~y~~~~~~~~~~~~~~~~~~~~lG~~y~F  170 (171)
T 1qjp_A          122 VFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF  170 (171)
T ss_dssp             EEEEEEEEEEETTEEEEEEEEEEC--------------CEEEEEEEEEC
T ss_pred             EEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             8981699992699899999999971587655442100458999999988


No 6  
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A
Probab=34.25  E-value=2.5  Score=21.47  Aligned_cols=43  Identities=21%  Similarity=0.289  Sum_probs=30.5

Q ss_pred             HHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             776503326777775300353358896168765455543067000057849
Q gi|254781128|r  175 DKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       175 dkvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      .-..|+|+|-.+..-+++|.||+|..--|  .      .-.-|+.|+--||
T Consensus       106 ~~~~G~Gvey~lt~n~~~~~eY~~~~~~~--~------d~~~~~vGv~Y~F  148 (148)
T 1orm_A          106 GFSYGAGLQFNPMENVALDFSYEQSRIRS--V------DVGTWIAGVGYRF  148 (148)
T ss_dssp             CCEECCCCCCCCSSSCBCCCCCCCCCSSS--C------CCCCCCCCCBCCC
T ss_pred             CEEEECEEEEEECCCEEEEEEEEEEECCC--C------CEEEEEEEEEEEC
T ss_conf             15581308998658879999999970799--6------1216999989989


No 7  
>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A
Probab=30.12  E-value=4.7  Score=19.78  Aligned_cols=50  Identities=14%  Similarity=0.062  Sum_probs=31.2

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEE-----ECCCCCHHHHHHCC---CCCEEEEEEC
Q ss_conf             76503326777775300353358896-----16876545554306---7000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVAC-----YDQPWDVSKWREKG---DFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvac-----ydqpwdvskwrekg---dftagvvlrf  225 (225)
                      -..|+|.|-.+..-++++.||||..-     +.......+.+-+-   .+++|+..||
T Consensus       134 ~~~g~G~~Y~i~~~~sl~~eyry~~~~~~~~~~~~~~~~~~~~~~d~~~~~~Gv~YrF  191 (197)
T 2f1v_A          134 AAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF  191 (197)
T ss_dssp             EEEEEEEEEECSSSEEEEEEEEEECCEEEEEEEESSCCCCEEEECCCEEEEEEEEEEE
T ss_pred             EEEECCEEEEECCCEEEEEEEEEEECCCCEEEECCCCCEEEEEEECCEEEEEEEEEEE
T ss_conf             8996248999179839999999997556057842886200058637259999899996


No 8  
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus}
Probab=22.37  E-value=32  Score=14.87  Aligned_cols=40  Identities=20%  Similarity=0.346  Sum_probs=30.8

Q ss_pred             CCCCCEEEEEECCHHHCEEEEEECHHHCCCCCCEEEEEEEECCEE
Q ss_conf             875311487513011011477632211244486155123323247
Q gi|254781128|r   38 SPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVS   82 (225)
Q Consensus        38 spqfqptimvsnfakfkglyvaadfskidhqspvrlqnlslngvs   82 (225)
                      |.|++++++|+.=+     .....|...|+++|.|+++-..+..+
T Consensus         1 ~~~~~~~~~~~~ps-----l~gg~~~~~de~~~~r~e~~q~~~~~   40 (182)
T 2jtn_A            1 SSQVPDVMVVGEPT-----LMGGEFGDEDERLITRLENTQFDAAN   40 (182)
T ss_dssp             CCCCCSCEECCCCC-----CCCCCCCTTTSCCCEEEECSCTTSSS
T ss_pred             CCCCCCEEEECCCC-----CCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             98668627846854-----46777786677540002115886545


No 9  
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B*
Probab=19.78  E-value=45  Score=13.97  Aligned_cols=29  Identities=34%  Similarity=0.635  Sum_probs=20.5

Q ss_pred             CCCCCEEEECCCCCCEEEECCCCCCCCCCEEEEEEEEEEEE
Q ss_conf             77750786111243202323557777000123667641012
Q gi|254781128|r   87 GQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFT  127 (225)
Q Consensus        87 gqdgtlvygaslgvegfhleprggidgdkvagtllfrtgft  127 (225)
                      =+|||...|-+.|.+|            .+.|.+.|-|+.|
T Consensus         8 LedGt~f~G~~fG~~~------------~~~GEvVFnT~Mt   36 (379)
T 1a9x_B            8 LEDGTQFHGRAIGATG------------SAVGEVVFNTSMT   36 (379)
T ss_dssp             ETTSCEEEEEECSCSE------------EEEEEEEEECCSS
T ss_pred             ECCCCEEEEEEECCCC------------CEEEEEEEECCCC
T ss_conf             5799999889817788------------6788999979978


No 10 
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, acetylation, ATP-binding, DNA-binding; 1.91A {Homo sapiens}
Probab=19.38  E-value=28  Score=15.14  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=12.5

Q ss_pred             CEEEEEEECCCCCHHHHH
Q ss_conf             335889616876545554
Q gi|254781128|r  195 EYRYVACYDQPWDVSKWR  212 (225)
Q Consensus       195 eyryvacydqpwdvskwr  212 (225)
                      +-++|..||-||++..+-
T Consensus       114 ~v~~VI~yd~P~~~~~yi  131 (185)
T 2jgn_A          114 NVKHVINFDLPSDIEEYV  131 (185)
T ss_dssp             SBSEEEESSCCSSHHHHH
T ss_pred             CCCEEEEECCCCCHHHHH
T ss_conf             886589924994688885


Done!